F441387

General Info

Members Datasets Scaffolds Average Seq Length
427 295 408 292

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100038651|Ga0070690_1000386511
Length 333
Sequence MLTVGGVTAGRSHEWSAVFLGLGAGLAGGSPTVEGMTVTIPELTLNNGVTMPALGLGVFQSPPEETTSAVETALNVGYRHIDTAAAYGNERQVGDGIGRSGLDRAAVFVETKVWVSDYGYDQTLHAFDKAIRKLGVDQLDLLILHQPAPDRFDRTVAAYKALETLLADGRVRAIGVSNFMRHHLDDLLRQTDVVPAVNQIELHPYFSQPDVQKANAEHGILTQAWSPIGGITFYPGWGEDRRNVLEDSTIGAIAVEHRKTPAQVMLRWQLQHGRSAIPKSTNPARIAENFDVFDFDLTAEQLSRIDALDTGVRNGPDPDVPRPEIFDRVVPED

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
4 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
5 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
6 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
7 2765235841 Pseudomonas putida AA7 Isolate Unclassified
8 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
9 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
10 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
11 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
12 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
13 2922554459 Rhodococcus sp. 66b Isolate Unclassified
14 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
15 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
185 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
186 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
187 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
188 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
283 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
284 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
285 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
286 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
287 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 8052494512 Pseudomonas putida LD6 Isolate Unclassified
293 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
294 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
295 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0.23
Isolates 4.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.68
Nodule 0.7
Rhizoplane 8.43
Rhizosphere 74.94
Stem 0
Stem Tuber 0
Unclassified 11.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10036887 3300002067 Bacteria 1434
2 JGI25406J46586_10001220 3300003203 Bacteria 12121
3 Ga0065714_10098476 3300005288 Bacteria 1686
4 Ga0065704_10071508 3300005289 Bacteria 10881
5 Ga0065704_10083468 3300005289 Bacteria 3462
6 Ga0070690_100038651 3300005330 Bacteria 3013
7 Ga0068869_100033225 3300005334 Bacteria 3641
8 Ga0070666_10032482 3300005335 Bacteria 3448
9 Ga0070680_100007639 3300005336 Bacteria 8248
10 Ga0070682_100019430 3300005337 Bacteria 3985
11 Ga0070660_100046247 3300005339 Bacteria 3335
12 Ga0070689_100000008 3300005340 Bacteria 250116
13 Ga0070668_100000503 3300005347 Bacteria 25817
14 Ga0070668_100086332 3300005347 Bacteria 2467
15 Ga0070669_100000428 3300005353 Bacteria 32242
16 Ga0070669_100052971 3300005353 Bacteria 2970
17 Ga0070671_100204620 3300005355 Bacteria 1674
18 Ga0070673_100028346 3300005364 Bacteria 4163
19 Ga0070659_100031194 3300005366 Bacteria 4127
20 Ga0070703_10009290 3300005406 Bacteria 2775
21 Ga0070713_100112420 3300005436 Bacteria 2376
22 Ga0070701_10016293 3300005438 Bacteria 3452
23 Ga0070705_100042178 3300005440 Bacteria 2607
24 Ga0070694_100284629 3300005444 Bacteria 1261
25 Ga0070663_100038946 3300005455 Bacteria 3320
26 Ga0070678_100039960 3300005456 Bacteria 3316
27 Ga0070662_100008729 3300005457 Bacteria 6609
28 Ga0068867_100111724 3300005459 Bacteria 2100
29 Ga0070685_10053506 3300005466 Bacteria 2339
30 Ga0070685_10149324 3300005466 Bacteria 1480
31 Ga0070707_100049847 3300005468 Bacteria 4014
32 Ga0070699_100011319 3300005518 Bacteria 7705
33 Ga0070699_100175664 3300005518 Bacteria 1899
34 Ga0070684_100039755 3300005535 Bacteria 4047
35 Ga0070697_100008850 3300005536 Bacteria 7858
36 Ga0070697_100286325 3300005536 Bacteria 1414
37 Ga0068853_100232297 3300005539 Bacteria 1688
38 Ga0070695_100043945 3300005545 Bacteria 2842
39 Ga0070696_100068471 3300005546 Bacteria 2492
40 Ga0070665_100007113 3300005548 Bacteria 11373
41 Ga0070665_100069799 3300005548 Bacteria 3522
42 Ga0070704_100024002 3300005549 Bacteria 3994
43 Ga0068855_100006231 3300005563 Bacteria 14538
44 Ga0068855_100016391 3300005563 Bacteria 8908
45 Ga0070664_100071310 3300005564 Bacteria 2977
46 Ga0068857_100086714 3300005577 Bacteria 2800
47 Ga0068854_100013940 3300005578 Bacteria 5288
48 Ga0068856_100015443 3300005614 Bacteria 7378
49 Ga0068852_100207476 3300005616 Bacteria 1857
50 Ga0068859_100056176 3300005617 Bacteria 3961
51 Ga0068864_100015102 3300005618 Bacteria 6420
52 Ga0068864_100085079 3300005618 Bacteria 2780
53 Ga0068861_100084770 3300005719 Bacteria 2488
54 Ga0068861_100227926 3300005719 Bacteria 1579
55 Ga0068863_100066967 3300005841 Bacteria 3397
56 Ga0068863_100185781 3300005841 Bacteria 1996
57 Ga0068858_100031027 3300005842 Bacteria 4963
58 Ga0068858_100074947 3300005842 Bacteria 3142
59 Ga0068858_100403190 3300005842 Bacteria 1314
60 Ga0068860_100112172 3300005843 Bacteria 2607
61 Ga0068860_100202138 3300005843 Bacteria 1926
62 Ga0068860_100222991 3300005843 Bacteria 1831
63 Ga0068862_100110508 3300005844 Bacteria 2412
64 Ga0081540_1002506 3300005983 Bacteria 14929
65 Ga0081539_10000683 3300005985 Bacteria 67952
66 Ga0070717_10128313 3300006028 Bacteria 2179
67 Ga0070717_10442364 3300006028 Bacteria 1171
68 Ga0075365_10002032 3300006038 Bacteria 9617
69 Ga0075365_10012877 3300006038 Bacteria 4985
70 Ga0075365_10017443 3300006038 Bacteria 4392
71 Ga0075365_10114566 3300006038 Bacteria 1855
72 Ga0075364_10004236 3300006051 Bacteria 8235
73 Ga0075364_10014519 3300006051 Bacteria 4868
74 Ga0075369_10012928 3300006186 Bacteria 3303
75 Ga0075370_10023402 3300006353 Bacteria 3403
76 Ga0075428_100397480 3300006844 Bacteria 1477
77 Ga0075434_100056591 3300006871 Bacteria 3897
78 Ga0068865_100008092 3300006881 Bacteria 6488
79 Ga0075436_100017743 3300006914 Bacteria 4872
80 Ga0097620_100056177 3300006931 Bacteria 3961
81 Ga0099823_1000013 3300006944 Bacteria 90711
82 Ga0105251_10000214 3300009011 Bacteria 58941
83 Ga0105244_10000396 3300009036 Bacteria 40375
