F440356
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 422 | 258 | 420 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300046462|Ga0495651_0001296|Ga0495651_0001296_4677_5222 |
| Length | 181 |
| Sequence | MQTASCYRRKQALAPAPTALGTKGAIMPSHAPLSPQEAADRLAIRELIDAYAHCADRRDAKGQMALFTEDTRFLVFMDATAAEPTQELRGRDSLAPVFDNLNSYKVTTHFNGESTVSLDGDRASGESYCLAHHVSFGTDAERTIMIASIRYLDEFVKQDGEWLFAERRLMVDWTETRPCVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 2 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 122 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 123 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 124 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 127 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 128 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 129 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 130 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 131 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 132 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 133 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 134 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 142 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 143 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 238 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 239 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 240 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 241 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 242 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 243 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 244 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 245 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 246 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 247 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 248 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 249 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 250 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 252 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 253 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 254 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 255 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 256 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 257 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 258 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0 |
| Isolates | 0.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.4 |
| Nodule | 0.24 |
| Rhizoplane | 4.5 |
| Rhizosphere | 82.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1008326 | 3300002705 | Unclassified | 2623 |
| 2 | rootH2_10008368 | 3300003320 | Bacteria | 5278 |
| 3 | Ga0055535_1000056 | 3300003761 | Bacteria | 128204 |
| 4 | Ga0055529_1000165 | 3300003763 | Bacteria | 91442 |
| 5 | Ga0070683_101494166 | 3300005329 | Bacteria | 649 |
| 6 | Ga0068869_100069257 | 3300005334 | Bacteria | 2608 |
| 7 | Ga0068869_100176372 | 3300005334 | Bacteria | 1673 |
| 8 | Ga0070682_100180970 | 3300005337 | Bacteria | 1472 |
| 9 | Ga0068868_100391807 | 3300005338 | Bacteria | 1197 |
| 10 | Ga0070689_100001333 | 3300005340 | Bacteria | 15704 |
| 11 | Ga0070692_10067380 | 3300005345 | Bacteria | 1900 |
| 12 | Ga0070674_100632206 | 3300005356 | Bacteria | 908 |
| 13 | Ga0070688_100000192 | 3300005365 | Bacteria | 32260 |
| 14 | Ga0070688_100737196 | 3300005365 | Unclassified | 766 |
| 15 | Ga0070659_100241998 | 3300005366 | Bacteria | 1493 |
| 16 | Ga0070714_100205053 | 3300005435 | Bacteria | 1805 |
| 17 | Ga0070714_100233474 | 3300005435 | Bacteria | 1695 |
| 18 | Ga0070714_101984997 | 3300005435 | Unclassified | 567 |
| 19 | Ga0070713_100779949 | 3300005436 | Unclassified | 915 |
| 20 | Ga0070710_10030953 | 3300005437 | Bacteria | 2884 |
| 21 | Ga0070701_10065076 | 3300005438 | Bacteria | 1934 |
