F442918

General Info

Members Datasets Scaffolds Average Seq Length
433 148 430 230

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0019757|Ga0495584_0019757_1583_2329
Length 248
Sequence MSERTRVLVVDDDVVSRMMLMHLVDTSGHYDILEAEDGADAWRQLQAGLRPAMIFCDLRMPHLSGMELLALVKADQRFASIPFVLASAANERETVDQASVLGAAGYLVKPFGHGEVGALLDALMPVQGEGDEAPAATCRRLGIDASRLLLYLGGLHKQLAGASADIEQMLACGDADGARARVARLREGCATLGLAGAVAALAGLQRSTSLTGCEVDGALDVARQAALRQGELARAAAGQDVKADADSA

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
47 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
48 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
49 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
50 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
51 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
52 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
53 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
57 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
58 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
68 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
81 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
111 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
148 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.46
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 5.54
Rhizosphere 89.38
Stem 0
Stem Tuber 0
Unclassified 4.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10023876 3300003322 Bacteria 3255
2 rootL2_10187929 3300003322 Bacteria 2704
3 Ga0055525_1000074 3300003759 Bacteria 178058
4 Ga0070658_10146436 3300005327 Bacteria 1975
5 Ga0070658_10194686 3300005327 Bacteria 1709
6 Ga0070676_10222218 3300005328 Bacteria 1248
7 Ga0070660_100017387 3300005339 Bacteria 5241
8 Ga0070660_100067351 3300005339 Bacteria 2789
9 Ga0070661_100173872 3300005344 Bacteria 1636
10 Ga0070659_100092183 3300005366 Bacteria 2429
11 Ga0068867_100428028 3300005459 Bacteria 1123
12 Ga0068855_100113803 3300005563 Bacteria 3103
13 Ga0070664_100249052 3300005564 Bacteria 1597
14 Ga0070664_100429703 3300005564 Bacteria 1211
15 Ga0068852_100402619 3300005616 Bacteria 1346
16 Ga0068865_100471488 3300006881 Bacteria 1042
17 Ga0105244_10086321 3300009036 Bacteria 1547
18 Ga0105240_10654078 3300009093 Bacteria 1151
19 Ga0105241_10023935 3300009174 Bacteria 4534
20 Ga0105242_10093473 3300009176 Bacteria 2535
21 Ga0105238_10037598 3300009551 Bacteria 4920
22 Ga0105239_10207938 3300010375 Bacteria 2193
23 Ga0105239_10591803 3300010375 Bacteria 1265
24 Ga0157370_10320505 3300013104 Bacteria 1430
25 Ga0157372_10150248 3300013307 Bacteria 2688
26 Ga0209563_100003 3300025230 Bacteria 1932942
27 Ga0209677_101919 3300025253 Bacteria 8352
28 Ga0209148_1000203 3300025254 Bacteria 105950
29 Ga0207656_10304366 3300025321 Bacteria 789
30 Ga0207705_10003993 3300025909 Bacteria 11222
31 Ga0207705_10658412 3300025909 Bacteria 814
32 Ga0207654_10003676 3300025911 Bacteria 7732
33 Ga0207695_10152913 3300025913 Bacteria 2245
34 Ga0207657_10062687 3300025919 Bacteria 3182
35 Ga0207657_10117625 3300025919 Bacteria 2189
36 Ga0207657_10123838 3300025919 Bacteria 2125
37 Ga0207649_10196238 3300025920 Bacteria 1423
38 Ga0207690_10023145 3300025932 Bacteria 3874
39 Ga0207690_10031452 3300025932 Bacteria 3396
40 Ga0207706_10197585 3300025933 Bacteria 1764
41 Ga0207706_10254411 3300025933 Bacteria 1534
42 Ga0207686_10200600 3300025934 Bacteria 1429
43 Ga0207686_10311534 3300025934 Bacteria 1173
44 Ga0207704_10194102 3300025938 Bacteria 1479
45 Ga0207679_10109519 3300025945 Bacteria 2177
46 Ga0207667_10000734 3300025949 Bacteria 42640
47 Ga0207667_10297457 3300025949 Bacteria 1649
48 Ga0207674_10104596 3300026116 Bacteria 2809
49 Ga0207698_10199514 3300026142 Bacteria 1790
50 Ga0307518_10005923 3300031838 Bacteria 8779
51 Ga0395899_0003097 3300037312 Bacteria 13234
52 Ga0395899_0008429 3300037312 Bacteria 7938
53 Ga0395899_0010433 3300037312 Bacteria 7116
54 Ga0395899_0107830 3300037312 Bacteria 2004
55 Ga0395899_0340269 3300037312 Bacteria 1006
56 Ga0395900_0000230 3300037418 Bacteria 87954
57 Ga0395900_0003565 3300037418 Bacteria 16741
58 Ga0395900_0007045 3300037418 Bacteria 11642
59 Ga0395900_0010912 3300037418 Bacteria 9290
60 Ga0395900_0073299 3300037418 Bacteria 3520
61 Ga0395900_0099723 3300037418 Bacteria 2983
62 Ga0395900_0127177 3300037418 Bacteria 2613
63 Ga0395900_0135117 3300037418 Bacteria 2526
64 Ga0395900_0203047 3300037418 Bacteria 2004
65 Ga0395900_0280403 3300037418 Bacteria 1658
66 Ga0395900_0304883 3300037418 Bacteria 1577
67 Ga0395900_0532582 3300037418 Bacteria 1121
68 Ga0395898_0030143 3300037466 Bacteria 5430
69 Ga0395898_0079312 3300037466 Bacteria 3167
70 Ga0395898_0556812 3300037466 Bacteria 1089
71 Ga0395898_0954062 3300037466 Bacteria 794
72 Ga0395905_0015244 3300037471 Bacteria 7308
73 Ga0395905_0109669 3300037471 Bacteria 2591
74 Ga0395905_0111232 3300037471 Bacteria 2572
75 Ga0395905_0120656 3300037471 Bacteria 2464
76 Ga0395905_0392917 3300037471 Bacteria 1281
77 Ga0395905_0619979 3300037471 Bacteria 984
78 Ga0395901_0000074 3300038443 Bacteria 138735
79 Ga0395901_0005795 3300038443 Bacteria 12517
80 Ga0395901_0156629 3300038443 Bacteria 2392
81 Ga0395901_0275446 3300038443 Bacteria 1749
82 Ga0395901_0304299 3300038443 Bacteria 1652
83 Ga0395901_0395070 3300038443 Bacteria 1421
84 Ga0439465_0152880 3300041413 Bacteria 825
85 Ga0439448_0002301 3300042005 Bacteria 5168
86 Ga0439448_0019489 3300042005 Bacteria 2089
87 Ga0439448_0031905 3300042005 Bacteria 1675
88 Ga0439455_0012903 3300042012 Bacteria 1883
89 Ga0450906_034036 3300042145 Bacteria 900
90 Ga0439458_0008246 3300042157 Bacteria 2317
91 Ga0439458_0056950 3300042157 Bacteria 971
92 Ga0466969_0011464 3300044656 Bacteria 4693
93 Ga0466969_0061328 3300044656 Bacteria 1827
94 Ga0466972_0001089 3300044658 Bacteria 13026
95 Ga0466972_0032543 3300044658 Bacteria 2560
96 Ga0466972_0084842 3300044658 Bacteria 1506
97 Ga0466972_0107536 3300044658 Bacteria 1318
98 Ga0466965_0021524 3300044683 Bacteria 3104
99 Ga0466965_0036776 3300044683 Bacteria 2402
100 Ga0466965_0062386 3300044683 Bacteria 1864
101 Ga0466966_0021218 3300044684 Bacteria 4265
102 Ga0466966_0026884 3300044684 Bacteria 3753
103 Ga0466966_0169209 3300044684 Bacteria 1328
104 Ga0466966_0192188 3300044684 Bacteria 1236
105 Ga0466961_0056534 3300044693 Bacteria 2500
106 Ga0466961_0084879 3300044693 Bacteria 2002
