F444450

General Info

Members Datasets Scaffolds Average Seq Length
440 365 220 484

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10000078|Ga0265323_1000007847
Length 513
Sequence MQTPPDIRLLLAVLAPLVGAGLVMLTGRKANLRETCSFLAAATLFGIVISMIPCVRAGHTLHFTLFQLLPGLSFSLRADGLSMIFAVTASFLWMVAVFYSAGYMRSLNEHAQTRFNACFALALFGAIGCAFSDNLLTLYLFYEIVSITTYPLVAHHQDEEGYEGGKKYLVYLTTTAKGLILPAMVLIYVLSGTLDFATNAHVGILPPHVHNGVIIILYICCILGFAKNGVMPLHNWLPSAMVAPTPVSALLHAVAVVKVGVFATVRVMLYVFGVDLMDRLHLGPPTAYFVSITILVGSIIALSKDNLKARLAYSTVSQLSYIILGVALLTPTGVAGGLFHIAAHAFSKITLFFCAGAIYVTTHKKNISEMSGLGRAMPWTFGAFALASLSMIGVPPVGGFISKLYLLVGALDAGSIGILIVLLASSLLNAAYFVPVVYKAYFGQVPAEDAAPNLKSEISDLKSAAHGPVHAPAVRHGEAPLAMLIPLCVTAVISVAIGLYPDFFMQFASAVLP

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
11 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
12 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
13 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
14 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
17 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
18 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
19 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
20 2516143018 Ensifer sp. BR816 Isolate Nodule
21 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
22 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
23 2519899620 Rhizobium sp. Pop5 Isolate Nodule
24 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
25 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
26 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
27 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
28 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
29 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
30 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
31 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
32 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
33 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
34 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
35 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
36 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
37 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
38 2643221557 Ensifer sp. Root558 Isolate Unclassified
39 2643221610 Ensifer sp. Root74 Isolate Unclassified
40 2643221618 Ensifer sp. Root231 Isolate Unclassified
41 2643221626 Ensifer sp. Root31 Isolate Unclassified
42 2643221655 Ensifer sp. Root1252 Isolate Unclassified
43 2643221659 Ensifer sp. Root127 Isolate Unclassified
44 2643221668 Ensifer sp. Root423 Isolate Unclassified
45 2643221675 Ensifer sp. Root1298 Isolate Unclassified
46 2643221680 Ensifer sp. Root1312 Isolate Unclassified
47 2643221698 Ensifer sp. Root142 Isolate Unclassified
48 2643221712 Ensifer sp. Root258 Isolate Unclassified
49 2643221723 Ensifer sp. Root278 Isolate Unclassified
50 2643221726 Ensifer sp. Root954 Isolate Unclassified
51 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
52 2718217882 Rhizobium sp. N741 Isolate Nodule
53 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
54 2718218009 Rhizobium sp. N561 Isolate Nodule
55 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
56 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
57 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
58 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
59 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
60 2718218363 Rhizobium sp. N113 Isolate Nodule
61 2718218365 Rhizobium sp. N731 Isolate Nodule
62 2718218366 Rhizobium sp. N621 Isolate Nodule
63 2721755514 Rhizobium sp. N6212 Isolate Nodule
64 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
65 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
66 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
67 2721755810 Rhizobium sp. N871 Isolate Nodule
68 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
69 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
70 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
71 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
72 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
73 2728369365 Rhizobium sp. N1341 Isolate Nodule
74 2728369397 Rhizobium sp. N1314 Isolate Nodule
75 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
76 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
77 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
78 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
79 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
80 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
81 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
82 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
83 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
84 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
85 2791355256 Rhizobium sp. M10 Isolate Nodule
86 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
87 2791355260 Rhizobium sp. L9 Isolate Nodule
88 2791355262 Rhizobium sp. M1 Isolate Nodule
89 2791355263 Rhizobium chutanense C5 Isolate Nodule
90 2791355264 Rhizobium sp. S9 Isolate Nodule
91 2791355265 Rhizobium sp. H4 Isolate Nodule
92 2791355266 Rhizobium sp. L43 Isolate Nodule
93 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
94 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
95 2802429637 Rhizobium anhuiense C15 Isolate Nodule
96 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
97 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
98 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
99 2838048938 Rhizobium pisi 27/80 Isolate Nodule
100 2838061910 Rhizobium phaseoli L15 Isolate Nodule
101 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
102 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
103 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
104 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
105 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
106 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
107 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
108 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
109 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
110 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
111 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
112 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
113 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
114 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
115 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
116 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
117 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
118 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
119 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
120 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
121 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
122 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
123 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
124 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
125 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
126 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
127 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
128 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
129 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
130 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
131 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
132 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
133 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
134 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
135 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
136 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
137 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
138 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
139 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
140 2844163670 Ensifer sp. 1H6 Isolate Unclassified
141 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
142 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
143 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
144 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
145 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
146 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
147 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
148 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
149 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
150 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
151 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
152 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
153 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
154 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
155 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
156 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
157 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
158 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
159 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
160 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
161 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
162 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
163 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
164 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
165 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
166 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
167 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
168 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
169 2933599457 Rhizobium phaseoli M3 Isolate Nodule
170 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
171 2936381700 Rhizobium chutanense C16 Isolate Unclassified
172 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
173 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
174 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
175 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
176 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
177 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
178 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
179 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
180 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
181 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
182 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
183 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
184 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
185 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
186 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
187 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
188 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
189 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
190 2996887358 Rhizobium sp. R711 Isolate Nodule
191 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
192 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
193 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
194 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
195 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
196 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
197 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
198 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
199 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
200 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
201 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
202 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
203 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
204 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
205 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
206 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
207 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
208 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
209 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
210 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
211 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
212 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
213 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
214 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
215 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
216 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
217 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
218 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
219 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
220 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
221 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
222 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
223 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
224 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
225 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
226 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
227 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
228 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
229 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
231 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
233 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
235 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
238 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
243 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
244 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
245 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
246 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
247 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
248 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
249 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
250 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
251 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
256 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
257 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
258 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
259 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
262 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
263 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
265 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
270 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
273 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
274 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
275 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
276 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
277 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
278 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
279 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
280 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
281 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
282 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
283 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
284 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
285 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
286 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
287 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
288 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
289 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
335 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
338 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
339 8005258706 Rhizobium sp. R693 Isolate Nodule
340 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
341 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
342 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
343 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
344 8005321885 Rhizobium sp. R72 Isolate Nodule
345 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
346 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
347 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
348 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
349 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
350 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
351 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
352 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
353 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
354 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
355 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
356 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
357 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
358 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
359 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
360 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
361 8024501048 Rhizobium sp. H4 Isolate Nodule
362 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
363 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
364 8056382006 Rhizobium croatiense 13T Isolate Nodule
365 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.77
Metatranscriptomes 0.23
Isolates 50