| 22 | Ga0070701_10621929 | 3300005438 | Unclassified | 718 |
| 23 | Ga0070711_100339120 | 3300005439 | Bacteria | 1205 |
| 24 | Ga0070700_100085989 | 3300005441 | Bacteria | 2041 |
| 25 | Ga0070694_100028809 | 3300005444 | Bacteria | 3618 |
| 26 | Ga0070694_100032913 | 3300005444 | Bacteria | 3406 |
| 27 | Ga0070694_100503405 | 3300005444 | Bacteria | 964 |
| 28 | Ga0070708_100541122 | 3300005445 | Bacteria | 1099 |
| 29 | Ga0070708_100921030 | 3300005445 | Bacteria | 820 |
| 30 | Ga0070708_101473033 | 3300005445 | Bacteria | 634 |
| 31 | Ga0070663_100462315 | 3300005455 | Bacteria | 1048 |
| 32 | Ga0070662_100032473 | 3300005457 | Bacteria | 3669 |
| 33 | Ga0070662_100388501 | 3300005457 | Unclassified | 1150 |
| 34 | Ga0070685_10001326 | 3300005466 | Bacteria | 12999 |
| 35 | Ga0070685_10278214 | 3300005466 | Bacteria | 1119 |
| 36 | Ga0070706_100008954 | 3300005467 | Bacteria | 9320 |
| 37 | Ga0070706_100013861 | 3300005467 | Bacteria | 7454 |
| 38 | Ga0070706_100219680 | 3300005467 | Bacteria | 1774 |
| 39 | Ga0070706_100512743 | 3300005467 | Bacteria | 1115 |
| 40 | Ga0070707_100066417 | 3300005468 | Bacteria | 3466 |
| 41 | Ga0070707_101029658 | 3300005468 | Bacteria | 789 |
| 42 | Ga0070707_101269003 | 3300005468 | Bacteria | 703 |
| 43 | Ga0070698_100003396 | 3300005471 | Bacteria | 17512 |
| 44 | Ga0070698_100018808 | 3300005471 | Bacteria | 7269 |
| 45 | Ga0070698_100052139 | 3300005471 | Plasmid | 4164 |
| 46 | Ga0070698_100080911 | 3300005471 | Bacteria | 3243 |
| 47 | Ga0070698_100094413 | 3300005471 | Bacteria | 2970 |
| 48 | Ga0070698_101272268 | 3300005471 | Bacteria | 685 |
| 49 | Ga0070699_100107789 | 3300005518 | Bacteria | 2444 |
| 50 | Ga0070697_100270472 | 3300005536 | Bacteria | 1456 |
| 51 | Ga0070697_100584029 | 3300005536 | Bacteria | 981 |
| 52 | Ga0070665_100645892 | 3300005548 | Bacteria | 1071 |
| 53 | Ga0070704_100436124 | 3300005549 | Unclassified | 1125 |
| 54 | Ga0068854_100328290 | 3300005578 | Unclassified | 1246 |
| 55 | Ga0070702_100090036 | 3300005615 | Bacteria | 1859 |
| 56 | Ga0068852_100052028 | 3300005616 | Bacteria | 3518 |
| 57 | Ga0068859_100026872 | 3300005617 | Bacteria | 5773 |
| 58 | Ga0068859_100859288 | 3300005617 | Bacteria | 993 |
| 59 | Ga0068864_100018120 | 3300005618 | Bacteria | 5877 |
| 60 | Ga0068866_10060869 | 3300005718 | Bacteria | 1959 |
| 61 | Ga0068861_100197149 | 3300005719 | Bacteria | 1687 |
| 62 | Ga0068851_10527978 | 3300005834 | Bacteria | 711 |
| 63 | Ga0068863_100026239 | 3300005841 | Bacteria | 5560 |
| 64 | Ga0068863_100055904 | 3300005841 | Bacteria | 3737 |
| 65 | Ga0068860_100261884 | 3300005843 | Bacteria | 1686 |
| 66 | Ga0068860_100546309 | 3300005843 | Unclassified | 1160 |
| 67 | Ga0068860_101354756 | 3300005843 | Bacteria | 733 |
| 68 | Ga0068862_100157286 | 3300005844 | Bacteria | 2026 |
| 69 | Ga0068862_100759760 | 3300005844 | Bacteria | 944 |
| 70 | Ga0081455_10009488 | 3300005937 | Bacteria | 10004 |
| 71 | Ga0081538_10016658 | 3300005981 | Bacteria | 5622 |
| 72 | Ga0081538_10038103 | 3300005981 | Bacteria | 3107 |
| 73 | Ga0081538_10050270 | 3300005981 | Bacteria | 2519 |
| 74 | Ga0081538_10094607 | 3300005981 | Unclassified | 1529 |
| 75 | Ga0081540_1000176 | 3300005983 | Bacteria | 67057 |
| 76 | Ga0081540_1041252 | 3300005983 | Unclassified | 2395 |
| 77 | Ga0070717_10075471 | 3300006028 | Bacteria | 2820 |
| 78 | Ga0070717_10169110 | 3300006028 | Bacteria | 1900 |
| 79 | Ga0070717_10292494 | 3300006028 | Bacteria | 1446 |
| 80 | Ga0075432_10002934 | 3300006058 | Bacteria | 5739 |
| 81 | Ga0075432_10010301 | 3300006058 | Bacteria | 3170 |
| 82 | Ga0075432_10117283 | 3300006058 | Bacteria | 997 |
| 83 | Ga0070715_11033879 | 3300006163 | Unclassified | 514 |
| 84 | Ga0070712_100103424 | 3300006175 | Bacteria | 2111 |
| 85 | Ga0070712_100159657 | 3300006175 | Bacteria | 1740 |