84 Ga0105244_10006533 3300009036 Bacteria 7524
85 Ga0105250_10000130 3300009092 Bacteria 65133
86 Ga0105240_10253138 3300009093 Bacteria 2036
87 Ga0111539_10095823 3300009094 Bacteria 3485
88 Ga0105245_10069131 3300009098 Bacteria 3202
89 Ga0105245_10344647 3300009098 Bacteria 1474
90 Ga0105247_10019242 3300009101 Bacteria 4097
91 Ga0105243_10054210 3300009148 Bacteria 3183
92 Ga0105243_10166415 3300009148 Bacteria 1906
93 Ga0105243_10337142 3300009148 Bacteria 1380
94 Ga0105242_10333416 3300009176 Bacteria 1396
95 Ga0105248_10289084 3300009177 Bacteria 1846
96 Ga0105238_10074199 3300009551 Bacteria 3395
97 Ga0105249_10032779 3300009553 Bacteria 4701
98 Ga0105239_10004841 3300010375 Bacteria 15929
99 Ga0105239_10182226 3300010375 Bacteria 2350
100 Ga0105246_10046670 3300011119 Bacteria 2956
101 Ga0105246_10088489 3300011119 Bacteria 2225
102 Ga0157370_10058145 3300013104 Bacteria 3675
103 Ga0157369_10101850 3300013105 Bacteria 3060
104 Ga0157369_10262003 3300013105 Bacteria 1803
105 Ga0157374_10203040 3300013296 Bacteria 1941
106 Ga0157378_10046411 3300013297 Bacteria 3862
107 Ga0163162_10077323 3300013306 Bacteria 3391
108 Ga0163162_10175309 3300013306 Bacteria 2269
109 Ga0163162_10300640 3300013306 Bacteria 1737
110 Ga0157372_10041079 3300013307 Bacteria 5113
111 Ga0157375_10083536 3300013308 Bacteria 3239
112 Ga0157375_10106877 3300013308 Bacteria 2891
113 Ga0157375_10164798 3300013308 Bacteria 2361
114 Ga0163163_10206077 3300014325 Bacteria 2015
115 Ga0163163_10328136 3300014325 Bacteria 1584
116 Ga0157380_10048313 3300014326 Bacteria 3351
117 Ga0157380_10068862 3300014326 Bacteria 2854
118 Ga0182008_10014844 3300014497 Bacteria 4074
119 Ga0157377_10211961 3300014745 Bacteria 1236
120 Ga0157379_10040507 3300014968 Bacteria 4158
121 Ga0157379_10196296 3300014968 Bacteria 1824
122 Ga0157376_10036691 3300014969 Bacteria 3973
123 Ga0157376_10500048 3300014969 Bacteria 1195
124 Ga0163161_10018522 3300017792 Bacteria 4878
125 Ga0163161_10070325 3300017792 Bacteria 2559
126 Ga0213876_10121710 3300021384 Bacteria 1386
127 Ga0224712_10110962 3300022467 Bacteria 1176
128 Ga0209676_1001072 3300025292 Bacteria 31080
129 Ga0207696_1000016 3300025711 Bacteria 502467
130 Ga0207696_1000255 3300025711 Bacteria 69740
131 Ga0207696_1019102 3300025711 Bacteria 2239
132 Ga0207696_1022247 3300025711 Bacteria 2018
133 Ga0207655_1000051 3300025728 Bacteria 294176
134 Ga0207655_1000497 3300025728 Bacteria 50628
135 Ga0207713_1000049 3300025735 Bacteria 227882
136 Ga0207713_1002994 3300025735 Bacteria 11808
137 Ga0207713_1012882 3300025735 Bacteria 4439
138 Ga0207713_1018765 3300025735 Bacteria 3411
139 Ga0207653_10012706 3300025885 Bacteria 2631
140 Ga0207688_10002030 3300025901 Bacteria 10866
141 Ga0207680_10020588 3300025903 Bacteria 3555
142 Ga0207680_10074358 3300025903 Bacteria 2115
143 Ga0207647_10013647 3300025904 Bacteria 5626
144 Ga0207654_10016558 3300025911 Bacteria 3841
145 Ga0207654_10147288 3300025911 Bacteria 1508
146 Ga0207695_10056417 3300025913 Bacteria 4087
147 Ga0207671_10013156 3300025914 Bacteria 6609
148 Ga0207693_10003655 3300025915 Bacteria 13128
149 Ga0207663_10021285 3300025916 Bacteria 3689
150 Ga0207663_10235462 3300025916 Bacteria 1340
151 Ga0207660_10258755 3300025917 Bacteria 1376
152 Ga0207662_10176040 3300025918 Bacteria 1375
153 Ga0207657_10027863 3300025919 Bacteria 5166
154 Ga0207646_10052353 3300025922 Bacteria 3653
155 Ga0207694_10055632 3300025924 Bacteria 3071
156 Ga0207664_10021959 3300025929 Bacteria 4756
157 Ga0207690_10026226 3300025932 Bacteria 3668
158 Ga0207706_10097652 3300025933 Bacteria 2584
159 Ga0207709_10009332 3300025935 Bacteria 5397
160 Ga0207709_10155847 3300025935 Bacteria 1587
161 Ga0207709_10166014 3300025935 Bacteria 1545
162 Ga0207665_10026047 3300025939 Bacteria 3858
163 Ga0207711_10000130 3300025941 Bacteria 79182
164 Ga0207711_10077123 3300025941 Bacteria 2904
165 Ga0207711_10099036 3300025941 Bacteria 2576
166 Ga0207689_10035993 3300025942 Bacteria 4110
167 Ga0207667_10509249 3300025949 Bacteria 1220
168 Ga0207651_10355408 3300025960 Bacteria 1235
169 Ga0207668_10000386 3300025972 Bacteria 28054
170 Ga0207668_10099060 3300025972 Bacteria 2161
171 Ga0207640_10004543 3300025981 Bacteria 7533
172 Ga0207640_10054407 3300025981 Bacteria 2616
173 Ga0207658_10169791 3300025986 Bacteria 1796
174 Ga0207658_10212226 3300025986 Bacteria 1623
175 Ga0207703_10100730 3300026035 Bacteria 2448
176 Ga0207639_10251664 3300026041 Bacteria 1541
177 Ga0207639_10274326 3300026041 Bacteria 1480
178 Ga0207678_10027343 3300026067 Bacteria 4975
179 Ga0207708_10015907 3300026075 Bacteria 5649
180 Ga0207708_10021613 3300026075 Bacteria 4854
181 Ga0207641_10463466 3300026088 Bacteria 1226
182 Ga0207676_10511300 3300026095 Bacteria 1142
183 Ga0207674_10356207 3300026116 Bacteria 1415
184 Ga0207675_100027657 3300026118 Bacteria 5281
185 Ga0207675_100082837 3300026118 Bacteria 3009
186 Ga0207683_10015933 3300026121 Bacteria 6399
187 Ga0207683_10052291 3300026121 Bacteria 3579
188 Ga0207683_10064245 3300026121 Bacteria 3235
189 Ga0207698_10723123 3300026142 Bacteria 992
190 Ga0209389_1000042 3300027296 Bacteria 123281
191 Ga0207428_10153440 3300027907 Bacteria 1752
192 Ga0268266_10370456 3300028379 Bacteria 1349
193 Ga0268264_10039747 3300028381 Bacteria 3886
194 Ga0268264_10629813 3300028381 Bacteria 1060
195 Ga0307515_10000996 3300028794 Bacteria 64755
196 Ga0307512_10068047 3300030522 Bacteria 2675
197 Ga0265327_10000001 3300031251 Bacteria 894475
198 Ga0307513_10005890 3300031456 Bacteria 16095
199 Ga0307514_10003801 3300031649 Bacteria 14211
200 Ga0307514_10096481 3300031649 Bacteria 2136
201 Ga0307405_10010292 3300031731 Bacteria 4836
202 Ga0307410_10007063 3300031852 Bacteria 6118
203 Ga0307406_10015809 3300031901 Bacteria 4374
204 Ga0307416_100015701 3300032002 Bacteria 5239
205 Ga0307411_10106470 3300032005 Bacteria 1996
206 Ga0307411_10187229 3300032005 Unclassified 1577
207 Ga0307415_100239508 3300032126 Bacteria 1467
208 Ga0373930_0006629 3300034816 Bacteria 1966
209 Ga0373929_0005092 3300035085 Bacteria 2362
210 Ga0373949_0004850 3300035090 Bacteria 3046
211 Ga0373952_0001406 3300035092 Bacteria 4394