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.45
Nodule 39.32
Rhizoplane 1.36
Rhizosphere 27.05
Stem 0
Stem Tuber 0
Unclassified 16.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000614 3300002739 Bacteria 7074
2 JGI25152J39213_1003835 3300002773 Bacteria 4971
3 JGI25150J39212_1002527 3300002774 Bacteria 4517
4 JGI25159J45721_1000012 3300002987 Bacteria 149808
5 JGI25151J46595_10019297 3300003187 Bacteria 2899
6 JGI25153J46596_10001503 3300003215 Bacteria 13900
7 rootH1_10147169 3300003323 Bacteria 4225
8 JGI25160J50197_1000042 3300003354 Bacteria 149808
9 JGI25160J50197_1000068 3300003354 Bacteria 112790
10 JGI25160J50197_1010197 3300003354 Bacteria 3413
11 JGI25161J50226_1000048 3300003374 Bacteria 112790
12 JGI25161J50226_1000254 3300003374 Bacteria 31906
13 Ga0055526_1000937 3300003771 Bacteria 21604
14 Ga0055526_1000940 3300003771 Bacteria 21580
15 Ga0055526_1003780 3300003771 Bacteria 9437
16 Ga0055526_1007407 3300003771 Bacteria 5709
17 Ga0055524_1000743 3300003775 Bacteria 22166
18 Ga0055524_1001241 3300003775 Bacteria 15020
19 Ga0055524_1001337 3300003775 Bacteria 14373
20 Ga0055536_1007787 3300003781 Bacteria 4729
21 Ga0055528_1000382 3300003790 Bacteria 36003
22 Ga0055528_1000681 3300003790 Bacteria 24503
23 Ga0055540_1006983 3300003792 Bacteria 4360
24 Ga0055531_10011309 3300003794 Bacteria 4324
25 Ga0055543_1000046 3300004625 Bacteria 113628
26 Ga0055543_1000452 3300004625 Bacteria 24678
27 Ga0065165_1000174 3300005262 Bacteria 113769
28 Ga0065165_1000175 3300005262 Bacteria 113628
29 Ga0065165_1004083 3300005262 Bacteria 9454
30 Ga0070713_100067981 3300005436 Bacteria 3002
31 Ga0070706_100003848 3300005467 Bacteria 14668
32 Ga0070697_100002486 3300005536 Bacteria 14171
33 Ga0081538_10010602 3300005981 Bacteria 7543
34 Ga0075369_10001995 3300006186 Bacteria 7180
35 Ga0075431_100053167 3300006847 Bacteria 4176
36 Ga0105240_10002417 3300009093 Bacteria 30006
37 Ga0105248_10206795 3300009177 Bacteria 2212
38 Ga0105249_10262766 3300009553 Bacteria 1716
39 Ga0123341_1000053 3300009765 Bacteria 49025
40 Ga0123342_1025567 3300009766 Bacteria 3541
41 Ga0171463_1005 3300013249 Bacteria 358236
42 Ga0183363_1026 3300015690 Bacteria 53052
43 Ga0214542_1000014 3300021321 Bacteria 233825
44 Ga0214543_1000146 3300021327 Bacteria 98609
45 Ga0228711_1000772 3300022739 Bacteria 42689
46 Ga0228710_1000936 3300022740 Bacteria 41455
47 Ga0209436_100252 3300025208 Bacteria 24622
48 Ga0207425_1002487 3300025245 Bacteria 6473
49 Ga0209129_1000595 3300025258 Bacteria 24695
50 Ga0209129_1001590 3300025258 Bacteria 12417
51 Ga0209673_1000063 3300025273 Bacteria 256709
52 Ga0209673_1000582 3300025273 Bacteria 57776
53 Ga0209130_1000075 3300025284 Bacteria 171698
54 Ga0209130_1000144 3300025284 Bacteria 114000
55 Ga0209676_1005076 3300025292 Bacteria 7032
56 Ga0209025_1000747 3300025294 Bacteria 54721
57 Ga0209025_1002615 3300025294 Bacteria 18501
58 Ga0209025_1004085 3300025294 Bacteria 13023
59 Ga0209025_1048006 3300025294 Bacteria 1736
60 Ga0209564_1000278 3300025295 Bacteria 105405
61 Ga0209564_1000482 3300025295 Bacteria 66363
62 Ga0209564_1000483 3300025295 Bacteria 66253
63 Ga0209564_1014782 3300025295 Bacteria 3220
64 Ga0209564_1024888 3300025295 Bacteria 2032
65 Ga0209758_1001643 3300025297 Bacteria 25398
66 Ga0209758_1001926 3300025297 Bacteria 22572
67 Ga0209758_1006386 3300025297 Bacteria 8508
68 Ga0209758_1011479 3300025297 Bacteria 5121
69 Ga0209050_1009795 3300025298 Bacteria 4831
70 Ga0209256_1000175 3300025299 Bacteria 127671
71 Ga0209256_1000411 3300025299 Bacteria 67351
72 Ga0209256_1002040 3300025299 Bacteria 17941
73 Ga0209256_1002344 3300025299 Bacteria 15777
74 Ga0209256_1028927 3300025299 Bacteria 1553
75 Ga0207426_1000126 3300025302 Bacteria 213341
76 Ga0207426_1000163 3300025302 Bacteria 171698
77 Ga0207426_1002356 3300025302 Bacteria 12299
78 Ga0209051_1000688 3300025303 Bacteria 37461
79 Ga0209051_1004276 3300025303 Bacteria 8888
80 Ga0209051_1015500 3300025303 Bacteria 3502
81 Ga0209051_1018717 3300025303 Bacteria 3053
82 Ga0209257_1003204 3300025304 Bacteria 14482
83 Ga0207684_10002231 3300025910 Bacteria 19754
84 Ga0207695_10025137 3300025913 Bacteria 6678
85 Ga0209281_1003793 3300027111 Bacteria 4793
86 Ga0209282_1000038 3300027666 Bacteria 128955
87 Ga0265337_1028839 3300028556 Bacteria 1663
88 Ga0265319_1006605 3300028563 Bacteria 5352
89 Ga0265334_10004098 3300028573 Bacteria 6535
90 Ga0265323_10000078 3300028653 Bacteria 54941
91 Ga0265323_10000525 3300028653 Bacteria 21261
92 Ga0265323_10001066 3300028653 Bacteria 14201
93 Ga0265323_10001853 3300028653 Bacteria 10010
94 Ga0265323_10011932 3300028653 Bacteria 3492
95 Ga0265322_10000870 3300028654 Bacteria 10720
96 Ga0265322_10002866 3300028654 Bacteria 5264
97 Ga0265338_10041746 3300028800 Bacteria 4286
98 Ga0265330_10010402 3300031235 Bacteria 4387
99 Ga0265330_10021759 3300031235 Bacteria 2922
100 Ga0265329_10010783 3300031242 Bacteria 3342
101 Ga0265316_10005522 3300031344 Bacteria 12267
102 Ga0265316_10020682 3300031344 Bacteria 5594
103 Ga0265316_10062613 3300031344 Bacteria 2887
104 Ga0265316_10148982 3300031344 Bacteria 1753
105 Ga0307513_10031148 3300031456 Bacteria 6046
106 Ga0265313_10002649 3300031595 Bacteria 15218
107 Ga0265314_10000827 3300031711 Bacteria 36791
108 Ga0265342_10006443 3300031712 Bacteria 8740
109 Ga0265342_10054175 3300031712 Bacteria 2384
110 Ga0316576_10005038 3300031727 Bacteria 8004
111 Ga0316576_10005680 3300031727 Bacteria 7668
112 Ga0316577_10062488 3300031733 Bacteria 2080
113 Ga0316577_10102560 3300031733 Bacteria 1604
114 Ga0315914_1000204 3300031967 Bacteria 62058
115 Ga0307414_10054249 3300032004 Bacteria 2800
116 Ga0315913_1002007 3300033430 Bacteria 23344