| 86 | Ga0070712_100206558 | 3300006175 | Bacteria | 1546 |
| 87 | Ga0075428_100016257 | 3300006844 | Bacteria | 8225 |
| 88 | Ga0075428_100023117 | 3300006844 | Bacteria | 6877 |
| 89 | Ga0075428_100030944 | 3300006844 | Bacteria | 5918 |
| 90 | Ga0075428_100701498 | 3300006844 | Bacteria | 1078 |
| 91 | Ga0075428_100790800 | 3300006844 | Bacteria | 1009 |
| 92 | Ga0075428_101513712 | 3300006844 | Bacteria | 703 |
| 93 | Ga0075431_100240900 | 3300006847 | Bacteria | 1840 |
| 94 | Ga0075431_100611828 | 3300006847 | Bacteria | 1073 |
| 95 | Ga0075433_10016301 | 3300006852 | Bacteria | 6117 |
| 96 | Ga0075433_10018681 | 3300006852 | Bacteria | 5765 |
| 97 | Ga0075433_10393094 | 3300006852 | Bacteria | 1224 |
| 98 | Ga0075433_10506026 | 3300006852 | Bacteria | 1063 |
| 99 | Ga0075434_100000543 | 3300006871 | Bacteria | 28760 |
| 100 | Ga0075434_100237465 | 3300006871 | Bacteria | 1842 |
| 101 | Ga0075429_100081117 | 3300006880 | Bacteria | 2828 |
| 102 | Ga0075429_100294820 | 3300006880 | Unclassified | 1420 |
| 103 | Ga0068865_100317182 | 3300006881 | Bacteria | 1252 |
| 104 | Ga0075436_100061527 | 3300006914 | Bacteria | 2593 |
| 105 | Ga0075436_100089790 | 3300006914 | Unclassified | 2135 |
| 106 | Ga0075436_100569682 | 3300006914 | Bacteria | 832 |
| 107 | Ga0097620_100026872 | 3300006931 | Bacteria | 5773 |
| 108 | Ga0097620_100859241 | 3300006931 | Bacteria | 993 |
| 109 | Ga0075435_100002946 | 3300007076 | Bacteria | 11443 |
| 110 | Ga0075435_100317391 | 3300007076 | Bacteria | 1333 |
| 111 | Ga0105251_10062270 | 3300009011 | Bacteria | 1752 |
| 112 | Ga0105240_10378801 | 3300009093 | Bacteria | 1598 |
| 113 | Ga0105240_10815076 | 3300009093 | Unclassified | 1010 |
| 114 | Ga0105240_11404467 | 3300009093 | Bacteria | 734 |
| 115 | Ga0111539_10006838 | 3300009094 | Bacteria | 14655 |
| 116 | Ga0111539_10391051 | 3300009094 | Bacteria | 1619 |
| 117 | Ga0111539_11966757 | 3300009094 | Bacteria | 678 |
| 118 | Ga0105245_10076649 | 3300009098 | Bacteria | 3046 |
| 119 | Ga0105245_10094988 | 3300009098 | Bacteria | 2749 |
| 120 | Ga0105245_10489957 | 3300009098 | Bacteria | 1244 |
| 121 | Ga0114129_10026678 | 3300009147 | Bacteria | 8182 |
| 122 | Ga0114129_10028650 | 3300009147 | Bacteria | 7890 |
| 123 | Ga0114129_11683527 | 3300009147 | Bacteria | 774 |
| 124 | Ga0105243_10035678 | 3300009148 | Bacteria | 3855 |
| 125 | Ga0105242_10030951 | 3300009176 | Bacteria | 4274 |
| 126 | Ga0105242_10144842 | 3300009176 | Bacteria | 2066 |
| 127 | Ga0105248_10114888 | 3300009177 | Bacteria | 3036 |
| 128 | Ga0105248_11401104 | 3300009177 | Bacteria | 791 |
| 129 | Ga0105237_10182449 | 3300009545 | Bacteria | 2099 |
| 130 | Ga0105238_10352472 | 3300009551 | Bacteria | 1461 |
| 131 | Ga0105238_11551051 | 3300009551 | Unclassified | 692 |
| 132 | Ga0105249_10018310 | 3300009553 | Bacteria | 6227 |
| 133 | Ga0105249_10201587 | 3300009553 | Bacteria | 1947 |
| 134 | Ga0105249_10335388 | 3300009553 | Bacteria | 1527 |
| 135 | Ga0157326_1036387 | 3300012513 | Bacteria | 674 |
| 136 | Ga0157369_10093477 | 3300013105 | Bacteria | 3210 |
| 137 | Ga0157369_10533100 | 3300013105 | Bacteria | 1214 |
| 138 | Ga0157369_10590552 | 3300013105 | Bacteria | 1147 |
| 139 | Ga0163162_10140940 | 3300013306 | Bacteria | 2524 |
| 140 | Ga0163162_10188017 | 3300013306 | Bacteria | 2192 |
| 141 | Ga0163162_12323859 | 3300013306 | Unclassified | 616 |
| 142 | Ga0157372_11071562 | 3300013307 | Unclassified | 933 |
| 143 | Ga0157375_10211934 | 3300013308 | Bacteria | 2095 |
| 144 | Ga0157375_10279946 | 3300013308 | Bacteria | 1831 |
| 145 | Ga0157375_10885209 | 3300013308 | Bacteria | 1038 |
| 146 | Ga0163163_11249880 | 3300014325 | Unclassified | 805 |
| 147 | Ga0157380_10112428 | 3300014326 | Bacteria | 2291 |
| 148 | Ga0157380_10151374 | 3300014326 | Bacteria | 2006 |
| 149 | Ga0157377_10018130 | 3300014745 | Bacteria | 3655 |