107 Ga0466961_0127849 3300044693 Bacteria 1593
108 Ga0466963_0192804 3300044694 Bacteria 1424
109 Ga0466964_0000609 3300044706 Bacteria 11356
110 Ga0466964_0003264 3300044706 Bacteria 5903
111 Ga0466964_0059232 3300044706 Bacteria 1590
112 Ga0466964_0192209 3300044706 Bacteria 975
113 Ga0466971_0016348 3300044719 Bacteria 3273
114 Ga0466968_0001728 3300044735 Bacteria 7871
115 Ga0466968_0085870 3300044735 Bacteria 1389
116 Ga0466957_0004477 3300044842 Bacteria 7792
117 Ga0466957_0045038 3300044842 Bacteria 2674
118 Ga0466957_0163393 3300044842 Bacteria 1447
119 Ga0466957_0385603 3300044842 Bacteria 956
120 Ga0466959_0017479 3300045049 Bacteria 5257
121 Ga0466959_0040051 3300045049 Bacteria 3462
122 Ga0466959_0080260 3300045049 Bacteria 2352
123 Ga0466959_0251596 3300045049 Bacteria 1218
124 Ga0466958_0036443 3300045836 Bacteria 2944
125 Ga0466958_0117736 3300045836 Bacteria 1661
126 Ga0466958_0287467 3300045836 Bacteria 1054
127 Ga0466967_0050344 3300045976 Bacteria 3647
128 Ga0466967_0061048 3300045976 Bacteria 3343
129 Ga0466967_0243645 3300045976 Bacteria 1715
130 Ga0466967_0671475 3300045976 Bacteria 1025
131 Ga0495617_000026 3300046452 Bacteria 157675
132 Ga0495627_000043 3300046453 Bacteria 185855
133 Ga0495603_0003991 3300046455 Bacteria 8787
134 Ga0495603_0016434 3300046455 Bacteria 4476
135 Ga0495603_0035268 3300046455 Bacteria 3005
136 Ga0495590_0000041 3300046457 Bacteria 121084
137 Ga0495590_0015868 3300046457 Bacteria 2726
138 Ga0495591_000916 3300046458 Bacteria 20404
139 Ga0495591_017718 3300046458 Bacteria 2437
140 Ga0495629_0088695 3300046459 Bacteria 2157
141 Ga0495638_0218299 3300046460 Bacteria 1067
142 Ga0495650_0000048 3300046471 Bacteria 334427
143 Ga0495650_0000304 3300046471 Bacteria 88929
144 Ga0495650_0004331 3300046471 Bacteria 9787
145 Ga0495650_0010369 3300046471 Bacteria 5204
146 Ga0495650_0048546 3300046471 Bacteria 1768
147 Ga0495582_0007922 3300046473 Bacteria 5870
148 Ga0495582_0125109 3300046473 Bacteria 1450
149 Ga0495605_0000113 3300046474 Bacteria 103900
150 Ga0495605_0000186 3300046474 Bacteria 77457
151 Ga0495605_0001195 3300046474 Bacteria 17294
152 Ga0495605_0010226 3300046474 Bacteria 5253
153 Ga0495605_0057366 3300046474 Bacteria 1874
154 Ga0495605_0079242 3300046474 Bacteria 1539
155 Ga0495605_0100102 3300046474 Bacteria 1333
156 Ga0495584_0000216 3300046491 Bacteria 41638
157 Ga0495584_0000325 3300046491 Bacteria 33411
158 Ga0495584_0008887 3300046491 Bacteria 5194
159 Ga0495584_0013047 3300046491 Bacteria 4239
160 Ga0495584_0013918 3300046491 Bacteria 4098
161 Ga0495584_0019757 3300046491 Bacteria 3423
162 Ga0495584_0116687 3300046491 Bacteria 1351
163 Ga0495585_0015375 3300046492 Bacteria 4447
164 Ga0495585_0015787 3300046492 Bacteria 4385
165 Ga0495585_0034599 3300046492 Bacteria 2856
166 Ga0495585_0038899 3300046492 Bacteria 2676
167 Ga0495585_0049444 3300046492 Bacteria 2334
168 Ga0495585_0090385 3300046492 Bacteria 1649
169 Ga0495585_0118735 3300046492 Bacteria 1400
170 Ga0495585_0136890 3300046492 Bacteria 1285
171 Ga0495585_0155801 3300046492 Bacteria 1188
172 Ga0495585_0207002 3300046492 Bacteria 996
173 Ga0495585_0289757 3300046492 Bacteria 807
174 Ga0495594_0005090 3300046499 Bacteria 6766
175 Ga0495594_0098299 3300046499 Bacteria 1645
176 Ga0495594_0099129 3300046499 Bacteria 1638
177 Ga0495596_0002605 3300046500 Bacteria 9583
178 Ga0495596_0006551 3300046500 Bacteria 5347
179 Ga0495596_0010414 3300046500 Bacteria 4050
180 Ga0495596_0010667 3300046500 Bacteria 3992
181 Ga0495596_0013753 3300046500 Bacteria 3423
182 Ga0495596_0016488 3300046500 Bacteria 3068
183 Ga0495596_0020275 3300046500 Bacteria 2723
184 Ga0495596_0040509 3300046500 Bacteria 1839
185 Ga0495596_0120309 3300046500 Bacteria 1019
186 Ga0495607_0000727 3300046501 Bacteria 31636
187 Ga0495607_0001944 3300046501 Bacteria 17466
188 Ga0495607_0002990 3300046501 Bacteria 13222
189 Ga0495607_0018034 3300046501 Bacteria 4511
190 Ga0495607_0018835 3300046501 Bacteria 4391
191 Ga0495607_0027041 3300046501 Bacteria 3553
192 Ga0495607_0040827 3300046501 Bacteria 2759
193 Ga0495607_0054095 3300046501 Bacteria 2314
194 Ga0495607_0073165 3300046501 Bacteria 1906
195 Ga0495583_0001813 3300046506 Bacteria 20128
196 Ga0495583_0005658 3300046506 Bacteria 8408
197 Ga0495583_0011174 3300046506 Bacteria 5173
198 Ga0495583_0013157 3300046506 Bacteria 4634
199 Ga0495583_0021038 3300046506 Bacteria 3361
200 Ga0495583_0049981 3300046506 Bacteria 1912
201 Ga0495583_0067035 3300046506 Bacteria 1586
202 Ga0495606_0037419 3300046507 Bacteria 3296
203 Ga0495606_0058424 3300046507 Bacteria 2479
204 Ga0495606_0211158 3300046507 Bacteria 1099
205 Ga0495610_0006430 3300046512 Bacteria 8089
206 Ga0495610_0067054 3300046512 Bacteria 1688
207 Ga0495616_0000201 3300046513 Bacteria 49599
208 Ga0495616_0000500 3300046513 Bacteria 29733
209 Ga0495616_0007606 3300046513 Bacteria 6480
210 Ga0495616_0012939 3300046513 Bacteria 4717
211 Ga0495616_0021380 3300046513 Bacteria 3504
212 Ga0495616_0022337 3300046513 Bacteria 3416
213 Ga0495616_0024684 3300046513 Bacteria 3221
214 Ga0495616_0041055 3300046513 Bacteria 2362
215 Ga0495631_0000111 3300046518 Bacteria 54693
216 Ga0495631_0009690 3300046518 Bacteria 4802
217 Ga0495631_0018296 3300046518 Bacteria 3300
218 Ga0495631_0020111 3300046518 Bacteria 3123
219 Ga0495631_0054292 3300046518 Bacteria 1747
220 Ga0495631_0060365 3300046518 Bacteria 1645
221 Ga0495631_0254633 3300046518 Bacteria 748
222 Ga0495632_0000098 3300046519 Bacteria 88691
223 Ga0495632_0001356 3300046519 Bacteria 20589
224 Ga0495632_0001412 3300046519 Bacteria 20067
225 Ga0495632_0007436 3300046519 Bacteria 6879
226 Ga0495632_0071868 3300046519 Bacteria 1661
227 Ga0495637_0000013 3300046520 Bacteria 244837
228 Ga0495637_0128291 3300046520 Bacteria 970
229 Ga0495643_0000548 3300046522 Bacteria 46576
230 Ga0495643_0002266 3300046522 Bacteria 15568
231 Ga0495643_0039373 3300046522 Bacteria 2585
232 Ga0495643_0072704 3300046522 Bacteria 1803
233 Ga0495644_0009205 3300046523 Bacteria 3805
234 Ga0495644_0016224 3300046523 Bacteria 2851
235 Ga0495644_0023864 3300046523 Bacteria 2327
236 Ga0495648_0000412 3300046524 Bacteria 47204
237 Ga0495648_0001098 3300046524 Bacteria 27531
238 Ga0495648_0066207 3300046524 Bacteria 2119
239 Ga0495666_0012845 3300046526 Bacteria 4174
240 Ga0495666_0024198 3300046526 Bacteria 3001