212 Ga0373941_0008913 3300035115 Bacteria 2512
213 Ga0373960_0006227 3300035121 Bacteria 2792
214 Ga0373931_0004141 3300035691 Bacteria 6583
215 Ga0373925_0315729 3300037068 Bacteria 1264
216 Ga0395899_0050605 3300037312 Bacteria 3084
217 Ga0395900_0022359 3300037418 Bacteria 6467
218 Ga0395900_0262435 3300037418 Bacteria 1724
219 Ga0395898_0010334 3300037466 Bacteria 9764
220 Ga0395905_0026835 3300037471 Bacteria 5432
221 Ga0395901_0006763 3300038443 Bacteria 11582
222 Ga0436365_1864184 3300039437 Bacteria 4019
223 Ga0436365_1912058 3300039437 Bacteria 2082
224 Ga0436363_1678498 3300039450 Bacteria 7504
225 Ga0439465_0027546 3300041413 Bacteria 1800
226 Ga0439433_0007210 3300041999 Bacteria 2400
227 Ga0439442_000444 3300042002 Bacteria 9383
228 Ga0439432_015405 3300042006 Bacteria 2580
229 Ga0439449_0040262 3300042007 Bacteria 1737
230 Ga0439452_020145 3300042010 Bacteria 1754
231 Ga0439462_0026599 3300042015 Bacteria 1525
232 Ga0450920_000154 3300042122 Bacteria 9482
233 Ga0450902_000037 3300042137 Bacteria 11581
234 Ga0450905_000018 3300042142 Bacteria 15231
235 Ga0450905_001038 3300042142 Bacteria 3481
236 Ga0450907_000082 3300042146 Bacteria 36985
237 Ga0450908_018422 3300042184 Bacteria 1235
238 Ga0439434_0004773 3300042435 Bacteria 3970
239 Ga0439464_0069054 3300042439 Bacteria 1043
240 Ga0450901_000111 3300042533 Bacteria 8881
241 Ga0466963_0050818 3300044694 Bacteria 2745
242 Ga0466970_0031735 3300044765 Bacteria 2790
243 Ga0466967_0017854 3300045976 Bacteria 5651
244 Ga0466967_0093481 3300045976 Bacteria 2736
245 Ga0466967_0246825 3300045976 Archaea 1704
246 Ga0495639_0001753 3300046475 Bacteria 9632
247 Ga0495618_0012556 3300046514 Bacteria 5147
248 Ga0495620_0000059 3300046515 Bacteria 95876
249 Ga0495628_0306482 3300046516 Bacteria 1174
250 Ga0495632_0000579 3300046519 Bacteria 33995
251 Ga0495643_0000087 3300046522 Bacteria 156505
252 Ga0495643_0000406 3300046522 Bacteria 56381
253 Ga0495648_0000734 3300046524 Bacteria 35054
254 Ga0495652_0034778 3300046529 Bacteria 4391
255 Ga0495654_0001224 3300046530 Bacteria 18179
256 Ga0495654_0018032 3300046530 Bacteria 3703
257 Ga0495586_0000835 3300046535 Bacteria 17671
258 Ga0495586_0001701 3300046535 Bacteria 12041
259 Ga0495586_0022137 3300046535 Bacteria 3392
260 Ga0495633_0085513 3300046558 Bacteria 1467
261 Ga0495668_0000128 3300046616 Bacteria 113090
262 Ga0495668_0022491 3300046616 Bacteria 3604
263 Ga0495635_0024153 3300046663 Bacteria 4238
264 Ga0495588_0001697 3300046674 Bacteria 9371
265 Ga0495588_0038134 3300046674 Bacteria 2444
266 Ga0495657_0001403 3300046675 Bacteria 20860
267 Ga0495623_0041557 3300046679 Bacteria 2932
268 Ga0495647_0000016 3300046681 Bacteria 86316
269 Ga0495613_0047383 3300046689 Bacteria 3175
270 Ga0495589_0004002 3300046794 Bacteria 7902
271 Ga0495600_0064571 3300046809 Bacteria 2393
272 Ga0495581_0008501 3300047315 Bacteria 5953
273 Ga0495604_0038757 3300047317 Bacteria 3750
274 Ga0495672_0003853 3300047320 Bacteria 12613
275 Ga0495680_0036564 3300047322 Bacteria 3941
276 Ga0495687_046070 3300047443 Bacteria 1885
277 Ga0495679_010938 3300047446 Bacteria 3532
278 Ga0495673_0000931 3300047469 Bacteria 26530
279 Ga0496100_0020430 3300048903 Bacteria 3970
280 Ga0496100_0497761 3300048903 Bacteria 939
281 Ga0496101_0000049 3300048904 Bacteria 146432
282 Ga0496101_0048753 3300048904 Bacteria 3045
283 Ga0496101_0270239 3300048904 Bacteria 1327
284 Ga0496102_0000011 3300048905 Bacteria 321716
285 Ga0496102_0007065 3300048905 Bacteria 9582
286 Ga0496102_0062278 3300048905 Bacteria 3416
287 Ga0496102_0092555 3300048905 Bacteria 2800
288 Ga0496102_0128023 3300048905 Bacteria 2375
289 Ga0496102_0279205 3300048905 Bacteria 1575
290 Ga0496103_0000032 3300048906 Bacteria 201453
291 Ga0496103_0094085 3300048906 Bacteria 1893
292 Ga0496104_0045541 3300048907 Bacteria 4126
293 Ga0496104_0112409 3300048907 Bacteria 2612
294 Ga0496104_0392534 3300048907 Bacteria 1300
295 Ga0496105_0046715 3300048908 Bacteria 3573
296 Ga0496106_0003548 3300048909 Bacteria 11615
297 Ga0496106_0058656 3300048909 Bacteria 2914
298 Ga0496107_0214249 3300048910 Bacteria 1432
299 Ga0496108_0049877 3300048911 Bacteria 3501
300 Ga0496108_0069625 3300048911 Bacteria 2969
301 Ga0496108_0138643 3300048911 Bacteria 2095
302 Ga0496108_0261715 3300048911 Bacteria 1505
303 Ga0496109_0035891 3300048912 Bacteria 4475
304 Ga0496109_0046269 3300048912 Bacteria 3952
305 Ga0496110_0028234 3300048913 Bacteria 4816
306 Ga0496110_0169197 3300048913 Bacteria 1982
307 Ga0496111_0087117 3300048914 Bacteria 2285
308 Ga0496111_0172528 3300048914 Bacteria 1607
309 Ga0496112_0068386 3300048915 Bacteria 3507
310 Ga0496113_0009722 3300048916 Bacteria 6319
311 Ga0496114_0003887 3300048917 Bacteria 11517
312 Ga0496114_0068490 3300048917 Bacteria 2979
313 Ga0496114_0098050 3300048917 Bacteria 2498
314 Ga0496114_0560801 3300048917 Bacteria 1009
315 Ga0496116_0000072 3300048919 Bacteria 238158
316 Ga0496116_0034261 3300048919 Bacteria 3586
317 Ga0496117_0000039 3300048920 Bacteria 322143
318 Ga0496117_0000989 3300048920 Bacteria 43520
319 Ga0496117_0039279 3300048920 Bacteria 3495
320 Ga0496117_0077888 3300048920 Bacteria 2191
321 Ga0496117_0115087 3300048920 Bacteria 1665
322 Ga0496118_0000035 3300048921 Bacteria 322143
323 Ga0496118_0003946 3300048921 Bacteria 18139
324 Ga0496118_0008933 3300048921 Bacteria 10231
325 Ga0496118_0022151 3300048921 Bacteria 5567
326 Ga0496119_0000326 3300048922 Bacteria 66943
327 Ga0496120_0000190 3300048923 Bacteria 105211
328 Ga0496121_0000351 3300048924 Bacteria 95963
329 Ga0496122_0001675 3300048925 Bacteria 34384
330 Ga0496122_0062879 3300048925 Bacteria 2714
331 Ga0496123_0003987 3300048926 Bacteria 15989
332 Ga0496123_0286340 3300048926 Bacteria 793
333 Ga0496124_0002380 3300048927 Bacteria 24767
334 Ga0496124_0007199 3300048927 Bacteria 11891
335 Ga0496124_0286263 3300048927 Bacteria 1198
336 Ga0496125_0000317 3300048928 Bacteria 94000
337 Ga0496125_0011296 3300048928 Bacteria 8950
338 Ga0496125_0022782 3300048928 Bacteria 5806
339 Ga0496125_0029260 3300048928 Bacteria 4954
340 Ga0496126_0004142 3300048929 Bacteria 17532
341 Ga0496126_0031655 3300048929 Bacteria 4992