| 150 | Ga0157379_10340484 | 3300014968 | Unclassified | 1372 |
| 151 | Ga0163161_10439433 | 3300017792 | Bacteria | 1053 |
| 152 | Ga0209258_100071 | 3300025242 | Bacteria | 278319 |
| 153 | Ga0209759_1000525 | 3300025256 | Bacteria | 40745 |
| 154 | Ga0209455_1000030 | 3300025272 | Bacteria | 533479 |
| 155 | Ga0207642_10011240 | 3300025899 | Bacteria | 3186 |
| 156 | Ga0207642_10197431 | 3300025899 | Bacteria | 1109 |
| 157 | Ga0207688_10002665 | 3300025901 | Bacteria | 9667 |
| 158 | Ga0207688_10085006 | 3300025901 | Bacteria | 1812 |
| 159 | Ga0207647_10045762 | 3300025904 | Bacteria | 2729 |
| 160 | Ga0207647_10258891 | 3300025904 | Bacteria | 997 |
| 161 | Ga0207685_10630309 | 3300025905 | Unclassified | 578 |
| 162 | Ga0207684_10002131 | 3300025910 | Bacteria | 20280 |
| 163 | Ga0207684_10207619 | 3300025910 | Bacteria | 1690 |
| 164 | Ga0207684_10718437 | 3300025910 | Unclassified | 848 |
| 165 | Ga0207671_10468255 | 3300025914 | Bacteria | 1004 |
| 166 | Ga0207693_10034902 | 3300025915 | Bacteria | 3967 |
| 167 | Ga0207693_10066396 | 3300025915 | Bacteria | 2824 |
| 168 | Ga0207693_10711831 | 3300025915 | Bacteria | 777 |
| 169 | Ga0207663_10133659 | 3300025916 | Bacteria | 1718 |
| 170 | Ga0207657_10098606 | 3300025919 | Bacteria | 2428 |
| 171 | Ga0207646_11002657 | 3300025922 | Bacteria | 738 |
| 172 | Ga0207694_10164435 | 3300025924 | Bacteria | 1794 |
| 173 | Ga0207694_10483817 | 3300025924 | Bacteria | 1035 |
| 174 | Ga0207687_10613004 | 3300025927 | Bacteria | 918 |
| 175 | Ga0207700_10643021 | 3300025928 | Unclassified | 945 |
| 176 | Ga0207644_11485076 | 3300025931 | Bacteria | 569 |
| 177 | Ga0207690_10192143 | 3300025932 | Bacteria | 1544 |
| 178 | Ga0207690_10209993 | 3300025932 | Unclassified | 1484 |
| 179 | Ga0207706_10006072 | 3300025933 | Bacteria | 11225 |
| 180 | Ga0207706_10710792 | 3300025933 | Unclassified | 858 |
| 181 | Ga0207709_10253723 | 3300025935 | Bacteria | 1286 |
| 182 | Ga0207670_10000241 | 3300025936 | Bacteria | 34491 |
| 183 | Ga0207669_10221547 | 3300025937 | Bacteria | 1389 |
| 184 | Ga0207689_10048210 | 3300025942 | Bacteria | 3514 |
| 185 | Ga0207689_10147398 | 3300025942 | Bacteria | 1939 |
| 186 | Ga0207661_10317603 | 3300025944 | Bacteria | 1400 |
| 187 | Ga0207668_10186433 | 3300025972 | Bacteria | 1641 |
| 188 | Ga0207640_10173959 | 3300025981 | Bacteria | 1607 |
| 189 | Ga0207640_10396181 | 3300025981 | Bacteria | 1123 |
| 190 | Ga0207658_10255606 | 3300025986 | Bacteria | 1491 |
| 191 | Ga0207677_10246522 | 3300026023 | Bacteria | 1448 |
| 192 | Ga0207677_10276365 | 3300026023 | Bacteria | 1377 |
| 193 | Ga0207677_10310474 | 3300026023 | Bacteria | 1306 |
| 194 | Ga0207678_10457612 | 3300026067 | Bacteria | 1110 |
| 195 | Ga0207708_10128323 | 3300026075 | Bacteria | 1981 |
| 196 | Ga0207708_10220509 | 3300026075 | Bacteria | 1519 |
| 197 | Ga0207708_10853345 | 3300026075 | Bacteria | 786 |
| 198 | Ga0207641_10110811 | 3300026088 | Bacteria | 2433 |
| 199 | Ga0207648_10048563 | 3300026089 | Bacteria | 3715 |
| 200 | Ga0207676_10288061 | 3300026095 | Bacteria | 1494 |
| 201 | Ga0207675_100016061 | 3300026118 | Bacteria | 6990 |
| 202 | Ga0207675_100270798 | 3300026118 | Bacteria | 1648 |
| 203 | Ga0207698_10042816 | 3300026142 | Bacteria | 3387 |
| 204 | Ga0207698_10961840 | 3300026142 | Bacteria | 863 |
| 205 | Ga0207428_10006357 | 3300027907 | Bacteria | 10927 |
| 206 | Ga0207428_10053101 | 3300027907 | Bacteria | 3233 |
| 207 | Ga0268266_10438152 | 3300028379 | Bacteria | 1241 |
| 208 | Ga0268265_10042418 | 3300028380 | Bacteria | 3376 |
| 209 | Ga0268265_10484026 | 3300028380 | Bacteria | 1163 |
| 210 | Ga0268265_10547420 | 3300028380 | Bacteria | 1098 |
| 211 | Ga0268264_10127020 | 3300028381 | Bacteria | 2255 |
| 212 | Ga0307517_10022489 | 3300028786 | Bacteria | 7895 |
| 213 | Ga0307517_10025008 | 3300028786 | Bacteria | 7328 |