241 Ga0495642_0000418 3300046528 Bacteria 22690
242 Ga0495642_0000684 3300046528 Bacteria 16814
243 Ga0495642_0002488 3300046528 Bacteria 7489
244 Ga0495642_0005175 3300046528 Bacteria 5017
245 Ga0495642_0012538 3300046528 Bacteria 3266
246 Ga0495642_0022289 3300046528 Bacteria 2495
247 Ga0495642_0029593 3300046528 Bacteria 2187
248 Ga0495642_0060126 3300046528 Bacteria 1575
249 Ga0495642_0062595 3300046528 Bacteria 1545
250 Ga0495642_0133093 3300046528 Bacteria 1071
251 Ga0495642_0210471 3300046528 Bacteria 848
252 Ga0495654_0009757 3300046530 Bacteria 5251
253 Ga0495654_0012363 3300046530 Bacteria 4586
254 Ga0495654_0117937 3300046530 Bacteria 1204
255 Ga0495665_0232433 3300046531 Bacteria 952
256 Ga0495586_0139143 3300046535 Unclassified 1362
257 Ga0495609_0000022 3300046538 Bacteria 279488
258 Ga0495609_0000482 3300046538 Bacteria 31993
259 Ga0495609_0003627 3300046538 Bacteria 8761
260 Ga0495609_0022716 3300046538 Bacteria 2890
261 Ga0495609_0031505 3300046538 Bacteria 2409
262 Ga0495609_0031837 3300046538 Bacteria 2397
263 Ga0495609_0036416 3300046538 Bacteria 2221
264 Ga0495609_0040466 3300046538 Bacteria 2097
265 Ga0495597_0000104 3300046542 Bacteria 75532
266 Ga0495597_0005550 3300046542 Bacteria 6667
267 Ga0495597_0007438 3300046542 Bacteria 5562
268 Ga0495597_0071407 3300046542 Bacteria 1495
269 Ga0495597_0115090 3300046542 Bacteria 1125
270 Ga0495645_0146484 3300046543 Bacteria 1644
271 Ga0495622_0023811 3300046557 Bacteria 2857
272 Ga0495622_0065727 3300046557 Bacteria 1676
273 Ga0495633_0004673 3300046558 Bacteria 8615
274 Ga0495633_0007297 3300046558 Bacteria 6382
275 Ga0495633_0037507 3300046558 Bacteria 2318
276 Ga0495633_0044489 3300046558 Bacteria 2104
277 Ga0495633_0056453 3300046558 Bacteria 1845
278 Ga0495656_0006654 3300046615 Bacteria 4057
279 Ga0495656_0023544 3300046615 Bacteria 2424
280 Ga0495656_0030935 3300046615 Bacteria 2167
281 Ga0495656_0071849 3300046615 Bacteria 1539
282 Ga0495656_0197873 3300046615 Bacteria 996
283 Ga0495668_0002850 3300046616 Bacteria 13717
284 Ga0495668_0023703 3300046616 Bacteria 3496
285 Ga0495668_0058732 3300046616 Bacteria 2122
286 Ga0495668_0119482 3300046616 Bacteria 1441
287 Ga0495611_0000436 3300046648 Bacteria 25739
288 Ga0495611_0015324 3300046648 Bacteria 3276
289 Ga0495611_0031444 3300046648 Bacteria 2336
290 Ga0495611_0076862 3300046648 Bacteria 1530
291 Ga0495611_0163728 3300046648 Bacteria 1039
292 Ga0495625_0091480 3300046660 Bacteria 2103
293 Ga0495661_0000350 3300046665 Bacteria 50303
294 Ga0495661_0000492 3300046665 Bacteria 41365
295 Ga0495661_0001279 3300046665 Bacteria 21554
296 Ga0495661_0003298 3300046665 Bacteria 11976
297 Ga0495661_0018552 3300046665 Bacteria 4572
298 Ga0495661_0023878 3300046665 Bacteria 3963
299 Ga0495661_0030674 3300046665 Bacteria 3420
300 Ga0495661_0065349 3300046665 Bacteria 2143
301 Ga0495661_0074558 3300046665 Bacteria 1974
302 Ga0495661_0100055 3300046665 Bacteria 1633
303 Ga0495661_0117112 3300046665 Bacteria 1476
304 Ga0495661_0151395 3300046665 Bacteria 1253
305 Ga0495588_0000148 3300046674 Bacteria 100600
306 Ga0495588_0011065 3300046674 Bacteria 4223
307 Ga0495588_0012108 3300046674 Bacteria 4067
308 Ga0495588_0014541 3300046674 Bacteria 3768
309 Ga0495669_0000060 3300046684 Bacteria 73237
310 Ga0495669_0000887 3300046684 Bacteria 12604
311 Ga0495669_0021914 3300046684 Bacteria 2775
312 Ga0495669_0023722 3300046684 Bacteria 2672
313 Ga0495613_0067120 3300046689 Bacteria 2618
314 Ga0495670_0001856 3300046691 Bacteria 10395
315 Ga0495670_0003575 3300046691 Bacteria 7633
316 Ga0495670_0101421 3300046691 Bacteria 1482
317 Ga0495671_0002580 3300046692 Bacteria 11403
318 Ga0495671_0027088 3300046692 Bacteria 2962
319 Ga0495671_0028183 3300046692 Bacteria 2895
320 Ga0495671_0082726 3300046692 Bacteria 1573
321 Ga0495649_0000072 3300046694 Bacteria 86748
322 Ga0495649_0040282 3300046694 Bacteria 2559
323 Ga0495649_0043634 3300046694 Bacteria 2447
324 Ga0495649_0055852 3300046694 Bacteria 2133
325 Ga0495589_0000017 3300046794 Bacteria 206113
326 Ga0495589_0000125 3300046794 Bacteria 71429
327 Ga0495589_0000271 3300046794 Bacteria 42167
328 Ga0495589_0001345 3300046794 Bacteria 14413
329 Ga0495589_0025490 3300046794 Bacteria 3000
330 Ga0495589_0045706 3300046794 Bacteria 2175
331 Ga0495589_0099262 3300046794 Bacteria 1409
332 Ga0495660_0000162 3300046810 Bacteria 71874
333 Ga0495660_0006161 3300046810 Bacteria 7120
334 Ga0495660_0012150 3300046810 Bacteria 4997
335 Ga0495660_0034272 3300046810 Bacteria 2842
336 Ga0495660_0155764 3300046810 Bacteria 1124
337 Ga0495581_0003788 3300047315 Bacteria 8700
338 Ga0495672_0000067 3300047320 Bacteria 190335
339 Ga0495672_0059946 3300047320 Bacteria 2200
340 Ga0495672_0127858 3300047320 Bacteria 1341
341 Ga0495676_0000123 3300047321 Bacteria 59710
342 Ga0495676_0029270 3300047321 Bacteria 4691
343 Ga0495676_0040751 3300047321 Bacteria 3830
344 Ga0495676_0084026 3300047321 Bacteria 2403
345 Ga0495683_0000069 3300047323 Bacteria 110339
346 Ga0495683_0014331 3300047323 Bacteria 4131
347 Ga0495683_0019602 3300047323 Bacteria 3490
348 Ga0495683_0036321 3300047323 Bacteria 2502
349 Ga0495683_0100446 3300047323 Bacteria 1391
350 Ga0495687_000113 3300047443 Bacteria 123712
351 Ga0495687_000140 3300047443 Bacteria 109311
352 Ga0495687_000175 3300047443 Bacteria 94911
353 Ga0495687_000236 3300047443 Bacteria 76970
354 Ga0495687_000507 3300047443 Bacteria 46874
355 Ga0495677_0000002 3300047445 Bacteria 346767
356 Ga0495677_0003034 3300047445 Bacteria 6530
357 Ga0495677_0012493 3300047445 Bacteria 3096
358 Ga0495677_0013737 3300047445 Bacteria 2946
359 Ga0495677_0016786 3300047445 Bacteria 2655
360 Ga0495677_0077011 3300047445 Bacteria 1247
361 Ga0495677_0097242 3300047445 Bacteria 1112
362 Ga0495679_023953 3300047446 Bacteria 2063
363 Ga0495679_031253 3300047446 Bacteria 1718
364 Ga0495681_0000704 3300047470 Bacteria 25533
365 Ga0495681_0009928 3300047470 Bacteria 5813
366 Ga0495681_0009974 3300047470 Bacteria 5787
367 Ga0495681_0022025 3300047470 Bacteria 3419
368 Ga0495681_0029179 3300047470 Bacteria 2827
369 Ga0495686_0000828 3300047472 Bacteria 39787
370 Ga0495686_0048696 3300047472 Bacteria 2671
371 Ga0495614_0021413 3300048089 Bacteria 2792
372 Ga0495626_0000170 3300048091 Bacteria 80445
373 Ga0495626_0001478 3300048091 Bacteria 18552
374 Ga0495626_0003699 3300048091 Bacteria 9682