342 Ga0496126_0044826 3300048929 Bacteria 4070
343 Ga0496126_0105303 3300048929 Bacteria 2463
344 Ga0496126_0335096 3300048929 Bacteria 1241
345 Ga0495682_0000118 3300049460 Bacteria 69167
346 Ga0501031_0124467 3300049568 Archaea 1684
347 Ga0501031_0215517 3300049568 Bacteria 1251
348 Ga0501031_0348528 3300049568 Archaea 958
349 Ga0501032_0003713 3300049569 Archaea 11590
350 Ga0501032_0004689 3300049569 Bacteria 10261
351 Ga0501032_0022787 3300049569 Bacteria 4338
352 Ga0501034_0000158 3300049571 Bacteria 128537
353 Ga0501034_0008271 3300049571 Bacteria 11008
354 Ga0501034_0013927 3300049571 Archaea 8279
355 Ga0501036_0063582 3300049572 Bacteria 3124
356 Ga0501036_0087608 3300049572 Archaea 2631
357 Ga0501037_0001235 3300049573 Bacteria 18849
358 Ga0501037_0002199 3300049573 Archaea 14093
359 Ga0501038_0008929 3300049574 Archaea 9195
360 Ga0501038_0012973 3300049574 Bacteria 7602
361 Ga0501038_0014358 3300049574 Bacteria 7217
362 Ga0501038_0337227 3300049574 Archaea 1176
363 Ga0501039_0006138 3300049575 Archaea 9121
364 Ga0501039_0007724 3300049575 Bacteria 8206
365 Ga0501040_0000359 3300049576 Archaea 26867
366 Ga0501041_0000173 3300049577 Archaea 28933
367 Ga0501042_0011388 3300049578 Archaea 6002
368 Ga0501042_0041402 3300049578 Archaea 3276
369 Ga0501043_0006614 3300049579 Archaea 9275
370 Ga0501043_0008003 3300049579 Bacteria 8343
371 Ga0501046_0001614 3300049580 Archaea 21573
372 Ga0501046_0016562 3300049580 Bacteria 6167
373 Ga0501047_0147394 3300049581 Bacteria 2230
374 Ga0501047_0224403 3300049581 Archaea 1734
375 Ga0501048_0000342 3300049582 Archaea 32108
376 Ga0501068_0083595 3300049584 Archaea 1962
377 Ga0501069_0060207 3300049585 Bacteria 2120
378 Ga0501070_0006036 3300049586 Bacteria 10317
379 Ga0501071_0000071 3300049587 Archaea 36416
380 Ga0501071_0382839 3300049587 Archaea 1073
381 Ga0501075_0011222 3300049591 Archaea 6336
382 Ga0501076_0002650 3300049592 Archaea 12353
383 Ga0501225_0059447 3300049705 Archaea 1074
384 Ga0501079_0000172 3300049741 Archaea 36362
385 Ga0501080_0000353 3300049742 Archaea 35311
386 Ga0501081_0107926 3300049743 Archaea 1974
387 Ga0501083_0106381 3300049744 Archaea 1847
388 Ga0501035_0059872 3300049822 Archaea 3391
389 Ga0501044_0002704 3300049823 Archaea 20153
390 Ga0501044_0892804 3300049823 Bacteria 764
391 Ga0501045_0000521 3300049824 Archaea 23925
392 nmdc:mga00v17_52646_c1 3300050491 Bacteria 2478
393 nmdc:mga00v17_9315_c1 3300050491 Bacteria 5311
394 nmdc:mga0yw44_1733_c1 3300050492 Bacteria 8864
395 nmdc:mga0yw44_5234_c1 3300050492 Bacteria 6084
396 nmdc:mga0qj67_318851_c1 3300050509 Bacteria 1258
397 nmdc:mga08y16_79360_c1 3300050511 Bacteria 3421
398 nmdc:mga0a205_22329_c1 3300050515 Bacteria 5992
399 Ga0500643_000325 3300053087 Bacteria 38363
400 Ga0500556_0000145 3300053104 Bacteria 59342
401 Ga0500562_001075 3300053108 Bacteria 6720
402 Ga0500593_004917 3300053117 Bacteria 5218
403 Ga0500655_001109 3300053133 Bacteria 5151
404 Ga0500659_0000299 3300053135 Bacteria 31126
405 Ga0500573_0010836 3300053140 Bacteria 5092
406 Ga0501084_0001147 3300054114 Archaea 20645
407 Ga0501082_0313811 3300060353 Archaea 1365
408 Ga0466962_0014141 3300061719 Bacteria 3845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0892804 Ga0501044_0892804_23_724 230
2 3300048926 Ga0496123_0286340 Ga0496123_0286340_44_760 231
3 3300031731 Ga0307405_10010292 Ga0307405_100102923 261
4 3300031901 Ga0307406_10015809 Ga0307406_100158094 261
5 3300032002 Ga0307416_100015701 Ga0307416_1000157016 261
6 3300032005 Ga0307411_10187229 Ga0307411_101872292 261
7 3300046681 Ga0495647_0000016 Ga0495647_0000016_15958_16767 263
8 iso_pu_bacteria 2765235841 2765584538 263
9 iso_pu_bacteria 3007803356 3007806949 263
10 iso_pu_bacteria 8052494512 8052497916 263
11 iso_pu_bacteria 8054929484 8054931274 263
12 iso_pu_bacteria 8056137416 8056139879 263
13 3300025711 Ga0207696_1000255 Ga0207696_100025533 266
14 3300025735 Ga0207713_1000049 Ga0207713_100004971 266
15 3300045976 Ga0466967_0246825 Ga0466967_0246825_325_1146 266
16 3300046530 Ga0495654_0001224 Ga0495654_0001224_14992_15822 266
17 3300049568 Ga0501031_0124467 Ga0501031_0124467_269_1084 266
18 3300049568 Ga0501031_0348528 Ga0501031_0348528_32_847 266
19 3300049569 Ga0501032_0003713 Ga0501032_0003713_6373_7188 266
20 3300049571 Ga0501034_0013927 Ga0501034_0013927_3504_4319 266
21 3300049572 Ga0501036_0087608 Ga0501036_0087608_365_1180 266
22 3300049573 Ga0501037_0002199 Ga0501037_0002199_6488_7303 266
23 3300049574 Ga0501038_0008929 Ga0501038_0008929_4292_5107 266
24 3300049574 Ga0501038_0337227 Ga0501038_0337227_283_1098 266
25 3300049575 Ga0501039_0006138 Ga0501039_0006138_1861_2676 266
26 3300049576 Ga0501040_0000359 Ga0501040_0000359_21862_22677 266
27 3300049577 Ga0501041_0000173 Ga0501041_0000173_756_1571 266
28 3300049578 Ga0501042_0011388 Ga0501042_0011388_2152_2967 266
29 3300049578 Ga0501042_0041402 Ga0501042_0041402_89_904 266
30 3300049579 Ga0501043_0006614 Ga0501043_0006614_6418_7233 266
31 3300049580 Ga0501046_0001614 Ga0501046_0001614_2498_3313 266
32 3300049581 Ga0501047_0224403 Ga0501047_0224403_159_974 266
33 3300049582 Ga0501048_0000342 Ga0501048_0000342_27365_28180 266
34 3300049584 Ga0501068_0083595 Ga0501068_0083595_115_930 266
35 3300049587 Ga0501071_0000071 Ga0501071_0000071_1943_2758 266
36 3300049587 Ga0501071_0382839 Ga0501071_0382839_68_883 266
37 3300049591 Ga0501075_0011222 Ga0501075_0011222_1561_2376 266
38 3300049592 Ga0501076_0002650 Ga0501076_0002650_10660_11475 266
39 3300049705 Ga0501225_0059447 Ga0501225_0059447_136_951 266
40 3300049741 Ga0501079_0000172 Ga0501079_0000172_1934_2749 266
41 3300049742 Ga0501080_0000353 Ga0501080_0000353_33657_34472 266
42 3300049743 Ga0501081_0107926 Ga0501081_0107926_119_934 266
43 3300049744 Ga0501083_0106381 Ga0501083_0106381_931_1746 266
44 3300049822 Ga0501035_0059872 Ga0501035_0059872_945_1760 266
45 3300049823 Ga0501044_0002704 Ga0501044_0002704_1230_2045 266
46 3300049824 Ga0501045_0000521 Ga0501045_0000521_18275_19090 266
47 3300054114 Ga0501084_0001147 Ga0501084_0001147_19669_20484 266
48 3300060353 Ga0501082_0313811 Ga0501082_0313811_511_1326 266