| 214 | Ga0307517_10338040 | 3300028786 | Bacteria | 824 |
| 215 | Ga0307515_10000106 | 3300028794 | Bacteria | 197218 |
| 216 | Ga0307511_10002051 | 3300030521 | Bacteria | 21091 |
| 217 | Ga0307512_10001704 | 3300030522 | Bacteria | 30048 |
| 218 | Ga0307512_10099218 | 3300030522 | Bacteria | 1983 |
| 219 | Ga0307513_10616108 | 3300031456 | Bacteria | 794 |
| 220 | Ga0307509_10007222 | 3300031507 | Bacteria | 14623 |
| 221 | Ga0307509_10021254 | 3300031507 | Bacteria | 7343 |
| 222 | Ga0307508_10017515 | 3300031616 | Bacteria | 6512 |
| 223 | Ga0307508_10040870 | 3300031616 | Bacteria | 4163 |
| 224 | Ga0307508_10223267 | 3300031616 | Bacteria | 1483 |
| 225 | Ga0307514_10003655 | 3300031649 | Bacteria | 14595 |
| 226 | Ga0307516_10009394 | 3300031730 | Bacteria | 10908 |
| 227 | Ga0307516_10051547 | 3300031730 | Bacteria | 4033 |
| 228 | Ga0307516_10077314 | 3300031730 | Bacteria | 3177 |
| 229 | Ga0307518_10036585 | 3300031838 | Bacteria | 3568 |
| 230 | Ga0307518_10113616 | 3300031838 | Bacteria | 1926 |
| 231 | Ga0307507_10005664 | 3300033179 | Bacteria | 20263 |
| 232 | Ga0307507_10005887 | 3300033179 | Bacteria | 19529 |
| 233 | Ga0307510_10033747 | 3300033180 | Bacteria | 5742 |
| 234 | Ga0307510_10039953 | 3300033180 | Bacteria | 5159 |
| 235 | Ga0316215_1021706 | 3300033544 | Bacteria | 655 |
| 236 | Ga0373931_0710868 | 3300035691 | Bacteria | 664 |
| 237 | Ga0373925_0000072 | 3300037068 | Bacteria | 106707 |
| 238 | Ga0395899_0048226 | 3300037312 | Bacteria | 3170 |
| 239 | Ga0395900_0009595 | 3300037418 | Bacteria | 9922 |
| 240 | Ga0395898_0007002 | 3300037466 | Bacteria | 11983 |
| 241 | Ga0395905_0026494 | 3300037471 | Bacteria | 5465 |
| 242 | Ga0395901_0005639 | 3300038443 | Bacteria | 12667 |
| 243 | Ga0242419_006727 | 3300038698 | Bacteria | 840 |
| 244 | Ga0453683_0769660 | 3300044673 | Bacteria | 633 |
| 245 | Ga0495592_0001777 | 3300046454 | Bacteria | 15168 |
| 246 | Ga0495592_0094619 | 3300046454 | Bacteria | 2138 |
| 247 | Ga0495629_0007584 | 3300046459 | Bacteria | 7993 |
| 248 | Ga0495629_0020104 | 3300046459 | Bacteria | 4767 |
| 249 | Ga0495638_0008656 | 3300046460 | Bacteria | 7199 |
| 250 | Ga0495638_0153269 | 3300046460 | Bacteria | 1335 |
| 251 | Ga0495651_0001296 | 3300046462 | Bacteria | 19414 |
| 252 | Ga0495651_0011552 | 3300046462 | Bacteria | 6783 |
| 253 | Ga0495651_0579933 | 3300046462 | Unclassified | 709 |
| 254 | Ga0495653_0024752 | 3300046463 | Bacteria | 4832 |
| 255 | Ga0495580_0027166 | 3300046472 | Bacteria | 4165 |
| 256 | Ga0495582_0029969 | 3300046473 | Bacteria | 2986 |
| 257 | Ga0495605_0115413 | 3300046474 | Bacteria | 1222 |
| 258 | Ga0495662_0002022 | 3300046476 | Bacteria | 10146 |
| 259 | Ga0495662_0015633 | 3300046476 | Bacteria | 3682 |
| 260 | Ga0495664_0003989 | 3300046477 | Bacteria | 8062 |
| 261 | Ga0495664_0007333 | 3300046477 | Bacteria | 6122 |
| 262 | Ga0495585_0057649 | 3300046492 | Bacteria | 2143 |
| 263 | Ga0495594_0035749 | 3300046499 | Bacteria | 2707 |
| 264 | Ga0495608_0000621 | 3300046511 | Bacteria | 24414 |
| 265 | Ga0495610_0105208 | 3300046512 | Bacteria | 1258 |
| 266 | Ga0495618_0125571 | 3300046514 | Bacteria | 1643 |
| 267 | Ga0495628_0004128 | 3300046516 | Bacteria | 12919 |
| 268 | Ga0495628_0200569 | 3300046516 | Bacteria | 1503 |
| 269 | Ga0495630_0129259 | 3300046517 | Bacteria | 1918 |
| 270 | Ga0495632_0087537 | 3300046519 | Bacteria | 1480 |
| 271 | Ga0495643_0002710 | 3300046522 | Bacteria | 13641 |
| 272 | Ga0495666_0001188 | 3300046526 | Bacteria | 12541 |
| 273 | Ga0495652_0009693 | 3300046529 | Bacteria | 8736 |
| 274 | Ga0495652_0079892 | 3300046529 | Bacteria | 2703 |
| 275 | Ga0495665_0002856 | 3300046531 | Bacteria | 9333 |
| 276 | Ga0495640_0013845 | 3300046533 | Bacteria | 6125 |
| 277 | Ga0495640_0107176 | 3300046533 | Bacteria | 1829 |