375 Ga0495626_0003800 3300048091 Bacteria 9486
376 Ga0495626_0011839 3300048091 Bacteria 4593
377 Ga0495626_0031228 3300048091 Bacteria 2565
378 Ga0495626_0039726 3300048091 Bacteria 2225
379 Ga0495626_0040674 3300048091 Bacteria 2195
380 Ga0495626_0041392 3300048091 Bacteria 2170
381 Ga0496100_0025222 3300048903 Bacteria 3634
382 Ga0496100_0063070 3300048903 Bacteria 2448
383 Ga0496101_0034929 3300048904 Bacteria 3553
384 Ga0496102_0000156 3300048905 Bacteria 92538
385 Ga0496102_0028097 3300048905 Bacteria 5026
386 Ga0496102_0351935 3300048905 Bacteria 1387
387 Ga0496102_0555901 3300048905 Bacteria 1070
388 Ga0496103_0022168 3300048906 Bacteria 3823
389 Ga0496104_0085584 3300048907 Bacteria 3009
390 Ga0496104_0160025 3300048907 Bacteria 2160
391 Ga0496104_0597662 3300048907 Bacteria 1014
392 Ga0496105_0067330 3300048908 Bacteria 2957
393 Ga0496106_0004418 3300048909 Bacteria 10417
394 Ga0496106_0130991 3300048909 Bacteria 1967
395 Ga0496108_0494476 3300048911 Bacteria 1068
396 Ga0496109_0134954 3300048912 Bacteria 2305
397 Ga0496110_0024625 3300048913 Bacteria 5132
398 Ga0496111_0042714 3300048914 Bacteria 3256
399 Ga0496112_0103287 3300048915 Bacteria 2820
400 Ga0496113_0002696 3300048916 Bacteria 10422
401 Ga0496113_0009538 3300048916 Bacteria 6366
402 Ga0496113_0561555 3300048916 Bacteria 915
403 Ga0496115_0029510 3300048918 Bacteria 4308
404 Ga0496115_0139296 3300048918 Bacteria 2001
405 Ga0496121_0039005 3300048924 Bacteria 4195
406 Ga0496122_0000653 3300048925 Bacteria 70150
407 Ga0496122_0004423 3300048925 Bacteria 17476
408 Ga0496122_0006881 3300048925 Bacteria 12867
409 Ga0496122_0113680 3300048925 Bacteria 1768
410 Ga0496123_0000196 3300048926 Bacteria 122955
411 Ga0496123_0002025 3300048926 Bacteria 26161
412 Ga0496123_0209877 3300048926 Bacteria 991
413 Ga0496124_0064278 3300048927 Bacteria 3064
414 Ga0496124_0069036 3300048927 Bacteria 2935
415 Ga0496124_0142802 3300048927 Bacteria 1887
416 Ga0496124_0187509 3300048927 Bacteria 1586
417 Ga0496125_0003691 3300048928 Bacteria 18272
418 Ga0501308_000499 3300049128 Bacteria 2590
419 Ga0501304_000848 3300049160 Bacteria 1778
420 Ga0495678_000145 3300049459 Bacteria 86070
421 Ga0495678_000418 3300049459 Bacteria 42851
422 Ga0495678_001248 3300049459 Bacteria 20698
423 Ga0495678_002988 3300049459 Bacteria 10782
424 Ga0495678_006996 3300049459 Bacteria 5917
425 Ga0495682_0000204 3300049460 Bacteria 47566
426 Ga0495682_0004488 3300049460 Bacteria 5960
427 Ga0495682_0011866 3300049460 Bacteria 3349
428 Ga0495682_0014821 3300049460 Bacteria 2954
429 Ga0501035_0000482 3300049822 Bacteria 44797
430 Ga0466962_0022306 3300061719 Bacteria 3042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0003575 Ga0495670_0003575_3124_3828 199
2 3300049460 Ga0495682_0011866 Ga0495682_0011866_156_839 204
3 3300047472 Ga0495686_0048696 Ga0495686_0048696_1291_1992 205
4 3300048925 Ga0496122_0113680 Ga0496122_0113680_635_1342 205
5 3300048926 Ga0496123_0209877 Ga0496123_0209877_73_780 205
6 3300046458 Ga0495591_017718 Ga0495591_017718_376_1077 206
7 3300046474 Ga0495605_0079242 Ga0495605_0079242_49_750 206
8 3300046491 Ga0495584_0013047 Ga0495584_0013047_2433_3134 206
9 3300046492 Ga0495585_0155801 Ga0495585_0155801_147_848 206
10 3300046500 Ga0495596_0040509 Ga0495596_0040509_371_1072 206
11 3300046506 Ga0495583_0049981 Ga0495583_0049981_841_1542 206
12 3300046507 Ga0495606_0037419 Ga0495606_0037419_55_756 206
13 3300046513 Ga0495616_0022337 Ga0495616_0022337_156_857 206
14 3300046518 Ga0495631_0020111 Ga0495631_0020111_2394_3095 206
15 3300046519 Ga0495632_0071868 Ga0495632_0071868_913_1614 206
16 3300046520 Ga0495637_0128291 Ga0495637_0128291_67_768 206
17 3300046523 Ga0495644_0023864 Ga0495644_0023864_1587_2288 206
18 3300046528 Ga0495642_0012538 Ga0495642_0012538_197_898 206
19 3300046538 Ga0495609_0003627 Ga0495609_0003627_6670_7371 206
20 3300046616 Ga0495668_0119482 Ga0495668_0119482_494_1195 206
21 3300046648 Ga0495611_0076862 Ga0495611_0076862_371_1072 206
22 3300046665 Ga0495661_0117112 Ga0495661_0117112_611_1312 206
23 3300047323 Ga0495683_0019602 Ga0495683_0019602_2608_3309 206
24 3300048091 Ga0495626_0040674 Ga0495626_0040674_686_1387 206
25 3300048927 Ga0496124_0187509 Ga0496124_0187509_838_1539 206
26 3300037466 Ga0395898_0556812 Ga0395898_0556812_30_749 208
27 3300038443 Ga0395901_0395070 Ga0395901_0395070_582_1331 208
28 3300046492 Ga0495585_0034599 Ga0495585_0034599_1420_2124 208
29 3300046507 Ga0495606_0211158 Ga0495606_0211158_126_821 208
30 3300046665 Ga0495661_0151395 Ga0495661_0151395_291_995 208
31 3300046674 Ga0495588_0011065 Ga0495588_0011065_952_1656 208
32 3300048907 Ga0496104_0597662 Ga0496104_0597662_330_995 209
33 3300047446 Ga0495679_023953 Ga0495679_023953_382_1140 210
34 3300046452 Ga0495617_000026 Ga0495617_000026_87127_87840 211
35 3300046453 Ga0495627_000043 Ga0495627_000043_65084_65797 211
36 3300046474 Ga0495605_0000113 Ga0495605_0000113_33525_34238 211
37 3300046492 Ga0495585_0090385 Ga0495585_0090385_460_1173 211
38 3300046500 Ga0495596_0016488 Ga0495596_0016488_1186_1899 211
39 3300046501 Ga0495607_0054095 Ga0495607_0054095_988_1701 211
40 3300046513 Ga0495616_0012939 Ga0495616_0012939_3216_3929 211
41 3300046518 Ga0495631_0009690 Ga0495631_0009690_1520_2233 211
42 3300046523 Ga0495644_0016224 Ga0495644_0016224_1323_2036 211
43 3300046524 Ga0495648_0000412 Ga0495648_0000412_13034_13747 211
44 3300046528 Ga0495642_0000684 Ga0495642_0000684_1824_2537 211
45 3300046538 Ga0495609_0040466 Ga0495609_0040466_1335_2048 211
46 3300046558 Ga0495633_0044489 Ga0495633_0044489_906_1619 211
47 3300046615 Ga0495656_0006654 Ga0495656_0006654_2732_3445 211
48 3300046616 Ga0495668_0002850 Ga0495668_0002850_11440_12153 211
49 3300046665 Ga0495661_0003298 Ga0495661_0003298_9654_10367 211
50 3300046692 Ga0495671_0002580 Ga0495671_0002580_9066_9779 211
51 3300046794 Ga0495589_0001345 Ga0495589_0001345_7128_7841 211
52 3300047445 Ga0495677_0016786 Ga0495677_0016786_758_1471 211
53 3300046500 Ga0495596_0013753 Ga0495596_0013753_1167_1871 212
54 3300046512 Ga0495610_0067054 Ga0495610_0067054_278_982 212
55 3300046692 Ga0495671_0082726 Ga0495671_0082726_690_1394 212
56 3300048903 Ga0496100_0025222 Ga0496100_0025222_1347_2051 212
57 3300048904 Ga0496101_0034929 Ga0496101_0034929_2805_3509 212
58 3300046500 Ga0495596_0120309 Ga0495596_0120309_30_734 213