49 3300005289 Ga0065704_10071508 Ga0065704_100715088 267
50 3300005289 Ga0065704_10083468 Ga0065704_100834681 267
51 3300006944 Ga0099823_1000013 Ga0099823_100001327 267
52 3300009011 Ga0105251_10000214 Ga0105251_1000021416 267
53 3300009036 Ga0105244_10000396 Ga0105244_1000039638 267
54 3300009036 Ga0105244_10006533 Ga0105244_100065334 267
55 3300009092 Ga0105250_10000130 Ga0105250_1000013026 267
56 3300009148 Ga0105243_10054210 Ga0105243_100542103 267
57 3300009148 Ga0105243_10166415 Ga0105243_101664152 267
58 3300025292 Ga0209676_1001072 Ga0209676_100107223 267
59 3300025711 Ga0207696_1000016 Ga0207696_100001619 267
60 3300025711 Ga0207696_1019102 Ga0207696_10191023 267
61 3300025711 Ga0207696_1022247 Ga0207696_10222471 267
62 3300025728 Ga0207655_1000051 Ga0207655_100005158 267
63 3300025728 Ga0207655_1000497 Ga0207655_100049712 267
64 3300025735 Ga0207713_1002994 Ga0207713_10029949 267
65 3300025735 Ga0207713_1012882 Ga0207713_10128824 267
66 3300025735 Ga0207713_1018765 Ga0207713_10187652 267
67 3300025935 Ga0207709_10155847 Ga0207709_101558471 267
68 3300025935 Ga0207709_10166014 Ga0207709_101660142 267
69 3300027296 Ga0209389_1000042 Ga0209389_100004258 267
70 3300042137 Ga0450902_000037 Ga0450902_000037_2075_2899 267
71 3300042142 Ga0450905_000018 Ga0450905_000018_2769_3593 267
72 3300042142 Ga0450905_001038 Ga0450905_001038_2606_3430 267
73 3300042533 Ga0450901_000111 Ga0450901_000111_2897_3721 267
74 3300046515 Ga0495620_0000059 Ga0495620_0000059_43704_44528 267
75 3300046519 Ga0495632_0000579 Ga0495632_0000579_12036_12860 267
76 3300046522 Ga0495643_0000406 Ga0495643_0000406_33560_34384 267
77 3300046524 Ga0495648_0000734 Ga0495648_0000734_12932_13756 267
78 3300048913 Ga0496110_0169197 Ga0496110_0169197_93_917 267
79 3300048919 Ga0496116_0034261 Ga0496116_0034261_1582_2406 267
80 3300048920 Ga0496117_0000989 Ga0496117_0000989_40217_41041 267
81 3300048920 Ga0496117_0039279 Ga0496117_0039279_73_897 267
82 3300048921 Ga0496118_0022151 Ga0496118_0022151_2144_2968 267
83 3300048925 Ga0496122_0062879 Ga0496122_0062879_1598_2422 267
84 3300048927 Ga0496124_0002380 Ga0496124_0002380_8813_9637 267
85 3300048927 Ga0496124_0286263 Ga0496124_0286263_350_1174 267
86 3300048928 Ga0496125_0000317 Ga0496125_0000317_78668_79492 267
87 3300048928 Ga0496125_0022782 Ga0496125_0022782_4903_5727 267
88 3300048929 Ga0496126_0031655 Ga0496126_0031655_535_1359 267
89 3300048929 Ga0496126_0105303 Ga0496126_0105303_937_1761 267
90 3300042006 Ga0439432_015405 Ga0439432_015405_561_1448 268
91 3300042439 Ga0439464_0069054 Ga0439464_0069054_28_915 268
92 3300046522 Ga0495643_0000087 Ga0495643_0000087_150928_151818 268
93 3300048917 Ga0496114_0003887 Ga0496114_0003887_5902_6792 268
94 3300048920 Ga0496117_0115087 Ga0496117_0115087_679_1569 268
95 3300048921 Ga0496118_0003946 Ga0496118_0003946_11199_12089 268
96 3300048925 Ga0496122_0001675 Ga0496122_0001675_2706_3596 268
97 3300048926 Ga0496123_0003987 Ga0496123_0003987_3391_4281 268
98 3300048927 Ga0496124_0007199 Ga0496124_0007199_6082_6972 268
99 3300048928 Ga0496125_0029260 Ga0496125_0029260_3534_4424 268
100 3300049571 Ga0501034_0000158 Ga0501034_0000158_13333_14220 268
101 3300053135 Ga0500659_0000299 Ga0500659_0000299_12553_13440 268
102 3300028794 Ga0307515_10000996 Ga0307515_1000099624 269
103 3300030522 Ga0307512_10068047 Ga0307512_100680472 269
104 3300031456 Ga0307513_10005890 Ga0307513_100058905 269
105 3300031649 Ga0307514_10003801 Ga0307514_100038017 269
106 3300049460 Ga0495682_0000118 Ga0495682_0000118_35458_36288 269
107 3300005340 Ga0070689_100000008 Ga0070689_100000008191 270
108 3300005468 Ga0070707_100049847 Ga0070707_1000498474 270
109 3300005518 Ga0070699_100011319 Ga0070699_1000113192 270
110 3300005518 Ga0070699_100175664 Ga0070699_1001756642 270
111 3300005536 Ga0070697_100008850 Ga0070697_1000088502 270
112 3300005536 Ga0070697_100286325 Ga0070697_1002863253 270
113 3300006844 Ga0075428_100397480 Ga0075428_1003974802 270
114 3300009094 Ga0111539_10095823 Ga0111539_100958233 270
115 3300025922 Ga0207646_10052353 Ga0207646_100523532 270
116 3300025986 Ga0207658_10169791 Ga0207658_101697912 270
117 3300027907 Ga0207428_10153440 Ga0207428_101534402 270
118 3300037068 Ga0373925_0315729 Ga0373925_0315729_265_1092 270
119 3300050509 nmdc:mga0qj67_318851_c1 nmdc:mga0qj67_318851_c1_424_1245 270
120 3300050511 nmdc:mga08y16_79360_c1 nmdc:mga08y16_79360_c1_274_1095 270
121 3300031649 Ga0307514_10096481 Ga0307514_100964812 272
122 3300005336 Ga0070680_100007639 Ga0070680_1000076395 273
123 3300047446 Ga0495679_010938 Ga0495679_010938_1232_2059 273
124 3300014497 Ga0182008_10014844 Ga0182008_100148444 275
125 iso_pu_bacteria 2939582691 2939588012 275
126 3300046535 Ga0495586_0001701 Ga0495586_0001701_7633_8562 276
127 3300048905 Ga0496102_0279205 Ga0496102_0279205_207_1058 276
128 3300048907 Ga0496104_0392534 Ga0496104_0392534_278_1129 276
129 3300005347 Ga0070668_100000503 Ga0070668_10000050319 277
130 3300005353 Ga0070669_100000428 Ga0070669_10000042819 277
131 3300005535 Ga0070684_100039755 Ga0070684_1000397555 277
132 3300005539 Ga0068853_100232297 Ga0068853_1002322972 277
133 3300005719 Ga0068861_100227926 Ga0068861_1002279262 277
134 3300006028 Ga0070717_10128313 Ga0070717_101283131 277
135 3300006353 Ga0075370_10023402 Ga0075370_100234023 277
136 3300010375 Ga0105239_10004841 Ga0105239_1000484110 277
137 3300013306 Ga0163162_10175309 Ga0163162_101753093 277
138 3300017792 Ga0163161_10070325 Ga0163161_100703253 277
139 3300022467 Ga0224712_10110962 Ga0224712_101109622 277
140 3300025914 Ga0207671_10013156 Ga0207671_100131564 277
141 3300025929 Ga0207664_10021959 Ga0207664_100219592 277
142 3300025972 Ga0207668_10000386 Ga0207668_1000038624 277
143 3300026041 Ga0207639_10251664 Ga0207639_102516642 277
144 3300026118 Ga0207675_100027657 Ga0207675_1000276576 277
145 3300041413 Ga0439465_0027546 Ga0439465_0027546_153_1028 277
146 3300044694 Ga0466963_0050818 Ga0466963_0050818_1807_2655 277
147 3300046530 Ga0495654_0018032 Ga0495654_0018032_2778_3626 277
148 3300046616 Ga0495668_0022491 Ga0495668_0022491_2558_3406 277
149 3300047320 Ga0495672_0003853 Ga0495672_0003853_7768_8616 277