117 Ga0315915_1000018 3300033464 Bacteria 129799
118 Ga0316588_1006590 3300033528 Bacteria 2326
119 Ga0373951_0015777 3300035091 Bacteria 1703
120 Ga0316574_0001421 3300035398 Bacteria 11365
121 Ga0373935_0010935 3300035692 Bacteria 5448
122 Ga0373927_0002558 3300035695 Bacteria 13250
123 Ga0373947_0009151 3300035725 Bacteria 5693
124 Ga0316582_0037637 3300036647 Unclassified 3001
125 Ga0316584_0006478 3300036712 Bacteria 7926
126 Ga0316584_0016808 3300036712 Bacteria 5250
127 Ga0373925_0003541 3300037068 Bacteria 12045
128 Ga0316581_0032391 3300037588 Bacteria 1577
129 Ga0400489_50987 3300039093 Bacteria 4128
130 Ga0400487_04521 3300039110 Bacteria 3259
131 Ga0451787_467073 3300041441 Bacteria 2997
132 Ga0451833_0809093 3300041491 Bacteria 10915
133 Ga0451833_1349069 3300041491 Bacteria 4932
134 Ga0451835_1219436 3300041492 Bacteria 14211
135 Ga0451837_0491498 3300041494 Bacteria 10339
136 Ga0451837_0728896 3300041494 Bacteria 13644
137 Ga0451839_0279842 3300041496 Bacteria 13622
138 Ga0451839_0605596 3300041496 Bacteria 10455
139 Ga0451841_0059912 3300041498 Bacteria 5971
140 Ga0451841_1265487 3300041498 Bacteria 13808
141 Ga0451845_0008211 3300041501 Bacteria 8934
142 Ga0451845_0426837 3300041501 Bacteria 15058
143 Ga0451847_0179584 3300041503 Bacteria 9854
144 Ga0451847_0188111 3300041503 Bacteria 4742
145 Ga0451849_0219991 3300041505 Bacteria 13716
146 Ga0451849_0568095 3300041505 Bacteria 10170
147 Ga0451851_0569716 3300041507 Bacteria 13642
148 Ga0451851_0620637 3300041507 Bacteria 13782
149 Ga0451843_0440648 3300041509 Bacteria 11203
150 Ga0451843_0871954 3300041509 Bacteria 14212
151 Ga0451855_0953101 3300041511 Bacteria 5654
152 Ga0451853_0083577 3300041512 Bacteria 17439
153 Ga0451577_0000245 3300042876 Bacteria 106824
154 Ga0451577_0001284 3300042876 Bacteria 34527
155 Ga0451577_0005240 3300042876 Bacteria 13337
156 Ga0451577_0022140 3300042876 Bacteria 5804
157 Ga0439440_0006056 3300042993 Bacteria 2423
158 Ga0453684_0000001 3300044712 Bacteria 2623166
159 Ga0453684_0000250 3300044712 Bacteria 232163
160 Ga0453684_0000644 3300044712 Bacteria 126030
161 Ga0453684_0000807 3300044712 Bacteria 106824
162 Ga0453684_0006016 3300044712 Bacteria 23491
163 Ga0453684_0008845 3300044712 Bacteria 17849
164 Ga0453684_0014193 3300044712 Bacteria 12792
165 Ga0453684_0018850 3300044712 Bacteria 10558
166 Ga0453684_0071912 3300044712 Bacteria 4370
167 Ga0453684_0095522 3300044712 Bacteria 3653
168 Ga0453684_0183374 3300044712 Bacteria 2455
169 Ga0451576_0000538 3300045051 Bacteria 81512
170 Ga0451576_0004789 3300045051 Bacteria 17345
171 Ga0451576_0020773 3300045051 Bacteria 7147
172 Ga0451576_0023613 3300045051 Bacteria 6656
173 Ga0451576_0078892 3300045051 Bacteria 3426
174 Ga0495629_0050248 3300046459 Bacteria 2921
175 Ga0495585_0003955 3300046492 Bacteria 9788
176 Ga0495583_0033923 3300046506 Bacteria 2450
177 Ga0495630_0000339 3300046517 Bacteria 37123
178 Ga0495643_0020699 3300046522 Bacteria 3787
179 Ga0495666_0004195 3300046526 Bacteria 7269
180 Ga0495665_0031837 3300046531 Bacteria 2822
181 Ga0495586_0000228 3300046535 Bacteria 37266
182 Ga0495622_0084454 3300046557 Bacteria 1460
183 Ga0495633_0035957 3300046558 Bacteria 2375
184 Ga0495625_0008785 3300046660 Bacteria 8557
185 Ga0495625_0056357 3300046660 Bacteria 2798
186 Ga0495660_0019334 3300046810 Bacteria 3910
187 Ga0495604_0091767 3300047317 Bacteria 2251
188 Ga0495636_0072802 3300047318 Bacteria 1469
189 Ga0495684_0136454 3300047471 Bacteria 1841
190 Ga0496101_0159355 3300048904 Bacteria 1730
191 Ga0496104_0011451 3300048907 Bacteria 7948
192 Ga0496111_0124259 3300048914 Bacteria 1907
193 Ga0496116_0045876 3300048919 Bacteria 2954
194 Ga0496117_0019559 3300048920 Bacteria 5557
195 Ga0496119_0006280 3300048922 Bacteria 11082
196 Ga0496123_0023815 3300048926 Bacteria 4676
197 Ga0496125_0011936 3300048928 Bacteria 8655
198 Ga0496125_0054133 3300048928 Bacteria 3282
199 Ga0496126_0069568 3300048929 Bacteria 3139
200 Ga0501032_0122861 3300049569 Bacteria 1716
201 Ga0501038_0036652 3300049574 Bacteria 4303
202 Ga0501039_0063059 3300049575 Bacteria 2872
203 Ga0501040_0000807 3300049576 Bacteria 19499
204 Ga0501042_0001992 3300049578 Bacteria 12325
205 Ga0501043_0045785 3300049579 Bacteria 3440
206 Ga0501046_0015438 3300049580 Bacteria 6416
207 Ga0501048_0013469 3300049582 Bacteria 6069
208 Ga0501071_0129299 3300049587 Bacteria 1875
209 Ga0501072_0115175 3300049588 Bacteria 2140
210 Ga0501075_0033902 3300049591 Bacteria 3799
211 Ga0501076_0013065 3300049592 Bacteria 6217
212 Ga0501079_0121230 3300049741 Bacteria 2034
213 Ga0501080_0030434 3300049742 Bacteria 5029
214 Ga0501081_0006512 3300049743 Bacteria 7583
215 Ga0501083_0009683 3300049744 Bacteria 6806
216 Ga0501044_0005151 3300049823 Bacteria 14571
217 nmdc:mga06r32_33095_c1 3300050510 Bacteria 4867
218 Ga0500578_0034990 3300053086 Bacteria 3227
219 Ga0500658_0003769 3300053134 Bacteria 5707
220 Ga0500616_0028303 3300053153 Bacteria 3088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037588 Ga0316581_0032391 Ga0316581_0032391_296_1531 375
2 3300044712 Ga0453684_0071912 Ga0453684_0071912_1836_3242 426
3 3300039093 Ga0400489_50987 Ga0400489_50987_2097_3437 433
4 3300049588 Ga0501072_0115175 Ga0501072_0115175_44_1402 433
5 iso_pu_bacteria 2871495908 2871496244 433
6 iso_pu_bacteria 2878760144 2878760473 433
7 iso_pu_bacteria 2878767105 2878767436 433
8 3300046557 Ga0495622_0084454 Ga0495622_0084454_30_1343 437
9 3300047318 Ga0495636_0072802 Ga0495636_0072802_13_1326 437
10 3300035091 Ga0373951_0015777 Ga0373951_0015777_24_1370 440
11 iso_pu_bacteria 2924754689 2924755039 440
12 3300049569 Ga0501032_0122861 Ga0501032_0122861_275_1642 442
13 iso_pu_bacteria 2856342000 2856347244 445