| 278 | Ga0495586_0131059 | 3300046535 | Bacteria | 1404 |
| 279 | Ga0495587_0077146 | 3300046536 | Bacteria | 1935 |
| 280 | Ga0495645_0037549 | 3300046543 | Bacteria | 3532 |
| 281 | Ga0495645_0101419 | 3300046543 | Bacteria | 2046 |
| 282 | Ga0495645_0125708 | 3300046543 | Bacteria | 1801 |
| 283 | Ga0495645_0138536 | 3300046543 | Bacteria | 1700 |
| 284 | Ga0495622_0144369 | 3300046557 | Bacteria | 1079 |
| 285 | Ga0495633_0038962 | 3300046558 | Bacteria | 2269 |
| 286 | Ga0495667_0043697 | 3300046559 | Bacteria | 2968 |
| 287 | Ga0495667_0372549 | 3300046559 | Unclassified | 901 |
| 288 | Ga0495656_0110102 | 3300046615 | Bacteria | 1287 |
| 289 | Ga0495634_0003255 | 3300046642 | Bacteria | 13117 |
| 290 | Ga0495611_0156502 | 3300046648 | Bacteria | 1064 |
| 291 | Ga0495625_0007997 | 3300046660 | Bacteria | 9081 |
| 292 | Ga0495625_0666086 | 3300046660 | Bacteria | 618 |
| 293 | Ga0495635_0001628 | 3300046663 | Bacteria | 15131 |
| 294 | Ga0495588_0015190 | 3300046674 | Bacteria | 3699 |
| 295 | Ga0495588_0291663 | 3300046674 | Bacteria | 859 |
| 296 | Ga0495657_0000602 | 3300046675 | Bacteria | 32915 |
| 297 | Ga0495657_0004402 | 3300046675 | Bacteria | 11241 |
| 298 | Ga0495646_0025311 | 3300046680 | Bacteria | 3733 |
| 299 | Ga0495646_0067830 | 3300046680 | Bacteria | 2107 |
| 300 | Ga0495613_0000692 | 3300046689 | Bacteria | 26583 |
| 301 | Ga0495613_0073271 | 3300046689 | Bacteria | 2495 |
| 302 | Ga0495613_0569370 | 3300046689 | Bacteria | 756 |
| 303 | Ga0495613_0755790 | 3300046689 | Unclassified | 637 |
| 304 | Ga0495624_0501525 | 3300046690 | Bacteria | 726 |
| 305 | Ga0495670_0007291 | 3300046691 | Bacteria | 5435 |
| 306 | Ga0495670_0736390 | 3300046691 | Unclassified | 538 |
| 307 | Ga0495671_0130336 | 3300046692 | Bacteria | 1226 |
| 308 | Ga0495649_0185455 | 3300046694 | Bacteria | 1084 |
| 309 | Ga0495589_0103669 | 3300046794 | Bacteria | 1375 |
| 310 | Ga0495600_0004965 | 3300046809 | Bacteria | 7987 |
| 311 | Ga0495600_0023860 | 3300046809 | Bacteria | 3935 |
| 312 | Ga0495660_0052971 | 3300046810 | Bacteria | 2204 |
| 313 | Ga0495581_0005346 | 3300047315 | Bacteria | 7426 |
| 314 | Ga0495581_0021503 | 3300047315 | Bacteria | 3738 |
| 315 | Ga0495604_0000491 | 3300047317 | Bacteria | 34687 |
| 316 | Ga0495604_0000721 | 3300047317 | Bacteria | 27964 |
| 317 | Ga0495604_0307604 | 3300047317 | Bacteria | 1063 |
| 318 | Ga0495604_0401219 | 3300047317 | Bacteria | 903 |
| 319 | Ga0495636_0445066 | 3300047318 | Bacteria | 622 |
| 320 | Ga0495674_0523691 | 3300047319 | Bacteria | 946 |
| 321 | Ga0495676_0008112 | 3300047321 | Bacteria | 9635 |
| 322 | Ga0495680_0871997 | 3300047322 | Bacteria | 583 |
| 323 | Ga0495683_0046370 | 3300047323 | Bacteria | 2181 |
| 324 | Ga0495687_002793 | 3300047443 | Bacteria | 13477 |
| 325 | Ga0495687_010808 | 3300047443 | Bacteria | 4968 |
| 326 | Ga0495687_024353 | 3300047443 | Bacteria | 2878 |
| 327 | Ga0495687_032747 | 3300047443 | Bacteria | 2368 |
| 328 | Ga0495687_035134 | 3300047443 | Bacteria | 2257 |
| 329 | Ga0495675_0014341 | 3300047444 | Bacteria | 5006 |
| 330 | Ga0495679_119150 | 3300047446 | Bacteria | 722 |
| 331 | Ga0495685_004874 | 3300047447 | Bacteria | 4354 |
| 332 | Ga0495681_0003170 | 3300047470 | Bacteria | 11499 |
| 333 | Ga0495681_0016671 | 3300047470 | Bacteria | 4106 |
| 334 | Ga0495684_0055074 | 3300047471 | Bacteria | 3033 |
| 335 | Ga0495684_0258002 | 3300047471 | Bacteria | 1265 |
| 336 | Ga0495686_0078652 | 3300047472 | Bacteria | 2018 |
| 337 | Ga0495593_0084782 | 3300047673 | Bacteria | 1635 |
| 338 | Ga0495602_0043267 | 3300048088 | Bacteria | 4097 |
| 339 | Ga0495602_0200667 | 3300048088 | Bacteria | 1522 |
| 340 | Ga0495614_0011944 | 3300048089 | Bacteria | 3815 |
| 341 | Ga0495614_0026727 | 3300048089 | Bacteria | 2487 |
| 342 | Ga0496100_0021753 | 3300048903 | Bacteria | 3869 |