150 3300047469 Ga0495673_0000931 Ga0495673_0000931_6897_7745 277
151 3300048904 Ga0496101_0000049 Ga0496101_0000049_68251_69099 277
152 3300048905 Ga0496102_0000011 Ga0496102_0000011_181588_182436 277
153 3300048906 Ga0496103_0000032 Ga0496103_0000032_61297_62145 277
154 3300048909 Ga0496106_0003548 Ga0496106_0003548_3692_4540 277
155 3300048919 Ga0496116_0000072 Ga0496116_0000072_98002_98850 277
156 3300048920 Ga0496117_0000039 Ga0496117_0000039_139309_140157 277
157 3300048921 Ga0496118_0000035 Ga0496118_0000035_181987_182835 277
158 3300048922 Ga0496119_0000326 Ga0496119_0000326_5978_6826 277
159 3300048923 Ga0496120_0000190 Ga0496120_0000190_75208_76056 277
160 3300048924 Ga0496121_0000351 Ga0496121_0000351_33275_34123 277
161 3300048929 Ga0496126_0004142 Ga0496126_0004142_12943_13791 277
162 3300049569 Ga0501032_0004689 Ga0501032_0004689_5621_6490 277
163 3300049571 Ga0501034_0008271 Ga0501034_0008271_6723_7592 277
164 3300049572 Ga0501036_0063582 Ga0501036_0063582_2080_2949 277
165 3300049573 Ga0501037_0001235 Ga0501037_0001235_14237_15106 277
166 3300049574 Ga0501038_0014358 Ga0501038_0014358_2577_3446 277
167 3300049575 Ga0501039_0007724 Ga0501039_0007724_3745_4614 277
168 3300049579 Ga0501043_0008003 Ga0501043_0008003_3754_4623 277
169 3300049586 Ga0501070_0006036 Ga0501070_0006036_6561_7430 277
170 3300061719 Ga0466962_0014141 Ga0466962_0014141_1264_2112 277
171 3300032126 Ga0307415_100239508 Ga0307415_1002395082 278
172 3300048903 Ga0496100_0497761 Ga0496100_0497761_49_903 283
173 3300048911 Ga0496108_0261715 Ga0496108_0261715_29_880 283
174 iso_pu_bacteria 2751185782 2753266194 285
175 3300046516 Ga0495628_0306482 Ga0495628_0306482_298_1161 286
176 3300047443 Ga0495687_046070 Ga0495687_046070_610_1473 286
177 3300046514 Ga0495618_0012556 Ga0495618_0012556_2970_3851 287
178 3300046529 Ga0495652_0034778 Ga0495652_0034778_3470_4351 287
179 3300046663 Ga0495635_0024153 Ga0495635_0024153_884_1765 287
180 3300046675 Ga0495657_0001403 Ga0495657_0001403_7183_8064 287
181 3300046679 Ga0495623_0041557 Ga0495623_0041557_1682_2563 287
182 3300046689 Ga0495613_0047383 Ga0495613_0047383_852_1733 287
183 3300046794 Ga0495589_0004002 Ga0495589_0004002_815_1696 287
184 3300046809 Ga0495600_0064571 Ga0495600_0064571_592_1473 287
185 3300047317 Ga0495604_0038757 Ga0495604_0038757_1104_1985 287
186 3300047322 Ga0495680_0036564 Ga0495680_0036564_208_1089 287
187 iso_pu_bacteria 2643221690 2644505941 289
188 3300049581 Ga0501047_0147394 Ga0501047_0147394_901_1773 290
189 iso_pu_bacteria 2523231044 2523386510 290
190 iso_pu_bacteria 2565956761 2566991987 290
191 iso_pu_bacteria 2904535858 2904538614 290
192 iso_pu_bacteria 2922554459 2922559344 290
193 3300009176 Ga0105242_10333416 Ga0105242_103334162 291
194 3300037312 Ga0395899_0050605 Ga0395899_0050605_2040_2918 291
195 3300037418 Ga0395900_0022359 Ga0395900_0022359_3732_4610 291
196 3300037466 Ga0395898_0010334 Ga0395898_0010334_6612_7490 291
197 3300037471 Ga0395905_0026835 Ga0395905_0026835_1858_2736 291
198 3300038443 Ga0395901_0006763 Ga0395901_0006763_8847_9725 291
199 3300053140 Ga0500573_0010836 Ga0500573_0010836_2665_3540 291
200 iso_pu_bacteria 2687453743 2689992684 291
201 iso_pu_bacteria 2919391150 2919394379 291
202 3300021384 Ga0213876_10121710 Ga0213876_101217102 292
203 3300031852 Ga0307410_10007063 Ga0307410_100070635 292
204 3300032005 Ga0307411_10106470 Ga0307411_101064703 292
205 3300039437 Ga0436365_1912058 Ga0436365_1912058_894_1787 292
206 3300039450 Ga0436363_1678498 Ga0436363_1678498_3627_4520 292
207 3300048929 Ga0496126_0044826 Ga0496126_0044826_547_1443 292
208 iso_pu_bacteria 2844852863 2844853483 292
209 iso_pu_bacteria 2852643534 2852644469 292
210 iso_pu_bacteria 8056037122 8056038786 292
211 3300005335 Ga0070666_10032482 Ga0070666_100324824 293
212 3300006038 Ga0075365_10012877 Ga0075365_100128772 293
213 3300006038 Ga0075365_10114566 Ga0075365_101145662 293
214 3300025903 Ga0207680_10020588 Ga0207680_100205882 293
215 3300031251 Ga0265327_10000001 Ga0265327_10000001435 293
216 3300046535 Ga0495586_0022137 Ga0495586_0022137_1147_2028 293
217 3300046558 Ga0495633_0085513 Ga0495633_0085513_52_933 293
218 3300046616 Ga0495668_0000128 Ga0495668_0000128_93453_94361 293
219 3300046674 Ga0495588_0038134 Ga0495588_0038134_1373_2254 293
220 3300048906 Ga0496103_0094085 Ga0496103_0094085_154_1038 293
221 3300048911 Ga0496108_0138643 Ga0496108_0138643_785_1669 293
222 3300048917 Ga0496114_0098050 Ga0496114_0098050_648_1532 293
223 3300048928 Ga0496125_0011296 Ga0496125_0011296_7711_8595 293
224 3300048929 Ga0496126_0335096 Ga0496126_0335096_233_1117 293
225 iso_pu_bacteria 2738543031 2739351199 293
226 iso_pu_bacteria 2857733635 2857734655 293
227 3300005548 Ga0070665_100007113 Ga0070665_1000071134 294
228 3300005548 Ga0070665_100069799 Ga0070665_1000697993 294
229 3300005563 Ga0068855_100006231 Ga0068855_1000062318 294
230 3300005578 Ga0068854_100013940 Ga0068854_1000139403 294
231 3300005842 Ga0068858_100031027 Ga0068858_1000310271 294
232 3300009093 Ga0105240_10253138 Ga0105240_102531382 294
233 3300013297 Ga0157378_10046411 Ga0157378_100464113 294
234 3300013307 Ga0157372_10041079 Ga0157372_100410795 294
235 3300025904 Ga0207647_10013647 Ga0207647_100136475 294
236 3300025911 Ga0207654_10147288 Ga0207654_101472882 294
237 3300025913 Ga0207695_10056417 Ga0207695_100564174 294
238 3300025924 Ga0207694_10055632 Ga0207694_100556322 294
239 3300025949 Ga0207667_10509249 Ga0207667_105092491 294
240 3300025981 Ga0207640_10004543 Ga0207640_100045438 294
241 3300025986 Ga0207658_10212226 Ga0207658_102122262 294
242 3300026041 Ga0207639_10274326 Ga0207639_102743262 294
243 3300026142 Ga0207698_10723123 Ga0207698_107231231 294
244 3300028381 Ga0268264_10039747 Ga0268264_100397472 294
245 3300042122 Ga0450920_000154 Ga0450920_000154_762_1649 294
246 3300042184 Ga0450908_018422 Ga0450908_018422_277_1164 294
247 3300044765 Ga0466970_0031735 Ga0466970_0031735_735_1619 294
248 3300002067 JGI24735J21928_10036887 JGI24735J21928_100368872 295
249 3300003203 JGI25406J46586_10001220 JGI25406J46586_100012207 295
250 3300005288 Ga0065714_10098476 Ga0065714_100984762 295
251 3300005330 Ga0070690_100038651 Ga0070690_1000386511 295