14 iso_pu_bacteria 2874168670 2874170119 445
15 iso_pu_bacteria 2903540706 2903541038 445
16 3300006847 Ga0075431_100053167 Ga0075431_1000531673 447
17 3300050510 nmdc:mga06r32_33095_c1 nmdc:mga06r32_33095_c1_1100_2572 447
18 3300031733 Ga0316577_10062488 Ga0316577_100624883 456
19 3300031733 Ga0316577_10102560 Ga0316577_101025602 456
20 iso_pu_bacteria 2920760137 2920764863 458
21 3300048914 Ga0496111_0124259 Ga0496111_0124259_12_1400 462
22 3300049823 Ga0501044_0005151 Ga0501044_0005151_10832_12382 465
23 3300022739 Ga0228711_1000772 Ga0228711_100077221 466
24 3300022740 Ga0228710_1000936 Ga0228710_100093617 466
25 3300027111 Ga0209281_1003793 Ga0209281_10037934 466
26 3300027666 Ga0209282_1000038 Ga0209282_100003854 466
27 3300031967 Ga0315914_1000204 Ga0315914_100020440 466
28 3300033430 Ga0315913_1002007 Ga0315913_100200717 466
29 3300033464 Ga0315915_1000018 Ga0315915_100001854 466
30 3300044712 Ga0453684_0000001 Ga0453684_0000001_293416_294972 466
31 3300049744 Ga0501083_0009683 Ga0501083_0009683_21_1571 467
32 3300031727 Ga0316576_10005680 Ga0316576_100056805 470
33 3300035398 Ga0316574_0001421 Ga0316574_0001421_6925_8421 470
34 3300036647 Ga0316582_0037637 Ga0316582_0037637_572_2050 470
35 3300036712 Ga0316584_0006478 Ga0316584_0006478_5317_6795 470
36 3300036712 Ga0316584_0016808 Ga0316584_0016808_373_1845 471
37 3300044712 Ga0453684_0000250 Ga0453684_0000250_26357_27838 472
38 3300042876 Ga0451577_0000245 Ga0451577_0000245_68655_70148 475
39 3300044712 Ga0453684_0000807 Ga0453684_0000807_36677_38170 475
40 3300044712 Ga0453684_0095522 Ga0453684_0095522_462_1913 475
41 3300028800 Ga0265338_10041746 Ga0265338_100417463 476
42 3300042876 Ga0451577_0001284 Ga0451577_0001284_15387_16919 476
43 3300009093 Ga0105240_10002417 Ga0105240_100024173 478
44 3300025913 Ga0207695_10025137 Ga0207695_100251378 478
45 iso_pu_bacteria 2740891818 2740994408 478
46 3300033528 Ga0316588_1006590 Ga0316588_10065903 479
47 3300042993 Ga0439440_0006056 Ga0439440_0006056_431_1900 479
48 3300044712 Ga0453684_0000644 Ga0453684_0000644_88008_89465 479
49 3300042876 Ga0451577_0022140 Ga0451577_0022140_1123_2637 480
50 3300044712 Ga0453684_0183374 Ga0453684_0183374_385_1854 480
51 3300045051 Ga0451576_0020773 Ga0451576_0020773_2647_4161 480
52 iso_pu_bacteria 2513237085 2513581138 480
53 iso_pu_bacteria 2515154134 2515744265 480
54 iso_pu_bacteria 2516653085 2517078019 480
55 iso_pu_bacteria 2585427526 2585530069 480
56 iso_pu_bacteria 2881147464 2881154644 480
57 iso_pu_bacteria 2882632389 2882639115 480
58 iso_pu_bacteria 2885305155 2885308904 480
59 iso_pu_bacteria 2885334103 2885336471 480
60 iso_pu_bacteria 2937994558 2937994891 480
61 iso_pu_bacteria 2958165035 2958165371 480
62 iso_pu_bacteria 2961163497 2961163829 480
63 iso_pu_bacteria 2965018300 2965018634 480
64 iso_pu_bacteria 2968171901 2968172235 480
65 iso_pu_bacteria 2970554993 2970555325 480
66 iso_pu_bacteria 2977864932 2977867261 480
67 iso_pu_bacteria 2987659509 2987659841 480
68 iso_pu_bacteria 3004188549 3004188888 480
69 iso_pu_bacteria 8004395343 8004397011 480
70 3300005467 Ga0070706_100003848 Ga0070706_1000038487 481
71 3300005536 Ga0070697_100002486 Ga0070697_10000248615 481
72 3300025910 Ga0207684_10002231 Ga0207684_1000223112 481
73 3300044712 Ga0453684_0006016 Ga0453684_0006016_8282_9757 481
74 3300044712 Ga0453684_0014193 Ga0453684_0014193_1029_2498 481
75 3300045051 Ga0451576_0000538 Ga0451576_0000538_8428_9987 481
76 3300045051 Ga0451576_0078892 Ga0451576_0078892_660_2132 481
77 3300031727 Ga0316576_10005038 Ga0316576_100050386 482
78 3300042876 Ga0451577_0005240 Ga0451577_0005240_8168_9640 482
79 3300045051 Ga0451576_0004789 Ga0451576_0004789_1908_3413 482
80 iso_pu_bacteria 2534681796 2535518226 482
81 iso_pu_bacteria 8005542996 8005549117 482
82 3300005436 Ga0070713_100067981 Ga0070713_1000679814 483
83 3300005981 Ga0081538_10010602 Ga0081538_100106023 483
84 3300009177 Ga0105248_10206795 Ga0105248_102067952 483
85 3300028556 Ga0265337_1028839 Ga0265337_10288392 483
86 3300028573 Ga0265334_10004098 Ga0265334_100040985 483
87 3300028653 Ga0265323_10000525 Ga0265323_1000052518 483
88 3300028653 Ga0265323_10001853 Ga0265323_100018539 483
89 3300028653 Ga0265323_10011932 Ga0265323_100119323 483
90 3300028654 Ga0265322_10000870 Ga0265322_100008705 483
91 3300031235 Ga0265330_10010402 Ga0265330_100104026 483
92 3300031242 Ga0265329_10010783 Ga0265329_100107831 483
93 3300031344 Ga0265316_10062613 Ga0265316_100626132 483
94 3300031711 Ga0265314_10000827 Ga0265314_1000082713 483
95 3300031712 Ga0265342_10006443 Ga0265342_100064437 483
96 3300031712 Ga0265342_10054175 Ga0265342_100541752 483
97 3300035692 Ga0373935_0010935 Ga0373935_0010935_698_2191 483
98 3300035695 Ga0373927_0002558 Ga0373927_0002558_147_1640 483
99 3300035725 Ga0373947_0009151 Ga0373947_0009151_1087_2580 483
100 3300037068 Ga0373925_0003541 Ga0373925_0003541_7582_9075 483
101 3300039110 Ga0400487_04521 Ga0400487_04521_10_1569 483
102 3300044712 Ga0453684_0008845 Ga0453684_0008845_5535_7016 483
103 3300044712 Ga0453684_0018850 Ga0453684_0018850_751_2229 483
104 3300045051 Ga0451576_0023613 Ga0451576_0023613_2731_4209 483
105 3300046517 Ga0495630_0000339 Ga0495630_0000339_28105_29592 483
106 3300046526 Ga0495666_0004195 Ga0495666_0004195_312_1799 483
107 3300046531 Ga0495665_0031837 Ga0495665_0031837_640_2127 483
108 3300046535 Ga0495586_0000228 Ga0495586_0000228_7675_9162 483
109 3300047471 Ga0495684_0136454 Ga0495684_0136454_291_1766 483
110 3300049574 Ga0501038_0036652 Ga0501038_0036652_2303_3793 483
111 3300049575 Ga0501039_0063059 Ga0501039_0063059_764_2254 483
112 3300049576 Ga0501040_0000807 Ga0501040_0000807_17568_19058 483