59 3300046530 Ga0495654_0117937 Ga0495654_0117937_548_1192 213
60 3300046528 Ga0495642_0210471 Ga0495642_0210471_181_828 214
61 3300046530 Ga0495654_0012363 Ga0495654_0012363_3859_4572 214
62 3300046538 Ga0495609_0036416 Ga0495609_0036416_810_1514 215
63 3300048927 Ga0496124_0142802 Ga0496124_0142802_133_852 216
64 3300046519 Ga0495632_0000098 Ga0495632_0000098_36787_37491 217
65 3300046531 Ga0495665_0232433 Ga0495665_0232433_11_730 217
66 3300046535 Ga0495586_0139143 Ga0495586_0139143_338_1075 217
67 3300046542 Ga0495597_0000104 Ga0495597_0000104_15727_16431 217
68 3300046542 Ga0495597_0005550 Ga0495597_0005550_899_1684 217
69 3300046810 Ga0495660_0012150 Ga0495660_0012150_3510_4214 217
70 3300049459 Ga0495678_000418 Ga0495678_000418_12229_12933 217
71 3300037312 Ga0395899_0010433 Ga0395899_0010433_6448_7104 218
72 3300046506 Ga0495583_0021038 Ga0495583_0021038_330_1034 220
73 3300048091 Ga0495626_0041392 Ga0495626_0041392_400_1104 220
74 3300046528 Ga0495642_0133093 Ga0495642_0133093_270_947 221
75 3300031838 Ga0307518_10005923 Ga0307518_100059232 222
76 3300046501 Ga0495607_0018835 Ga0495607_0018835_2091_2792 222
77 3300046794 Ga0495589_0099262 Ga0495589_0099262_240_941 222
78 3300042145 Ga0450906_034036 Ga0450906_034036_178_876 224
79 3300046491 Ga0495584_0116687 Ga0495584_0116687_51_755 224
80 3300046522 Ga0495643_0072704 Ga0495643_0072704_648_1331 225
81 3300046694 Ga0495649_0043634 Ga0495649_0043634_44_727 225
82 3300048911 Ga0496108_0494476 Ga0496108_0494476_254_937 225
83 3300048913 Ga0496110_0024625 Ga0496110_0024625_3737_4420 225
84 3300048914 Ga0496111_0042714 Ga0496111_0042714_1075_1758 225
85 3300046455 Ga0495603_0016434 Ga0495603_0016434_72_767 226
86 3300046459 Ga0495629_0088695 Ga0495629_0088695_720_1403 226
87 3300046471 Ga0495650_0000304 Ga0495650_0000304_4662_5369 226
88 3300046473 Ga0495582_0007922 Ga0495582_0007922_4536_5231 226
89 3300046474 Ga0495605_0057366 Ga0495605_0057366_246_953 226
90 3300046474 Ga0495605_0100102 Ga0495605_0100102_59_742 226
91 3300046491 Ga0495584_0013918 Ga0495584_0013918_2573_3256 226
92 3300046492 Ga0495585_0049444 Ga0495585_0049444_51_746 226
93 3300046492 Ga0495585_0118735 Ga0495585_0118735_195_878 226
94 3300046499 Ga0495594_0099129 Ga0495594_0099129_255_950 226
95 3300046500 Ga0495596_0010414 Ga0495596_0010414_677_1372 226
96 3300046500 Ga0495596_0020275 Ga0495596_0020275_2019_2702 226
97 3300046501 Ga0495607_0027041 Ga0495607_0027041_707_1402 226
98 3300046501 Ga0495607_0073165 Ga0495607_0073165_801_1484 226
99 3300046518 Ga0495631_0054292 Ga0495631_0054292_325_1008 226
100 3300046524 Ga0495648_0001098 Ga0495648_0001098_15583_16290 226
101 3300046528 Ga0495642_0029593 Ga0495642_0029593_596_1291 226
102 3300046528 Ga0495642_0062595 Ga0495642_0062595_400_1083 226
103 3300046538 Ga0495609_0000482 Ga0495609_0000482_22031_22738 226
104 3300046542 Ga0495597_0115090 Ga0495597_0115090_221_904 226
105 3300046557 Ga0495622_0023811 Ga0495622_0023811_874_1557 226
106 3300046558 Ga0495633_0037507 Ga0495633_0037507_1011_1706 226
107 3300046616 Ga0495668_0058732 Ga0495668_0058732_346_1041 226
108 3300046648 Ga0495611_0031444 Ga0495611_0031444_899_1582 226
109 3300046665 Ga0495661_0100055 Ga0495661_0100055_40_735 226
110 3300046674 Ga0495588_0012108 Ga0495588_0012108_254_949 226
111 3300046684 Ga0495669_0000060 Ga0495669_0000060_9972_10667 226
112 3300046689 Ga0495613_0067120 Ga0495613_0067120_1566_2261 226
113 3300046691 Ga0495670_0001856 Ga0495670_0001856_6997_7680 226
114 3300047315 Ga0495581_0003788 Ga0495581_0003788_337_1020 226
115 3300047321 Ga0495676_0000123 Ga0495676_0000123_22124_22807 226
116 3300047323 Ga0495683_0100446 Ga0495683_0100446_582_1265 226
117 3300047445 Ga0495677_0097242 Ga0495677_0097242_81_764 226
118 3300048089 Ga0495614_0021413 Ga0495614_0021413_328_1023 226
119 3300046455 Ga0495603_0003991 Ga0495603_0003991_3777_4475 227
120 3300046492 Ga0495585_0038899 Ga0495585_0038899_918_1616 227
121 3300046499 Ga0495594_0098299 Ga0495594_0098299_426_1124 227
122 3300046507 Ga0495606_0058424 Ga0495606_0058424_497_1207 227
123 3300046513 Ga0495616_0000201 Ga0495616_0000201_12073_12771 227
124 3300046518 Ga0495631_0018296 Ga0495631_0018296_1797_2495 227
125 3300046518 Ga0495631_0254633 Ga0495631_0254633_52_735 227
126 3300046519 Ga0495632_0001356 Ga0495632_0001356_9405_10103 227
127 3300046530 Ga0495654_0009757 Ga0495654_0009757_2772_3482 227
128 3300046538 Ga0495609_0031837 Ga0495609_0031837_648_1346 227
129 3300046542 Ga0495597_0071407 Ga0495597_0071407_373_1059 227
130 3300046665 Ga0495661_0074558 Ga0495661_0074558_652_1335 227
131 3300046674 Ga0495588_0014541 Ga0495588_0014541_2488_3186 227
132 3300046684 Ga0495669_0000887 Ga0495669_0000887_6835_7533 227
133 3300046694 Ga0495649_0055852 Ga0495649_0055852_1052_1753 227
134 3300047320 Ga0495672_0127858 Ga0495672_0127858_97_780 227
135 3300047321 Ga0495676_0029270 Ga0495676_0029270_3908_4624 227
136 3300048905 Ga0496102_0000156 Ga0496102_0000156_75702_76397 227
137 iso_pu_bacteria 2643221556 2643800326 227
138 iso_pu_bacteria 2643221684 2644471895 227
139 iso_pu_bacteria 8047673197 8047675213 227
140 3300037471 Ga0395905_0619979 Ga0395905_0619979_83_799 228
141 3300046455 Ga0495603_0035268 Ga0495603_0035268_145_858 228
142 3300046471 Ga0495650_0000048 Ga0495650_0000048_291889_292614 228
143 3300046471 Ga0495650_0004331 Ga0495650_0004331_6548_7276 228
144 3300046471 Ga0495650_0048546 Ga0495650_0048546_424_1149 228
145 3300046473 Ga0495582_0125109 Ga0495582_0125109_123_836 228
146 3300046492 Ga0495585_0136890 Ga0495585_0136890_54_767 228
147 3300046499 Ga0495594_0005090 Ga0495594_0005090_3454_4167 228
148 3300046526 Ga0495666_0012845 Ga0495666_0012845_164_877 228
149 3300046526 Ga0495666_0024198 Ga0495666_0024198_620_1333 228
150 3300046557 Ga0495622_0065727 Ga0495622_0065727_651_1364 228
151 3300046694 Ga0495649_0040282 Ga0495649_0040282_536_1234 228
152 3300047321 Ga0495676_0084026 Ga0495676_0084026_439_1152 228
153 3300047323 Ga0495683_0036321 Ga0495683_0036321_1762_2487 228
154 3300049459 Ga0495678_001248 Ga0495678_001248_16724_17449 228
155 3300049459 Ga0495678_006996 Ga0495678_006996_740_1465 228
156 3300037418 Ga0395900_0073299 Ga0395900_0073299_1287_1988 229
157 3300037471 Ga0395905_0120656 Ga0395905_0120656_129_830 229
158 3300046457 Ga0495590_0000041 Ga0495590_0000041_74498_75208 229
159 3300046458 Ga0495591_000916 Ga0495591_000916_15903_16613 229