252 3300005334 Ga0068869_100033225 Ga0068869_1000332253 295
253 3300005337 Ga0070682_100019430 Ga0070682_1000194302 295
254 3300005339 Ga0070660_100046247 Ga0070660_1000462472 295
255 3300005347 Ga0070668_100086332 Ga0070668_1000863322 295
256 3300005353 Ga0070669_100052971 Ga0070669_1000529712 295
257 3300005355 Ga0070671_100204620 Ga0070671_1002046201 295
258 3300005364 Ga0070673_100028346 Ga0070673_1000283462 295
259 3300005366 Ga0070659_100031194 Ga0070659_1000311942 295
260 3300005406 Ga0070703_10009290 Ga0070703_100092902 295
261 3300005436 Ga0070713_100112420 Ga0070713_1001124202 295
262 3300005438 Ga0070701_10016293 Ga0070701_100162932 295
263 3300005440 Ga0070705_100042178 Ga0070705_1000421782 295
264 3300005444 Ga0070694_100284629 Ga0070694_1002846291 295
265 3300005455 Ga0070663_100038946 Ga0070663_1000389461 295
266 3300005456 Ga0070678_100039960 Ga0070678_1000399601 295
267 3300005457 Ga0070662_100008729 Ga0070662_1000087293 295
268 3300005459 Ga0068867_100111724 Ga0068867_1001117242 295
269 3300005466 Ga0070685_10053506 Ga0070685_100535062 295
270 3300005466 Ga0070685_10149324 Ga0070685_101493241 295
271 3300005545 Ga0070695_100043945 Ga0070695_1000439452 295
272 3300005546 Ga0070696_100068471 Ga0070696_1000684712 295
273 3300005549 Ga0070704_100024002 Ga0070704_1000240022 295
274 3300005563 Ga0068855_100016391 Ga0068855_1000163912 295
275 3300005564 Ga0070664_100071310 Ga0070664_1000713102 295
276 3300005577 Ga0068857_100086714 Ga0068857_1000867142 295
277 3300005614 Ga0068856_100015443 Ga0068856_1000154436 295
278 3300005616 Ga0068852_100207476 Ga0068852_1002074762 295
279 3300005617 Ga0068859_100056176 Ga0068859_1000561762 295
280 3300005618 Ga0068864_100015102 Ga0068864_1000151022 295
281 3300005618 Ga0068864_100085079 Ga0068864_1000850792 295
282 3300005719 Ga0068861_100084770 Ga0068861_1000847702 295
283 3300005841 Ga0068863_100066967 Ga0068863_1000669672 295
284 3300005841 Ga0068863_100185781 Ga0068863_1001857812 295
285 3300005842 Ga0068858_100074947 Ga0068858_1000749472 295
286 3300005842 Ga0068858_100403190 Ga0068858_1004031902 295
287 3300005843 Ga0068860_100112172 Ga0068860_1001121721 295
288 3300005843 Ga0068860_100202138 Ga0068860_1002021382 295
289 3300005843 Ga0068860_100222991 Ga0068860_1002229911 295
290 3300005844 Ga0068862_100110508 Ga0068862_1001105082 295
291 3300005983 Ga0081540_1002506 Ga0081540_100250611 295
292 3300005985 Ga0081539_10000683 Ga0081539_1000068343 295
293 3300006028 Ga0070717_10442364 Ga0070717_104423642 295
294 3300006038 Ga0075365_10002032 Ga0075365_100020324 295
295 3300006038 Ga0075365_10017443 Ga0075365_100174434 295
296 3300006051 Ga0075364_10004236 Ga0075364_100042366 295
297 3300006051 Ga0075364_10014519 Ga0075364_100145192 295
298 3300006186 Ga0075369_10012928 Ga0075369_100129282 295
299 3300006871 Ga0075434_100056591 Ga0075434_1000565911 295
300 3300006881 Ga0068865_100008092 Ga0068865_1000080926 295
301 3300006914 Ga0075436_100017743 Ga0075436_1000177432 295
302 3300006931 Ga0097620_100056177 Ga0097620_1000561772 295
303 3300009098 Ga0105245_10069131 Ga0105245_100691314 295
304 3300009098 Ga0105245_10344647 Ga0105245_103446471 295
305 3300009101 Ga0105247_10019242 Ga0105247_100192422 295
306 3300009148 Ga0105243_10337142 Ga0105243_103371422 295
307 3300009177 Ga0105248_10289084 Ga0105248_102890842 295
308 3300009551 Ga0105238_10074199 Ga0105238_100741992 295
309 3300009553 Ga0105249_10032779 Ga0105249_100327792 295
310 3300010375 Ga0105239_10182226 Ga0105239_101822262 295
311 3300011119 Ga0105246_10046670 Ga0105246_100466701 295
312 3300011119 Ga0105246_10088489 Ga0105246_100884892 295
313 3300013104 Ga0157370_10058145 Ga0157370_100581451 295
314 3300013105 Ga0157369_10101850 Ga0157369_101018502 295
315 3300013105 Ga0157369_10262003 Ga0157369_102620032 295
316 3300013296 Ga0157374_10203040 Ga0157374_102030401 295
317 3300013306 Ga0163162_10077323 Ga0163162_100773231 295
318 3300013306 Ga0163162_10300640 Ga0163162_103006402 295
319 3300013308 Ga0157375_10083536 Ga0157375_100835361 295
320 3300013308 Ga0157375_10106877 Ga0157375_101068772 295
321 3300013308 Ga0157375_10164798 Ga0157375_101647982 295
322 3300014325 Ga0163163_10206077 Ga0163163_102060771 295
323 3300014325 Ga0163163_10328136 Ga0163163_103281361 295
324 3300014326 Ga0157380_10048313 Ga0157380_100483131 295
325 3300014326 Ga0157380_10068862 Ga0157380_100688623 295
326 3300014745 Ga0157377_10211961 Ga0157377_102119611 295
327 3300014968 Ga0157379_10040507 Ga0157379_100405073 295
328 3300014968 Ga0157379_10196296 Ga0157379_101962961 295
329 3300014969 Ga0157376_10036691 Ga0157376_100366913 295
330 3300014969 Ga0157376_10500048 Ga0157376_105000481 295
331 3300017792 Ga0163161_10018522 Ga0163161_100185223 295
332 3300025885 Ga0207653_10012706 Ga0207653_100127061 295
333 3300025901 Ga0207688_10002030 Ga0207688_100020302 295
334 3300025903 Ga0207680_10074358 Ga0207680_100743581 295
335 3300025911 Ga0207654_10016558 Ga0207654_100165582 295
336 3300025915 Ga0207693_10003655 Ga0207693_1000365512 295
337 3300025916 Ga0207663_10021285 Ga0207663_100212852 295
338 3300025916 Ga0207663_10235462 Ga0207663_102354622 295
339 3300025917 Ga0207660_10258755 Ga0207660_102587551 295
340 3300025918 Ga0207662_10176040 Ga0207662_101760402 295
341 3300025919 Ga0207657_10027863 Ga0207657_100278633 295
342 3300025932 Ga0207690_10026226 Ga0207690_100262263 295
343 3300025933 Ga0207706_10097652 Ga0207706_100976522 295
344 3300025935 Ga0207709_10009332 Ga0207709_100093322 295
345 3300025939 Ga0207665_10026047 Ga0207665_100260472 295
346 3300025941 Ga0207711_10000130 Ga0207711_1000013068 295
347 3300025941 Ga0207711_10077123 Ga0207711_100771232 295
348 3300025941 Ga0207711_10099036 Ga0207711_100990362 295
349 3300025942 Ga0207689_10035993 Ga0207689_100359932 295
350 3300025960 Ga0207651_10355408 Ga0207651_103554081 295
351 3300025972 Ga0207668_10099060 Ga0207668_100990602 295
352 3300025981 Ga0207640_10054407 Ga0207640_100544072 295
353 3300026035 Ga0207703_10100730 Ga0207703_101007301 295
354 3300026067 Ga0207678_10027343 Ga0207678_100273432 295
355 3300026075 Ga0207708_10015907 Ga0207708_100159073 295