113 3300049578 Ga0501042_0001992 Ga0501042_0001992_10784_12274 483
114 3300049579 Ga0501043_0045785 Ga0501043_0045785_593_2083 483
115 3300049580 Ga0501046_0015438 Ga0501046_0015438_786_2276 483
116 3300049582 Ga0501048_0013469 Ga0501048_0013469_2599_4089 483
117 3300049587 Ga0501071_0129299 Ga0501071_0129299_196_1686 483
118 3300049591 Ga0501075_0033902 Ga0501075_0033902_533_2023 483
119 3300049592 Ga0501076_0013065 Ga0501076_0013065_970_2460 483
120 3300049742 Ga0501080_0030434 Ga0501080_0030434_187_1677 483
121 3300049743 Ga0501081_0006512 Ga0501081_0006512_4524_6014 483
122 iso_pu_bacteria 2508501050 2508730691 483
123 iso_pu_bacteria 2508501127 2509141210 483
124 iso_pu_bacteria 2509276033 2509445904 483
125 iso_pu_bacteria 2510461076 2510895961 483
126 iso_pu_bacteria 2510917028 2511184319 483
127 iso_pu_bacteria 2510917030 2511196944 483
128 iso_pu_bacteria 2512047086 2512530618 483
129 iso_pu_bacteria 2513237084 2513567326 483
130 iso_pu_bacteria 2513237138 2513867698 483
131 iso_pu_bacteria 2513237144 2513910704 483
132 iso_pu_bacteria 2513237146 2513927777 483
133 iso_pu_bacteria 2513237159 2513997401 483
134 iso_pu_bacteria 2513237162 2514017736 483
135 iso_pu_bacteria 2515075009 2515114681 483
136 iso_pu_bacteria 2515154113 2515636744 483
137 iso_pu_bacteria 2515154114 2515644843 483
138 iso_pu_bacteria 2515154116 2515654772 483
139 iso_pu_bacteria 2516143018 2516204251 483
140 iso_pu_bacteria 2517287029 2517408267 483
141 iso_pu_bacteria 2519899620 2520378815 483
142 iso_pu_bacteria 2582581298 2585226915 483
143 iso_pu_bacteria 2582581299 2585230405 483
144 iso_pu_bacteria 2582581306 2585269278 483
145 iso_pu_bacteria 2582581865 2585390539 483
146 iso_pu_bacteria 2582581866 2585396351 483
147 iso_pu_bacteria 2582581867 2585403774 483
148 iso_pu_bacteria 2585427529 2585550330 483
149 iso_pu_bacteria 2585427590 2585823265 483
150 iso_pu_bacteria 2599185170 2599416792 483
151 iso_pu_bacteria 2599185352 2600194514 483
152 iso_pu_bacteria 2615840624 2616294086 483
153 iso_pu_bacteria 2617270742 2617380855 483
154 iso_pu_bacteria 2643221557 2643806610 483
155 iso_pu_bacteria 2643221610 2644067014 483
156 iso_pu_bacteria 2643221618 2644106584 483
157 iso_pu_bacteria 2643221626 2644148182 483
158 iso_pu_bacteria 2643221655 2644311038 483
159 iso_pu_bacteria 2643221659 2644334980 483
160 iso_pu_bacteria 2643221668 2644381148 483
161 iso_pu_bacteria 2643221675 2644415637 483
162 iso_pu_bacteria 2643221680 2644450453 483
163 iso_pu_bacteria 2643221698 2644544067 483
164 iso_pu_bacteria 2643221712 2644616871 483
165 iso_pu_bacteria 2643221723 2644672455 483
166 iso_pu_bacteria 2643221726 2644691095 483
167 iso_pu_bacteria 2690316117 2692315430 483
168 iso_pu_bacteria 2718217882 2719182374 483
169 iso_pu_bacteria 2718217997 2719666682 483
170 iso_pu_bacteria 2718218009 2719733090 483
171 iso_pu_bacteria 2718218199 2720493102 483
172 iso_pu_bacteria 2718218232 2720614580 483
173 iso_pu_bacteria 2718218233 2720621354 483
174 iso_pu_bacteria 2718218235 2720632680 483
175 iso_pu_bacteria 2718218269 2720776404 483
176 iso_pu_bacteria 2718218363 2721148487 483
177 iso_pu_bacteria 2718218365 2721159872 483
178 iso_pu_bacteria 2718218366 2721165301 483
179 iso_pu_bacteria 2721755514 2722841471 483
180 iso_pu_bacteria 2721755556 2723027993 483
181 iso_pu_bacteria 2721755684 2723561623 483
182 iso_pu_bacteria 2721755685 2723568252 483
183 iso_pu_bacteria 2721755810 2724045846 483
184 iso_pu_bacteria 2721755819 2724091011 483
185 iso_pu_bacteria 2721755822 2724105517 483
186 iso_pu_bacteria 2721755823 2724111342 483
187 iso_pu_bacteria 2724679232 2725952155 483
188 iso_pu_bacteria 2728369352 2730108929 483
189 iso_pu_bacteria 2728369365 2730165609 483
190 iso_pu_bacteria 2728369397 2730299504 483
191 iso_pu_bacteria 2738541333 2739033373 483
192 iso_pu_bacteria 2751185821 2753462132 483
193 iso_pu_bacteria 2767802442 2770200091 483
194 iso_pu_bacteria 2775506902 2776268706 483
195 iso_pu_bacteria 2775506904 2776285210 483
196 iso_pu_bacteria 2775507266 2778176646 483
197 iso_pu_bacteria 2791355091 2792620666 483
198 iso_pu_bacteria 2791355092 2792626026 483
199 iso_pu_bacteria 2791355094 2792638966 483
200 iso_pu_bacteria 2791355256 2793293908 483
201 iso_pu_bacteria 2791355259 2793318374 483
202 iso_pu_bacteria 2791355260 2793323920 483
203 iso_pu_bacteria 2791355262 2793335003 483
204 iso_pu_bacteria 2791355263 2793344463 483
205 iso_pu_bacteria 2791355264 2793349796 483
206 iso_pu_bacteria 2791355265 2793355427 483
207 iso_pu_bacteria 2791355266 2793363670 483
208 iso_pu_bacteria 2802429605 2805929665 483
209 iso_pu_bacteria 2802429606 2805937272 483
210 iso_pu_bacteria 2802429637 2806075589 483
211 iso_pu_bacteria 2838016132 2838019826 483
212 iso_pu_bacteria 2838022645 2838023316 483
213 iso_pu_bacteria 2838035591 2838036905 483
214 iso_pu_bacteria 2838048938 2838052633 483
215 iso_pu_bacteria 2838061910 2838064891 483
216 iso_pu_bacteria 2838068647 2838069618 483
217 iso_pu_bacteria 2838074704 2838077868 483
218 iso_pu_bacteria 2838661181 2838662057 483
219 iso_pu_bacteria 2838668709 2838671899 483
220 iso_pu_bacteria 2838686498 2838693743 483
221 iso_pu_bacteria 2838701080 2838704578 483
222 iso_pu_bacteria 2838729681 2838736419 483
223 iso_pu_bacteria 2838742623 2838749259 483
224 iso_pu_bacteria 2840764183 2840768753 483
225 iso_pu_bacteria 2841851746 2841858694 483
226 iso_pu_bacteria 2842146304 2842149796 483
227 iso_pu_bacteria 2842156927 2842163352 483
228 iso_pu_bacteria 2842163707 2842170265 483
229 iso_pu_bacteria 2842180545 2842186980 483
230 iso_pu_bacteria 2842192696 2842195521 483
231 iso_pu_bacteria 2842198810 2842198830 483
232 iso_pu_bacteria 2842205361 2842210842 483