| 343 | Ga0496101_0034192 | 3300048904 | Bacteria | 3588 |
| 344 | Ga0496101_0440795 | 3300048904 | Unclassified | 1027 |
| 345 | Ga0496102_0017562 | 3300048905 | Bacteria | 6267 |
| 346 | Ga0496103_0218430 | 3300048906 | Bacteria | 1226 |
| 347 | Ga0496104_0136162 | 3300048907 | Bacteria | 2360 |
| 348 | Ga0496106_0017301 | 3300048909 | Bacteria | 5336 |
| 349 | Ga0496106_1416818 | 3300048909 | Unclassified | 537 |
| 350 | Ga0496107_0021520 | 3300048910 | Bacteria | 4557 |
| 351 | Ga0496107_0374772 | 3300048910 | Bacteria | 1058 |
| 352 | Ga0496107_0537772 | 3300048910 | Unclassified | 866 |
| 353 | Ga0496108_0376491 | 3300048911 | Bacteria | 1240 |
| 354 | Ga0496108_0485737 | 3300048911 | Bacteria | 1079 |
| 355 | Ga0496110_0216744 | 3300048913 | Bacteria | 1741 |
| 356 | Ga0496110_0264985 | 3300048913 | Bacteria | 1564 |
| 357 | Ga0496110_0279457 | 3300048913 | Bacteria | 1520 |
| 358 | Ga0496111_0513917 | 3300048914 | Bacteria | 881 |
| 359 | Ga0496112_0359900 | 3300048915 | Unclassified | 1397 |
| 360 | Ga0496115_0136420 | 3300048918 | Bacteria | 2023 |
| 361 | Ga0501033_0447490 | 3300049570 | Bacteria | 897 |
| 362 | Ga0501034_0379603 | 3300049571 | Bacteria | 1338 |
| 363 | Ga0501036_1114720 | 3300049572 | Bacteria | 644 |
| 364 | Ga0501038_0252268 | 3300049574 | Bacteria | 1397 |
| 365 | Ga0501039_0470204 | 3300049575 | Bacteria | 987 |
| 366 | Ga0501043_0223061 | 3300049579 | Bacteria | 1457 |
| 367 | Ga0501047_0210835 | 3300049581 | Bacteria | 1801 |
| 368 | Ga0501047_0451781 | 3300049581 | Bacteria | 1114 |
| 369 | nmdc:mga05p37_24310_c1 | 3300050507 | Bacteria | 7362 |
| 370 | nmdc:mga05p37_381041_c1 | 3300050507 | Bacteria | 1653 |
| 371 | nmdc:mga05p37_39023_c1 | 3300050507 | Bacteria | 5826 |
| 372 | nmdc:mga09592_464182_c1 | 3300050508 | Unclassified | 1092 |
| 373 | nmdc:mga09592_93609_c1 | 3300050508 | Bacteria | 2570 |
| 374 | nmdc:mga0qj67_789811_c1 | 3300050509 | Bacteria | 752 |
| 375 | nmdc:mga06r32_23642_c1 | 3300050510 | Bacteria | 5689 |
| 376 | nmdc:mga06r32_42926_c1 | 3300050510 | Bacteria | 4301 |
| 377 | nmdc:mga08y16_1089530_c1 | 3300050511 | Bacteria | 774 |
| 378 | nmdc:mga08y16_21113_c1 | 3300050511 | Bacteria | 6875 |
| 379 | nmdc:mga08y16_57914_c1 | 3300050511 | Bacteria | 4049 |
| 380 | nmdc:mga0n895_117441_c1 | 3300050512 | Bacteria | 2680 |
| 381 | nmdc:mga0n895_160242_c1 | 3300050512 | Bacteria | 2282 |
| 382 | nmdc:mga0n895_53772_c1 | 3300050512 | Bacteria | 3958 |
| 383 | nmdc:mga0rr50_43471_c1 | 3300050513 | Unclassified | 3289 |
| 384 | nmdc:mga0rr50_66750_c1 | 3300050513 | Bacteria | 2730 |
| 385 | nmdc:mga08x19_307526_c1 | 3300050514 | Bacteria | 1102 |
| 386 | nmdc:mga08x19_41666_c1 | 3300050514 | Bacteria | 2925 |
| 387 | nmdc:mga0a205_32448_c1 | 3300050515 | Bacteria | 5007 |
| 388 | nmdc:mga0a205_40101_c1 | 3300050515 | Bacteria | 4508 |
| 389 | nmdc:mga0a205_71998_c1 | 3300050515 | Unclassified | 3339 |
| 390 | Ga0495601_0004917 | 3300053077 | Bacteria | 7758 |
| 391 | Ga0495601_0038766 | 3300053077 | Bacteria | 2980 |
| 392 | Ga0495601_0406554 | 3300053077 | Bacteria | 882 |
| 393 | Ga0495601_0638072 | 3300053077 | Bacteria | 682 |
| 394 | Ga0495612_0008854 | 3300053078 | Bacteria | 4078 |
| 395 | Ga0495612_0025556 | 3300053078 | Bacteria | 2371 |
| 396 | Ga0495655_0035974 | 3300053083 | Bacteria | 1235 |
| 397 | Ga0495619_0106841 | 3300053085 | Bacteria | 1909 |
| 398 | Ga0500578_0042229 | 3300053086 | Bacteria | 2928 |
| 399 | Ga0500644_0024249 | 3300053088 | Bacteria | 1852 |
| 400 | Ga0500651_0098317 | 3300053093 | Bacteria | 1797 |
| 401 | Ga0500566_0013310 | 3300053094 | Bacteria | 4844 |
| 402 | Ga0500640_000618 | 3300053095 | Bacteria | 9237 |
| 403 | Ga0500641_0094591 | 3300053096 | Bacteria | 1278 |
| 404 | Ga0500654_044857 | 3300053099 | Bacteria | 2458 |
| 405 | Ga0500660_031932 | 3300053100 | Bacteria | 2742 |