160 3300046460 Ga0495638_0218299 Ga0495638_0218299_136_840 229
161 3300046471 Ga0495650_0010369 Ga0495650_0010369_2045_2749 229
162 3300046474 Ga0495605_0001195 Ga0495605_0001195_12556_13266 229
163 3300046491 Ga0495584_0000216 Ga0495584_0000216_25761_26471 229
164 3300046491 Ga0495584_0019757 Ga0495584_0019757_1583_2329 229
165 3300046492 Ga0495585_0015375 Ga0495585_0015375_2384_3094 229
166 3300046492 Ga0495585_0015787 Ga0495585_0015787_614_1318 229
167 3300046492 Ga0495585_0207002 Ga0495585_0207002_152_865 229
168 3300046492 Ga0495585_0289757 Ga0495585_0289757_43_747 229
169 3300046500 Ga0495596_0002605 Ga0495596_0002605_1247_1951 229
170 3300046500 Ga0495596_0006551 Ga0495596_0006551_4595_5299 229
171 3300046500 Ga0495596_0010667 Ga0495596_0010667_1929_2639 229
172 3300046501 Ga0495607_0001944 Ga0495607_0001944_9308_10021 229
173 3300046501 Ga0495607_0002990 Ga0495607_0002990_5610_6320 229
174 3300046506 Ga0495583_0001813 Ga0495583_0001813_15509_16219 229
175 3300046506 Ga0495583_0005658 Ga0495583_0005658_6479_7183 229
176 3300046506 Ga0495583_0011174 Ga0495583_0011174_2687_3391 229
177 3300046506 Ga0495583_0013157 Ga0495583_0013157_2963_3667 229
178 3300046506 Ga0495583_0067035 Ga0495583_0067035_869_1573 229
179 3300046512 Ga0495610_0006430 Ga0495610_0006430_6026_6736 229
180 3300046513 Ga0495616_0007606 Ga0495616_0007606_4985_5689 229
181 3300046513 Ga0495616_0021380 Ga0495616_0021380_1438_2148 229
182 3300046513 Ga0495616_0024684 Ga0495616_0024684_1837_2550 229
183 3300046518 Ga0495631_0000111 Ga0495631_0000111_44164_44874 229
184 3300046518 Ga0495631_0060365 Ga0495631_0060365_644_1348 229
185 3300046519 Ga0495632_0001412 Ga0495632_0001412_12183_12896 229
186 3300046519 Ga0495632_0007436 Ga0495632_0007436_992_1702 229
187 3300046520 Ga0495637_0000013 Ga0495637_0000013_53915_54625 229
188 3300046522 Ga0495643_0000548 Ga0495643_0000548_8230_8943 229
189 3300046523 Ga0495644_0009205 Ga0495644_0009205_1066_1776 229
190 3300046528 Ga0495642_0002488 Ga0495642_0002488_1552_2256 229
191 3300046528 Ga0495642_0005175 Ga0495642_0005175_3315_4025 229
192 3300046528 Ga0495642_0060126 Ga0495642_0060126_62_766 229
193 3300046538 Ga0495609_0022716 Ga0495609_0022716_229_939 229
194 3300046538 Ga0495609_0031505 Ga0495609_0031505_710_1414 229
195 3300046542 Ga0495597_0007438 Ga0495597_0007438_1874_2590 229
196 3300046558 Ga0495633_0004673 Ga0495633_0004673_6840_7550 229
197 3300046558 Ga0495633_0007297 Ga0495633_0007297_3245_3949 229
198 3300046558 Ga0495633_0056453 Ga0495633_0056453_609_1325 229
199 3300046615 Ga0495656_0030935 Ga0495656_0030935_302_1006 229
200 3300046615 Ga0495656_0071849 Ga0495656_0071849_13_717 229
201 3300046616 Ga0495668_0023703 Ga0495668_0023703_659_1369 229
202 3300046648 Ga0495611_0000436 Ga0495611_0000436_8305_9015 229
203 3300046648 Ga0495611_0015324 Ga0495611_0015324_193_909 229
204 3300046648 Ga0495611_0163728 Ga0495611_0163728_132_848 229
205 3300046660 Ga0495625_0091480 Ga0495625_0091480_1283_1987 229
206 3300046665 Ga0495661_0001279 Ga0495661_0001279_1533_2246 229
207 3300046665 Ga0495661_0023878 Ga0495661_0023878_59_763 229
208 3300046665 Ga0495661_0030674 Ga0495661_0030674_1893_2597 229
209 3300046665 Ga0495661_0065349 Ga0495661_0065349_106_816 229
210 3300046684 Ga0495669_0021914 Ga0495669_0021914_260_964 229
211 3300046684 Ga0495669_0023722 Ga0495669_0023722_153_863 229
212 3300046691 Ga0495670_0101421 Ga0495670_0101421_427_1131 229
213 3300046692 Ga0495671_0027088 Ga0495671_0027088_1027_1731 229
214 3300046692 Ga0495671_0028183 Ga0495671_0028183_945_1649 229
215 3300046694 Ga0495649_0000072 Ga0495649_0000072_12977_13687 229
216 3300046794 Ga0495589_0000125 Ga0495589_0000125_13228_13944 229
217 3300046794 Ga0495589_0025490 Ga0495589_0025490_1536_2246 229
218 3300046794 Ga0495589_0045706 Ga0495589_0045706_150_866 229
219 3300046810 Ga0495660_0006161 Ga0495660_0006161_1324_2034 229
220 3300046810 Ga0495660_0034272 Ga0495660_0034272_934_1638 229
221 3300046810 Ga0495660_0155764 Ga0495660_0155764_100_804 229
222 3300047320 Ga0495672_0000067 Ga0495672_0000067_10670_11380 229
223 3300047320 Ga0495672_0059946 Ga0495672_0059946_423_1136 229
224 3300047321 Ga0495676_0040751 Ga0495676_0040751_1398_2117 229
225 3300047323 Ga0495683_0000069 Ga0495683_0000069_74759_75469 229
226 3300047443 Ga0495687_000113 Ga0495687_000113_70126_70830 229
227 3300047443 Ga0495687_000140 Ga0495687_000140_58342_59058 229
228 3300047445 Ga0495677_0003034 Ga0495677_0003034_4755_5465 229
229 3300047445 Ga0495677_0012493 Ga0495677_0012493_1278_1991 229
230 3300047445 Ga0495677_0077011 Ga0495677_0077011_154_858 229
231 3300047446 Ga0495679_031253 Ga0495679_031253_775_1485 229
232 3300047470 Ga0495681_0000704 Ga0495681_0000704_9315_10019 229
233 3300047470 Ga0495681_0009928 Ga0495681_0009928_3315_4025 229
234 3300047470 Ga0495681_0009974 Ga0495681_0009974_4482_5186 229
235 3300047470 Ga0495681_0022025 Ga0495681_0022025_2161_2907 229
236 3300047470 Ga0495681_0029179 Ga0495681_0029179_1168_1884 229
237 3300047472 Ga0495686_0000828 Ga0495686_0000828_24247_24951 229
238 3300048091 Ga0495626_0003699 Ga0495626_0003699_7909_8655 229
239 3300048091 Ga0495626_0003800 Ga0495626_0003800_7918_8628 229
240 3300048091 Ga0495626_0011839 Ga0495626_0011839_3863_4576 229
241 3300048091 Ga0495626_0031228 Ga0495626_0031228_826_1530 229
242 3300048091 Ga0495626_0039726 Ga0495626_0039726_1495_2208 229
243 3300048906 Ga0496103_0022168 Ga0496103_0022168_2535_3239 229
244 3300048912 Ga0496109_0134954 Ga0496109_0134954_492_1196 229
245 3300048915 Ga0496112_0103287 Ga0496112_0103287_991_1695 229
246 3300048916 Ga0496113_0009538 Ga0496113_0009538_1449_2153 229
247 3300048918 Ga0496115_0029510 Ga0496115_0029510_764_1468 229
248 3300048918 Ga0496115_0139296 Ga0496115_0139296_372_1085 229
249 3300048925 Ga0496122_0000653 Ga0496122_0000653_60312_61016 229
250 3300048926 Ga0496123_0000196 Ga0496123_0000196_60380_61084 229
251 3300048927 Ga0496124_0064278 Ga0496124_0064278_156_860 229
252 3300048928 Ga0496125_0003691 Ga0496125_0003691_13622_14326 229
253 3300049459 Ga0495678_000145 Ga0495678_000145_15553_16263 229
254 3300049459 Ga0495678_002988 Ga0495678_002988_4646_5350 229
255 3300049460 Ga0495682_0000204 Ga0495682_0000204_10339_11043 229
256 3300049460 Ga0495682_0004488 Ga0495682_0004488_839_1543 229
257 3300049460 Ga0495682_0014821 Ga0495682_0014821_945_1655 229