233 iso_pu_bacteria 2842229732 2842236460 483
234 iso_pu_bacteria 2842243621 2842250158 483
235 iso_pu_bacteria 2842250916 2842254058 483
236 iso_pu_bacteria 2842257432 2842264168 483
237 iso_pu_bacteria 2842264693 2842269017 483
238 iso_pu_bacteria 2842271015 2842278301 483
239 iso_pu_bacteria 2842278818 2842284296 483
240 iso_pu_bacteria 2842304105 2842310429 483
241 iso_pu_bacteria 2842311132 2842314270 483
242 iso_pu_bacteria 2842317721 2842320094 483
243 iso_pu_bacteria 2842395702 2842396618 483
244 iso_pu_bacteria 2842422224 2842423232 483
245 iso_pu_bacteria 2842428310 2842433061 483
246 iso_pu_bacteria 2842434925 2842439366 483
247 iso_pu_bacteria 2842441272 2842445995 483
248 iso_pu_bacteria 2842447887 2842449023 483
249 iso_pu_bacteria 2842462802 2842467400 483
250 iso_pu_bacteria 2842469257 2842474195 483
251 iso_pu_bacteria 2842489311 2842493366 483
252 iso_pu_bacteria 2842495871 2842497516 483
253 iso_pu_bacteria 2842509118 2842514422 483
254 iso_pu_bacteria 2842521101 2842522358 483
255 iso_pu_bacteria 2844163670 2844168795 483
256 iso_pu_bacteria 2844454524 2844457319 483
257 iso_pu_bacteria 2847417321 2847419508 483
258 iso_pu_bacteria 2848992105 2848994537 483
259 iso_pu_bacteria 2852387548 2852393458 483
260 iso_pu_bacteria 2855872281 2855872414 483
261 iso_pu_bacteria 2874123672 2874127785 483
262 iso_pu_bacteria 2888343758 2888349492 483
263 iso_pu_bacteria 2896384573 2896388417 483
264 iso_pu_bacteria 2913295892 2913296059 483
265 iso_pu_bacteria 2917699015 2917700286 483
266 iso_pu_bacteria 2919100787 2919102481 483
267 iso_pu_bacteria 2920822456 2920822636 483
268 iso_pu_bacteria 2923556063 2923559785 483
269 iso_pu_bacteria 2924762789 2924764740 483
270 iso_pu_bacteria 2933016740 2933017469 483
271 iso_pu_bacteria 2933570622 2933576869 483
272 iso_pu_bacteria 2933599457 2933600424 483
273 iso_pu_bacteria 2935901341 2935907988 483
274 iso_pu_bacteria 2936381700 2936387606 483
275 iso_pu_bacteria 2941499720 2941505992 483
276 iso_pu_bacteria 2957415311 2957415406 483
277 iso_pu_bacteria 2957443900 2957444806 483
278 iso_pu_bacteria 2960617483 2960623765 483
279 iso_pu_bacteria 2960660292 2960661520 483
280 iso_pu_bacteria 2964643177 2964644228 483
281 iso_pu_bacteria 2970524798 2970527954 483
282 iso_pu_bacteria 2970540015 2970543260 483
283 iso_pu_bacteria 2977523885 2977527781 483
284 iso_pu_bacteria 2987666974 2987669511 483
285 iso_pu_bacteria 2996887358 2996888697 483
286 iso_pu_bacteria 643692032 643826413 483
287 iso_pu_bacteria 8005258706 8005264370 483
288 iso_pu_bacteria 8005282627 8005284284 483
289 iso_pu_bacteria 8005289223 8005289537 483
290 iso_pu_bacteria 8005301065 8005303680 483
291 iso_pu_bacteria 8005307578 8005311361 483
292 iso_pu_bacteria 8005321885 8005323224 483
293 iso_pu_bacteria 8005430974 8005434414 483
294 iso_pu_bacteria 8005460587 8005465376 483
295 iso_pu_bacteria 8005497431 8005501431 483
296 iso_pu_bacteria 8005556819 8005560830 483
297 iso_pu_bacteria 8005563573 8005566927 483
298 iso_pu_bacteria 8005570704 8005572916 483
299 iso_pu_bacteria 8005619151 8005622793 483
300 iso_pu_bacteria 8005626139 8005630307 483
301 iso_pu_bacteria 8005668836 8005672852 483
302 iso_pu_bacteria 8005688590 8005691540 483
303 iso_pu_bacteria 8005695170 8005701673 483
304 iso_pu_bacteria 8018127388 8018132408 483
305 iso_pu_bacteria 8018163183 8018169501 483
306 iso_pu_bacteria 8023680758 8023683724 483
307 iso_pu_bacteria 8024479707 8024485952 483
308 iso_pu_bacteria 8024501048 8024501062 483
309 iso_pu_bacteria 8046767195 8046773565 483
310 iso_pu_bacteria 8055617313 8055623914 483
311 iso_pu_bacteria 8056382006 8056387446 483
312 iso_pu_bacteria 8057575449 8057579715 483
313 3300003215 JGI25153J46596_10001503 JGI25153J46596_100015033 484
314 3300025295 Ga0209564_1014782 Ga0209564_10147823 484
315 3300025297 Ga0209758_1006386 Ga0209758_10063865 484
316 3300025303 Ga0209051_1015500 Ga0209051_10155003 484
317 3300028653 Ga0265323_10001066 Ga0265323_1000106610 484
318 3300031344 Ga0265316_10148982 Ga0265316_101489822 484
319 3300049741 Ga0501079_0121230 Ga0501079_0121230_139_1620 484
320 3300028563 Ga0265319_1006605 Ga0265319_10066054 485
321 3300028653 Ga0265323_10000078 Ga0265323_1000007847 485
322 3300028654 Ga0265322_10002866 Ga0265322_100028664 485
323 3300031235 Ga0265330_10021759 Ga0265330_100217592 485
324 3300031344 Ga0265316_10005522 Ga0265316_100055225 485
325 3300031344 Ga0265316_10020682 Ga0265316_100206824 485
326 3300031595 Ga0265313_10002649 Ga0265313_1000264916 485
327 3300002739 JGI25158J39367_1000614 JGI25158J39367_10006145 487
328 3300002773 JGI25152J39213_1003835 JGI25152J39213_10038353 487
329 3300002774 JGI25150J39212_1002527 JGI25150J39212_10025273 487
330 3300002987 JGI25159J45721_1000012 JGI25159J45721_100001275 487
331 3300003187 JGI25151J46595_10019297 JGI25151J46595_100192973 487
332 3300003323 rootH1_10147169 rootH1_101471695 487
333 3300003354 JGI25160J50197_1000042 JGI25160J50197_100004278 487
334 3300003354 JGI25160J50197_1000068 JGI25160J50197_100006891 487
335 3300003354 JGI25160J50197_1010197 JGI25160J50197_10101973 487
336 3300003374 JGI25161J50226_1000048 JGI25161J50226_100004891 487
337 3300003374 JGI25161J50226_1000254 JGI25161J50226_100025429 487
338 3300003771 Ga0055526_1000937 Ga0055526_100093712 487
339 3300003771 Ga0055526_1000940 Ga0055526_10009403 487
340 3300003771 Ga0055526_1003780 Ga0055526_10037808 487
341 3300003771 Ga0055526_1007407 Ga0055526_10074077 487
342 3300003775 Ga0055524_1000743 Ga0055524_100074312 487
343 3300003775 Ga0055524_1001241 Ga0055524_10012413 487
344 3300003775 Ga0055524_1001337 Ga0055524_100133713 487
345 3300003781 Ga0055536_1007787 Ga0055536_10077872 487
346 3300003790 Ga0055528_1000382 Ga0055528_10003823 487