356 3300026075 Ga0207708_10021613 Ga0207708_100216132 295
357 3300026088 Ga0207641_10463466 Ga0207641_104634661 295
358 3300026095 Ga0207676_10511300 Ga0207676_105113001 295
359 3300026116 Ga0207674_10356207 Ga0207674_103562072 295
360 3300026118 Ga0207675_100082837 Ga0207675_1000828372 295
361 3300026121 Ga0207683_10015933 Ga0207683_100159333 295
362 3300026121 Ga0207683_10052291 Ga0207683_100522912 295
363 3300026121 Ga0207683_10064245 Ga0207683_100642452 295
364 3300028379 Ga0268266_10370456 Ga0268266_103704561 295
365 3300028381 Ga0268264_10629813 Ga0268264_106298131 295
366 3300034816 Ga0373930_0006629 Ga0373930_0006629_333_1229 295
367 3300035085 Ga0373929_0005092 Ga0373929_0005092_38_934 295
368 3300035090 Ga0373949_0004850 Ga0373949_0004850_2047_2943 295
369 3300035092 Ga0373952_0001406 Ga0373952_0001406_1966_2862 295
370 3300035115 Ga0373941_0008913 Ga0373941_0008913_1513_2409 295
371 3300035121 Ga0373960_0006227 Ga0373960_0006227_1641_2537 295
372 3300035691 Ga0373931_0004141 Ga0373931_0004141_5367_6263 295
373 3300037418 Ga0395900_0262435 Ga0395900_0262435_275_1162 295
374 3300039437 Ga0436365_1864184 Ga0436365_1864184_2833_3729 295
375 3300041999 Ga0439433_0007210 Ga0439433_0007210_1217_2107 295
376 3300042002 Ga0439442_000444 Ga0439442_000444_4981_5871 295
377 3300042007 Ga0439449_0040262 Ga0439449_0040262_70_960 295
378 3300042010 Ga0439452_020145 Ga0439452_020145_145_1035 295
379 3300042015 Ga0439462_0026599 Ga0439462_0026599_622_1512 295
380 3300042146 Ga0450907_000082 Ga0450907_000082_1179_2069 295
381 3300042435 Ga0439434_0004773 Ga0439434_0004773_1930_2820 295
382 3300045976 Ga0466967_0017854 Ga0466967_0017854_317_1213 295
383 3300045976 Ga0466967_0093481 Ga0466967_0093481_1771_2667 295
384 3300046475 Ga0495639_0001753 Ga0495639_0001753_1100_1987 295
385 3300046535 Ga0495586_0000835 Ga0495586_0000835_11215_12102 295
386 3300046674 Ga0495588_0001697 Ga0495588_0001697_2228_3115 295
387 3300047315 Ga0495581_0008501 Ga0495581_0008501_4995_5882 295
388 3300048903 Ga0496100_0020430 Ga0496100_0020430_3044_3940 295
389 3300048904 Ga0496101_0048753 Ga0496101_0048753_1138_2034 295
390 3300048904 Ga0496101_0270239 Ga0496101_0270239_256_1152 295
391 3300048905 Ga0496102_0007065 Ga0496102_0007065_7665_8552 295
392 3300048905 Ga0496102_0062278 Ga0496102_0062278_186_1082 295
393 3300048905 Ga0496102_0092555 Ga0496102_0092555_1087_1974 295
394 3300048905 Ga0496102_0128023 Ga0496102_0128023_1224_2111 295
395 3300048907 Ga0496104_0045541 Ga0496104_0045541_1592_2488 295
396 3300048907 Ga0496104_0112409 Ga0496104_0112409_984_1880 295
397 3300048908 Ga0496105_0046715 Ga0496105_0046715_1784_2680 295
398 3300048909 Ga0496106_0058656 Ga0496106_0058656_809_1705 295
399 3300048910 Ga0496107_0214249 Ga0496107_0214249_210_1106 295
400 3300048911 Ga0496108_0049877 Ga0496108_0049877_180_1076 295
401 3300048911 Ga0496108_0069625 Ga0496108_0069625_256_1161 295
402 3300048912 Ga0496109_0035891 Ga0496109_0035891_2664_3560 295
403 3300048912 Ga0496109_0046269 Ga0496109_0046269_2447_3343 295
404 3300048913 Ga0496110_0028234 Ga0496110_0028234_1924_2820 295
405 3300048914 Ga0496111_0087117 Ga0496111_0087117_466_1362 295
406 3300048914 Ga0496111_0172528 Ga0496111_0172528_65_961 295
407 3300048915 Ga0496112_0068386 Ga0496112_0068386_2379_3275 295
408 3300048916 Ga0496113_0009722 Ga0496113_0009722_3045_3941 295
409 3300048917 Ga0496114_0068490 Ga0496114_0068490_491_1387 295
410 3300048917 Ga0496114_0560801 Ga0496114_0560801_25_924 295
411 3300048920 Ga0496117_0077888 Ga0496117_0077888_362_1249 295
412 3300048921 Ga0496118_0008933 Ga0496118_0008933_4221_5108 295
413 3300049568 Ga0501031_0215517 Ga0501031_0215517_279_1172 295
414 3300049569 Ga0501032_0022787 Ga0501032_0022787_619_1512 295
415 3300049574 Ga0501038_0012973 Ga0501038_0012973_6420_7313 295
416 3300049580 Ga0501046_0016562 Ga0501046_0016562_2038_2931 295
417 3300049585 Ga0501069_0060207 Ga0501069_0060207_697_1590 295
418 3300050491 nmdc:mga00v17_52646_c1 nmdc:mga00v17_52646_c1_625_1515 295
419 3300050491 nmdc:mga00v17_9315_c1 nmdc:mga00v17_9315_c1_943_1836 295
420 3300050492 nmdc:mga0yw44_1733_c1 nmdc:mga0yw44_1733_c1_6377_7270 295
421 3300050492 nmdc:mga0yw44_5234_c1 nmdc:mga0yw44_5234_c1_1870_2763 295
422 3300050515 nmdc:mga0a205_22329_c1 nmdc:mga0a205_22329_c1_5043_5939 295
423 3300053087 Ga0500643_000325 Ga0500643_000325_29613_30503 295
424 3300053104 Ga0500556_0000145 Ga0500556_0000145_36110_37003 295
425 3300053108 Ga0500562_001075 Ga0500562_001075_4423_5316 295
426 3300053117 Ga0500593_004917 Ga0500593_004917_1219_2112 295
427 3300053133 Ga0500655_001109 Ga0500655_001109_3112_4005 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

52

310

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o0k-assembly3.cif.gz_C crystal structure of aldo/keto reductase from brucella melitensis 0.9788 1 271
3o0k-assembly1.cif.gz_A crystal structure of aldo/keto reductase from brucella melitensis 0.9766 1 271
3o0k-assembly4.cif.gz_D crystal structure of aldo/keto reductase from brucella melitensis 0.9757 1 271
4q3m-assembly1.cif.gz_B crystal structure of mgs-m4, an aldo-keto reductase enzyme from a medee basin deep-sea metagenome library 0.9756 3 275
3f7j-assembly2.cif.gz_B b.subtilis yvgn 0.9755 3 281
ID Description Score Start End Superfamily
af_P91021_30_130_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9769 2 75 3.20.20.100
2wzmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9709 1 280 3.20.20.100
af_Q4DJ07_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.968 2 281 3.20.20.100
af_Q5T2L2_5_129_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9664 4 109 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9601 3 281 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A0K8Q7P4-F1-model_v4 Morphine 6-dehydrogenase 0.9973 3 186 GO:0004033
GO:0044281
AF-A0A7X7ZGG2-F1-model_v4 Aldo/keto reductase 0.9973 3 182 GO:0004033
GO:0044281
AF-A0A2S8MGV9-F1-model_v4 deleted 0.989 1 156
AF-A0A2N4A6U9-F1-model_v4 deleted 0.9883 1 192
AF-A0A6B3GCP6-F1-model_v4 Aldo/keto reductase 0.9883 2 164 GO:0004033
GO:0044281

Feature Viewer

pLDDT pTM Quality
93.69 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map