258 3300003322 rootL2_10023876 rootL2_100238762 231
259 3300003322 rootL2_10187929 rootL2_101879292 231
260 3300003759 Ga0055525_1000074 Ga0055525_1000074151 231
261 3300005327 Ga0070658_10146436 Ga0070658_101464362 231
262 3300005327 Ga0070658_10194686 Ga0070658_101946862 231
263 3300005328 Ga0070676_10222218 Ga0070676_102222182 231
264 3300005339 Ga0070660_100017387 Ga0070660_1000173872 231
265 3300005339 Ga0070660_100067351 Ga0070660_1000673512 231
266 3300005344 Ga0070661_100173872 Ga0070661_1001738722 231
267 3300005366 Ga0070659_100092183 Ga0070659_1000921832 231
268 3300005459 Ga0068867_100428028 Ga0068867_1004280282 231
269 3300005563 Ga0068855_100113803 Ga0068855_1001138033 231
270 3300005564 Ga0070664_100249052 Ga0070664_1002490522 231
271 3300005564 Ga0070664_100429703 Ga0070664_1004297032 231
272 3300005616 Ga0068852_100402619 Ga0068852_1004026192 231
273 3300006881 Ga0068865_100471488 Ga0068865_1004714881 231
274 3300009036 Ga0105244_10086321 Ga0105244_100863212 231
275 3300009093 Ga0105240_10654078 Ga0105240_106540782 231
276 3300009174 Ga0105241_10023935 Ga0105241_100239352 231
277 3300009176 Ga0105242_10093473 Ga0105242_100934732 231
278 3300009551 Ga0105238_10037598 Ga0105238_100375982 231
279 3300010375 Ga0105239_10207938 Ga0105239_102079382 231
280 3300010375 Ga0105239_10591803 Ga0105239_105918032 231
281 3300013104 Ga0157370_10320505 Ga0157370_103205052 231
282 3300013307 Ga0157372_10150248 Ga0157372_101502485 231
283 3300025230 Ga0209563_100003 Ga0209563_100003150 231
284 3300025253 Ga0209677_101919 Ga0209677_1019192 231
285 3300025254 Ga0209148_1000203 Ga0209148_100020354 231
286 3300025321 Ga0207656_10304366 Ga0207656_103043661 231
287 3300025909 Ga0207705_10003993 Ga0207705_100039932 231
288 3300025909 Ga0207705_10658412 Ga0207705_106584121 231
289 3300025911 Ga0207654_10003676 Ga0207654_100036762 231
290 3300025913 Ga0207695_10152913 Ga0207695_101529132 231
291 3300025919 Ga0207657_10062687 Ga0207657_100626872 231
292 3300025919 Ga0207657_10117625 Ga0207657_101176252 231
293 3300025919 Ga0207657_10123838 Ga0207657_101238382 231
294 3300025920 Ga0207649_10196238 Ga0207649_101962382 231
295 3300025932 Ga0207690_10023145 Ga0207690_100231452 231
296 3300025932 Ga0207690_10031452 Ga0207690_100314522 231
297 3300025933 Ga0207706_10197585 Ga0207706_101975852 231
298 3300025933 Ga0207706_10254411 Ga0207706_102544111 231
299 3300025934 Ga0207686_10200600 Ga0207686_102006002 231
300 3300025934 Ga0207686_10311534 Ga0207686_103115342 231
301 3300025938 Ga0207704_10194102 Ga0207704_101941021 231
302 3300025945 Ga0207679_10109519 Ga0207679_101095192 231
303 3300025949 Ga0207667_10000734 Ga0207667_100007343 231
304 3300025949 Ga0207667_10297457 Ga0207667_102974571 231
305 3300026116 Ga0207674_10104596 Ga0207674_101045962 231
306 3300026142 Ga0207698_10199514 Ga0207698_101995142 231
307 3300037312 Ga0395899_0003097 Ga0395899_0003097_2797_3492 231
308 3300037312 Ga0395899_0008429 Ga0395899_0008429_2591_3286 231
309 3300037312 Ga0395899_0107830 Ga0395899_0107830_382_1077 231
310 3300037312 Ga0395899_0340269 Ga0395899_0340269_96_791 231
311 3300037418 Ga0395900_0000230 Ga0395900_0000230_75240_75935 231
312 3300037418 Ga0395900_0003565 Ga0395900_0003565_10350_11045 231
313 3300037418 Ga0395900_0007045 Ga0395900_0007045_3289_3984 231
314 3300037418 Ga0395900_0010912 Ga0395900_0010912_891_1586 231
315 3300037418 Ga0395900_0099723 Ga0395900_0099723_1406_2101 231
316 3300037418 Ga0395900_0127177 Ga0395900_0127177_679_1374 231
317 3300037418 Ga0395900_0135117 Ga0395900_0135117_1776_2471 231
318 3300037418 Ga0395900_0203047 Ga0395900_0203047_928_1623 231
319 3300037418 Ga0395900_0280403 Ga0395900_0280403_729_1424 231
320 3300037418 Ga0395900_0304883 Ga0395900_0304883_158_853 231
321 3300037418 Ga0395900_0532582 Ga0395900_0532582_39_734 231
322 3300037466 Ga0395898_0030143 Ga0395898_0030143_1061_1756 231
323 3300037466 Ga0395898_0079312 Ga0395898_0079312_874_1569 231
324 3300037466 Ga0395898_0954062 Ga0395898_0954062_50_745 231
325 3300037471 Ga0395905_0015244 Ga0395905_0015244_1181_1876 231
326 3300037471 Ga0395905_0109669 Ga0395905_0109669_1159_1854 231
327 3300037471 Ga0395905_0111232 Ga0395905_0111232_440_1135 231
328 3300037471 Ga0395905_0392917 Ga0395905_0392917_242_937 231
329 3300038443 Ga0395901_0000074 Ga0395901_0000074_73921_74616 231
330 3300038443 Ga0395901_0005795 Ga0395901_0005795_7979_8674 231
331 3300038443 Ga0395901_0156629 Ga0395901_0156629_967_1662 231
332 3300038443 Ga0395901_0275446 Ga0395901_0275446_630_1325 231
333 3300038443 Ga0395901_0304299 Ga0395901_0304299_323_1018 231
334 3300041413 Ga0439465_0152880 Ga0439465_0152880_93_788 231
335 3300042005 Ga0439448_0002301 Ga0439448_0002301_3293_3988 231
336 3300042005 Ga0439448_0019489 Ga0439448_0019489_719_1414 231
337 3300042005 Ga0439448_0031905 Ga0439448_0031905_219_914 231
338 3300042012 Ga0439455_0012903 Ga0439455_0012903_461_1156 231
339 3300042157 Ga0439458_0008246 Ga0439458_0008246_64_759 231
340 3300042157 Ga0439458_0056950 Ga0439458_0056950_49_744 231
341 3300044656 Ga0466969_0011464 Ga0466969_0011464_1481_2176 231
342 3300044656 Ga0466969_0061328 Ga0466969_0061328_10_705 231
343 3300044658 Ga0466972_0001089 Ga0466972_0001089_5983_6678 231
344 3300044658 Ga0466972_0032543 Ga0466972_0032543_191_886 231
345 3300044658 Ga0466972_0084842 Ga0466972_0084842_74_769 231
346 3300044658 Ga0466972_0107536 Ga0466972_0107536_269_964 231
347 3300044683 Ga0466965_0021524 Ga0466965_0021524_957_1652 231
348 3300044683 Ga0466965_0036776 Ga0466965_0036776_790_1485 231
349 3300044683 Ga0466965_0062386 Ga0466965_0062386_767_1462 231
350 3300044684 Ga0466966_0021218 Ga0466966_0021218_318_1013 231
351 3300044684 Ga0466966_0026884 Ga0466966_0026884_843_1538 231
352 3300044684 Ga0466966_0169209 Ga0466966_0169209_351_1046 231
353 3300044684 Ga0466966_0192188 Ga0466966_0192188_236_931 231
354 3300044693 Ga0466961_0056534 Ga0466961_0056534_1472_2167 231
355 3300044693 Ga0466961_0084879 Ga0466961_0084879_1004_1699 231
356 3300044693 Ga0466961_0127849 Ga0466961_0127849_680_1375 231
357 3300044694 Ga0466963_0192804 Ga0466963_0192804_199_894 231
358 3300044706 Ga0466964_0000609 Ga0466964_0000609_8758_9453 231
359 3300044706 Ga0466964_0003264 Ga0466964_0003264_4573_5268 231
360 3300044706 Ga0466964_0059232 Ga0466964_0059232_651_1346 231