347 3300003790 Ga0055528_1000681 Ga0055528_100068125 487
348 3300003792 Ga0055540_1006983 Ga0055540_10069833 487
349 3300003794 Ga0055531_10011309 Ga0055531_100113094 487
350 3300004625 Ga0055543_1000046 Ga0055543_100004613 487
351 3300004625 Ga0055543_1000452 Ga0055543_10004529 487
352 3300005262 Ga0065165_1000174 Ga0065165_100017475 487
353 3300005262 Ga0065165_1000175 Ga0065165_100017592 487
354 3300005262 Ga0065165_1004083 Ga0065165_10040834 487
355 3300006186 Ga0075369_10001995 Ga0075369_100019955 487
356 3300009553 Ga0105249_10262766 Ga0105249_102627662 487
357 3300009765 Ga0123341_1000053 Ga0123341_100005316 487
358 3300009766 Ga0123342_1025567 Ga0123342_10255673 487
359 3300013249 Ga0171463_1005 Ga0171463_1005247 487
360 3300015690 Ga0183363_1026 Ga0183363_102640 487
361 3300021321 Ga0214542_1000014 Ga0214542_10000148 487
362 3300021327 Ga0214543_1000146 Ga0214543_10001468 487
363 3300025208 Ga0209436_100252 Ga0209436_10025212 487
364 3300025245 Ga0207425_1002487 Ga0207425_10024874 487
365 3300025258 Ga0209129_1000595 Ga0209129_100059515 487
366 3300025258 Ga0209129_1001590 Ga0209129_100159010 487
367 3300025273 Ga0209673_1000063 Ga0209673_1000063205 487
368 3300025273 Ga0209673_1000582 Ga0209673_100058216 487
369 3300025284 Ga0209130_1000075 Ga0209130_100007580 487
370 3300025284 Ga0209130_1000144 Ga0209130_100014489 487
371 3300025292 Ga0209676_1005076 Ga0209676_10050764 487
372 3300025294 Ga0209025_1000747 Ga0209025_100074730 487
373 3300025294 Ga0209025_1002615 Ga0209025_100261515 487
374 3300025294 Ga0209025_1004085 Ga0209025_100408512 487
375 3300025294 Ga0209025_1048006 Ga0209025_10480061 487
376 3300025295 Ga0209564_1000278 Ga0209564_100027822 487
377 3300025295 Ga0209564_1000482 Ga0209564_100048213 487
378 3300025295 Ga0209564_1000483 Ga0209564_100048346 487
379 3300025295 Ga0209564_1024888 Ga0209564_10248883 487
380 3300025297 Ga0209758_1001643 Ga0209758_100164317 487
381 3300025297 Ga0209758_1001926 Ga0209758_100192615 487
382 3300025297 Ga0209758_1011479 Ga0209758_10114795 487
383 3300025298 Ga0209050_1009795 Ga0209050_10097954 487
384 3300025299 Ga0209256_1000175 Ga0209256_100017563 487
385 3300025299 Ga0209256_1000411 Ga0209256_100041150 487
386 3300025299 Ga0209256_1002040 Ga0209256_10020405 487
387 3300025299 Ga0209256_1002344 Ga0209256_100234412 487
388 3300025299 Ga0209256_1028927 Ga0209256_10289271 487
389 3300025302 Ga0207426_1000126 Ga0207426_100012688 487
390 3300025302 Ga0207426_1000163 Ga0207426_100016380 487
391 3300025302 Ga0207426_1002356 Ga0207426_100235610 487
392 3300025303 Ga0209051_1000688 Ga0209051_10006884 487
393 3300025303 Ga0209051_1004276 Ga0209051_10042767 487
394 3300025303 Ga0209051_1018717 Ga0209051_10187174 487
395 3300025304 Ga0209257_1003204 Ga0209257_10032043 487
396 3300031456 Ga0307513_10031148 Ga0307513_100311484 487
397 3300032004 Ga0307414_10054249 Ga0307414_100542491 487
398 3300041441 Ga0451787_467073 Ga0451787_467073_983_2446 487
399 3300041491 Ga0451833_0809093 Ga0451833_0809093_8009_9472 487
400 3300041491 Ga0451833_1349069 Ga0451833_1349069_2461_3924 487
401 3300041492 Ga0451835_1219436 Ga0451835_1219436_11306_12769 487
402 3300041494 Ga0451837_0491498 Ga0451837_0491498_7620_9083 487
403 3300041494 Ga0451837_0728896 Ga0451837_0728896_937_2400 487
404 3300041496 Ga0451839_0279842 Ga0451839_0279842_915_2378 487
405 3300041496 Ga0451839_0605596 Ga0451839_0605596_7550_9013 487
406 3300041498 Ga0451841_0059912 Ga0451841_0059912_2498_3961 487
407 3300041498 Ga0451841_1265487 Ga0451841_1265487_11336_12799 487
408 3300041501 Ga0451845_0008211 Ga0451845_0008211_935_2398 487
409 3300041501 Ga0451845_0426837 Ga0451845_0426837_2328_3791 487
410 3300041503 Ga0451847_0179584 Ga0451847_0179584_7557_9020 487
411 3300041503 Ga0451847_0188111 Ga0451847_0188111_1272_2735 487
412 3300041505 Ga0451849_0219991 Ga0451849_0219991_11245_12708 487
413 3300041505 Ga0451849_0568095 Ga0451849_0568095_7557_9020 487
414 3300041507 Ga0451851_0569716 Ga0451851_0569716_935_2398 487
415 3300041507 Ga0451851_0620637 Ga0451851_0620637_10627_12090 487
416 3300041509 Ga0451843_0440648 Ga0451843_0440648_2121_3584 487
417 3300041509 Ga0451843_0871954 Ga0451843_0871954_11268_12731 487
418 3300041511 Ga0451855_0953101 Ga0451855_0953101_2729_4192 487
419 3300041512 Ga0451853_0083577 Ga0451853_0083577_14533_15996 487
420 3300046459 Ga0495629_0050248 Ga0495629_0050248_71_1534 487
421 3300046492 Ga0495585_0003955 Ga0495585_0003955_6050_7513 487
422 3300046506 Ga0495583_0033923 Ga0495583_0033923_268_1731 487
423 3300046522 Ga0495643_0020699 Ga0495643_0020699_1440_2903 487
424 3300046558 Ga0495633_0035957 Ga0495633_0035957_344_1807 487
425 3300046660 Ga0495625_0008785 Ga0495625_0008785_2512_3975 487
426 3300046660 Ga0495625_0056357 Ga0495625_0056357_427_1890 487
427 3300046810 Ga0495660_0019334 Ga0495660_0019334_2203_3666 487
428 3300047317 Ga0495604_0091767 Ga0495604_0091767_737_2200 487
429 3300048904 Ga0496101_0159355 Ga0496101_0159355_80_1543 487
430 3300048907 Ga0496104_0011451 Ga0496104_0011451_4468_5931 487
431 3300048919 Ga0496116_0045876 Ga0496116_0045876_781_2244 487
432 3300048920 Ga0496117_0019559 Ga0496117_0019559_499_1962 487
433 3300048922 Ga0496119_0006280 Ga0496119_0006280_7193_8656 487
434 3300048926 Ga0496123_0023815 Ga0496123_0023815_2096_3559 487
435 3300048928 Ga0496125_0011936 Ga0496125_0011936_6245_7708 487
436 3300048928 Ga0496125_0054133 Ga0496125_0054133_1774_3237 487
437 3300048929 Ga0496126_0069568 Ga0496126_0069568_364_1827 487
438 3300053086 Ga0500578_0034990 Ga0500578_0034990_591_2054 487
439 3300053134 Ga0500658_0003769 Ga0500658_0003769_3737_5200 487
440 3300053153 Ga0500616_0028303 Ga0500616_0028303_1124_2587 487