361 3300044706 Ga0466964_0192209 Ga0466964_0192209_106_801 231
362 3300044719 Ga0466971_0016348 Ga0466971_0016348_2068_2763 231
363 3300044735 Ga0466968_0001728 Ga0466968_0001728_6919_7614 231
364 3300044735 Ga0466968_0085870 Ga0466968_0085870_502_1197 231
365 3300044842 Ga0466957_0004477 Ga0466957_0004477_4361_5056 231
366 3300044842 Ga0466957_0045038 Ga0466957_0045038_366_1061 231
367 3300044842 Ga0466957_0163393 Ga0466957_0163393_730_1425 231
368 3300044842 Ga0466957_0385603 Ga0466957_0385603_109_804 231
369 3300045049 Ga0466959_0017479 Ga0466959_0017479_147_842 231
370 3300045049 Ga0466959_0040051 Ga0466959_0040051_1210_1905 231
371 3300045049 Ga0466959_0080260 Ga0466959_0080260_444_1139 231
372 3300045049 Ga0466959_0251596 Ga0466959_0251596_323_1018 231
373 3300045836 Ga0466958_0036443 Ga0466958_0036443_554_1249 231
374 3300045836 Ga0466958_0117736 Ga0466958_0117736_282_977 231
375 3300045836 Ga0466958_0287467 Ga0466958_0287467_302_997 231
376 3300045976 Ga0466967_0050344 Ga0466967_0050344_1132_1827 231
377 3300045976 Ga0466967_0061048 Ga0466967_0061048_973_1668 231
378 3300045976 Ga0466967_0243645 Ga0466967_0243645_886_1581 231
379 3300045976 Ga0466967_0671475 Ga0466967_0671475_44_739 231
380 3300046457 Ga0495590_0015868 Ga0495590_0015868_653_1348 231
381 3300046474 Ga0495605_0000186 Ga0495605_0000186_49433_50128 231
382 3300046474 Ga0495605_0010226 Ga0495605_0010226_3901_4596 231
383 3300046491 Ga0495584_0000325 Ga0495584_0000325_17389_18084 231
384 3300046491 Ga0495584_0008887 Ga0495584_0008887_3762_4457 231
385 3300046501 Ga0495607_0000727 Ga0495607_0000727_14781_15476 231
386 3300046501 Ga0495607_0018034 Ga0495607_0018034_1485_2180 231
387 3300046501 Ga0495607_0040827 Ga0495607_0040827_581_1276 231
388 3300046513 Ga0495616_0000500 Ga0495616_0000500_453_1148 231
389 3300046513 Ga0495616_0041055 Ga0495616_0041055_345_1040 231
390 3300046522 Ga0495643_0002266 Ga0495643_0002266_9882_10577 231
391 3300046522 Ga0495643_0039373 Ga0495643_0039373_407_1102 231
392 3300046524 Ga0495648_0066207 Ga0495648_0066207_1368_2063 231
393 3300046528 Ga0495642_0000418 Ga0495642_0000418_21399_22094 231
394 3300046528 Ga0495642_0022289 Ga0495642_0022289_957_1652 231
395 3300046538 Ga0495609_0000022 Ga0495609_0000022_56777_57472 231
396 3300046543 Ga0495645_0146484 Ga0495645_0146484_227_922 231
397 3300046615 Ga0495656_0023544 Ga0495656_0023544_81_776 231
398 3300046615 Ga0495656_0197873 Ga0495656_0197873_11_706 231
399 3300046665 Ga0495661_0000350 Ga0495661_0000350_48125_48820 231
400 3300046665 Ga0495661_0000492 Ga0495661_0000492_15811_16506 231
401 3300046665 Ga0495661_0018552 Ga0495661_0018552_1485_2180 231
402 3300046674 Ga0495588_0000148 Ga0495588_0000148_39537_40232 231
403 3300046794 Ga0495589_0000017 Ga0495589_0000017_21278_21973 231
404 3300046794 Ga0495589_0000271 Ga0495589_0000271_3426_4121 231
405 3300046810 Ga0495660_0000162 Ga0495660_0000162_53468_54163 231
406 3300047323 Ga0495683_0014331 Ga0495683_0014331_512_1207 231
407 3300047443 Ga0495687_000175 Ga0495687_000175_56751_57446 231
408 3300047443 Ga0495687_000236 Ga0495687_000236_47075_47770 231
409 3300047443 Ga0495687_000507 Ga0495687_000507_44530_45225 231
410 3300047445 Ga0495677_0000002 Ga0495677_0000002_45372_46067 231
411 3300047445 Ga0495677_0013737 Ga0495677_0013737_527_1222 231
412 3300048091 Ga0495626_0000170 Ga0495626_0000170_45745_46440 231
413 3300048091 Ga0495626_0001478 Ga0495626_0001478_15733_16428 231
414 3300048903 Ga0496100_0063070 Ga0496100_0063070_133_828 231
415 3300048905 Ga0496102_0028097 Ga0496102_0028097_3382_4077 231
416 3300048905 Ga0496102_0351935 Ga0496102_0351935_131_826 231
417 3300048905 Ga0496102_0555901 Ga0496102_0555901_193_888 231
418 3300048907 Ga0496104_0085584 Ga0496104_0085584_2254_2949 231
419 3300048907 Ga0496104_0160025 Ga0496104_0160025_73_768 231
420 3300048908 Ga0496105_0067330 Ga0496105_0067330_10_705 231
421 3300048909 Ga0496106_0004418 Ga0496106_0004418_3952_4647 231
422 3300048909 Ga0496106_0130991 Ga0496106_0130991_687_1382 231
423 3300048916 Ga0496113_0002696 Ga0496113_0002696_2462_3157 231
424 3300048916 Ga0496113_0561555 Ga0496113_0561555_146_841 231
425 3300048924 Ga0496121_0039005 Ga0496121_0039005_1208_1903 231
426 3300048925 Ga0496122_0004423 Ga0496122_0004423_15453_16148 231
427 3300048925 Ga0496122_0006881 Ga0496122_0006881_2318_3013 231
428 3300048926 Ga0496123_0002025 Ga0496123_0002025_14954_15649 231
429 3300048927 Ga0496124_0069036 Ga0496124_0069036_372_1067 231
430 3300049128 Ga0501308_000499 Ga0501308_000499_1729_2424 231
431 3300049160 Ga0501304_000848 Ga0501304_000848_1067_1762 231
432 3300049822 Ga0501035_0000482 Ga0501035_0000482_14374_15069 231
433 3300061719 Ga0466962_0022306 Ga0466962_0022306_1330_2025 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

7

121

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b1j-assembly1.cif.gz_A crystal structure of unphosphorylated chey bound to the n-terminus of flim 0.9506 1 118
2id7-assembly1.cif.gz_A 1.75 a structure of t87i phosphono-chey 0.9475 1 118
1ab6-assembly2.cif.gz_B structure of chey mutant f14n, v86t 0.946 2 118
1e6m-assembly1.cif.gz_A two-component signal transduction system d57a mutant of chey 0.9458 2 118
4lx8-assembly1.cif.gz_A crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae 0.9453 1 116
ID Description Score Start End Superfamily
af_Q7XQA6_50_170_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9539 1 117 3.40.50.2300
af_K7LHH0_84_250_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9488 2 119 3.40.50.2300
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9461 1 116 3.40.50.2300
af_Q1JSA0_6_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9433 1 118 3.40.50.2300
af_Q0D3B6_62_211_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9416 1 119 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A660PCE1-F1-model_v4 Response regulatory domain-containing protein 0.9667 1 112 GO:0000160
AF-E1IIA6-F1-model_v4 Response regulator receiver modulated diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(S) 0.9617 2 118 GO:0000160
AF-A0A0P9HB75-F1-model_v4 Response regulatory domain-containing protein 0.961 2 118 GO:0000160
AF-A0A8A7VQZ7-F1-model_v4 deleted 0.9595 2 119
AF-A0A7T9Q9L8-F1-model_v4 deleted 0.9576 1 118

Feature Viewer

pLDDT pTM Quality
93.26 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map