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

132

429

0.91

PF00662

Proton_antipo_N

NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus

70

116

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z16-assembly1.cif.gz_d structure of the mrp antiporter complex 0.9174 7 486
8e9g-assembly1.cif.gz_M mycobacterial respiratory complex i with both quinone positions modelled 0.9133 8 486
7o6y-assembly1.cif.gz_5 cryo-em structure of respiratory complex i under turnover 0.9116 8 472
8beh-assembly1.cif.gz_M cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane tip) 0.9107 276 479
7b0n-assembly1.cif.gz_L a 3.7-angstrom structure of yarrowia lipolytica complex i with an r121m mutation in nucm. 0.9085 8 468
ID Description Score Start End Superfamily
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8087 6 130 1.20.1070.10
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7635 6 130 1.20.1070.10
af_Q2G2H7_1_127_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7532 8 148 1.20.1070.10
af_Q2G2H7_1_127_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7181 8 148 1.20.1070.10
af_P16429_1_123_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7051 12 127 1.20.1070.10
ID Description Score Start End GO Terms
AF-S3IBH8-F1-model_v4 Monovalent cation/H+ antiporter subunit D 0.9922 1 487 GO:0012505
GO:0016020
AF-S3IBH8-F1-model_v4 Monovalent cation/H+ antiporter subunit D 0.9902 1 487 GO:0012505
GO:0016020
AF-A0A8B6S9M6-F1-model_v4 deleted 0.9895 1 371
AF-A0A7W0FE63-F1-model_v4 Monovalent cation/H+ antiporter subunit D family protein 0.9891 1 155 GO:0016020
AF-A0A8B6S9M6-F1-model_v4 deleted 0.9868 1 371

Feature Viewer

pLDDT pTM Quality
90.14 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map