| 406 | Ga0500560_034407 | 3300053107 | Bacteria | 1554 |
| 407 | Ga0500569_000761 | 3300053109 | Bacteria | 5643 |
| 408 | Ga0500572_055444 | 3300053111 | Bacteria | 1192 |
| 409 | Ga0500628_003407 | 3300053129 | Bacteria | 2626 |
| 410 | Ga0500652_002257 | 3300053131 | Bacteria | 5790 |
| 411 | Ga0500658_0004248 | 3300053134 | Bacteria | 5373 |
| 412 | Ga0500573_0475399 | 3300053140 | Bacteria | 571 |
| 413 | Ga0500579_116251 | 3300053143 | Bacteria | 1320 |
| 414 | Ga0500588_0018753 | 3300053146 | Bacteria | 1829 |
| 415 | Ga0500600_0037793 | 3300053149 | Bacteria | 2797 |
| 416 | Ga0500600_0332677 | 3300053149 | Bacteria | 634 |
| 417 | Ga0500624_019272 | 3300053157 | Bacteria | 1083 |
| 418 | Ga0500633_0019398 | 3300053160 | Bacteria | 2032 |
| 419 | Ga0500634_0008994 | 3300053161 | Bacteria | 5024 |
| 420 | Ga0500656_000575 | 3300053732 | Bacteria | 2802 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_10885209 | Ga0157375_108852092 | 125 |
| 2 | 3300037312 | Ga0395899_0048226 | Ga0395899_0048226_2376_2765 | 127 |
| 3 | 3300037418 | Ga0395900_0009595 | Ga0395900_0009595_7158_7547 | 127 |
| 4 | 3300037466 | Ga0395898_0007002 | Ga0395898_0007002_376_765 | 127 |
| 5 | 3300037471 | Ga0395905_0026494 | Ga0395905_0026494_2337_2726 | 127 |
| 6 | 3300038443 | Ga0395901_0005639 | Ga0395901_0005639_9903_10292 | 127 |
| 7 | 3300006844 | Ga0075428_100030944 | Ga0075428_1000309446 | 131 |
| 8 | 3300006880 | Ga0075429_100294820 | Ga0075429_1002948202 | 131 |
| 9 | 3300050507 | nmdc:mga05p37_39023_c1 | nmdc:mga05p37_39023_c1_2677_3147 | 131 |
| 10 | 3300050508 | nmdc:mga09592_464182_c1 | nmdc:mga09592_464182_c1_220_690 | 131 |
| 11 | 3300038698 | Ga0242419_006727 | Ga0242419_006727_294_710 | 134 |
| 12 | 3300005983 | Ga0081540_1041252 | Ga0081540_10412523 | 146 |
| 13 | 3300006844 | Ga0075428_101513712 | Ga0075428_1015137122 | 148 |
| 14 | 3300046694 | Ga0495649_0185455 | Ga0495649_0185455_618_1067 | 148 |
| 15 | 3300012513 | Ga0157326_1036387 | Ga0157326_10363871 | 149 |
| 16 | iso_pu_bacteria | 2687453737 | 2689959158 | 150 |
| 17 | iso_pu_bacteria | 2995463766 | 2995463997 | 150 |
| 18 | 3300006844 | Ga0075428_100023117 | Ga0075428_1000231174 | 151 |
| 19 | 3300009147 | Ga0114129_10028650 | Ga0114129_100286507 | 151 |
| 20 | 3300050507 | nmdc:mga05p37_24310_c1 | nmdc:mga05p37_24310_c1_143_598 | 151 |
| 21 | 3300005843 | Ga0068860_100546309 | Ga0068860_1005463092 | 152 |
| 22 | 3300005981 | Ga0081538_10050270 | Ga0081538_100502702 | 152 |
| 23 | 3300005981 | Ga0081538_10094607 | Ga0081538_100946072 | 152 |
| 24 | 3300006058 | Ga0075432_10117283 | Ga0075432_101172832 | 152 |
| 25 | 3300028381 | Ga0268264_10127020 | Ga0268264_101270202 | 152 |
| 26 | 3300028786 | Ga0307517_10022489 | Ga0307517_100224899 | 152 |
| 27 | 3300031616 | Ga0307508_10017515 | Ga0307508_100175154 | 152 |
| 28 | 3300031730 | Ga0307516_10051547 | Ga0307516_100515473 | 152 |
| 29 | 3300046460 | Ga0495638_0008656 | Ga0495638_0008656_3928_4389 | 152 |
| 30 | 3300046492 | Ga0495585_0057649 | Ga0495585_0057649_551_1012 | 152 |
| 31 | 3300046512 | Ga0495610_0105208 | Ga0495610_0105208_565_1026 | 152 |
| 32 | 3300046519 | Ga0495632_0087537 | Ga0495632_0087537_263_724 | 152 |
| 33 | 3300046522 | Ga0495643_0002710 | Ga0495643_0002710_5484_5945 | 152 |
| 34 | 3300046558 | Ga0495633_0038962 | Ga0495633_0038962_1598_2059 | 152 |
| 35 | 3300046648 | Ga0495611_0156502 | Ga0495611_0156502_169_630 | 152 |
| 36 | 3300046691 | Ga0495670_0007291 | Ga0495670_0007291_4293_4754 | 152 |
| 37 | 3300046794 | Ga0495589_0103669 | Ga0495589_0103669_129_590 | 152 |
| 38 | 3300046810 | Ga0495660_0052971 | Ga0495660_0052971_1615_2076 | 152 |
| 39 | 3300047323 | Ga0495683_0046370 | Ga0495683_0046370_642_1103 | 152 |
| 40 | 3300047443 | Ga0495687_010808 | Ga0495687_010808_2146_2607 | 152 |
| 41 | 3300047446 | Ga0495679_119150 | Ga0495679_119150_217_678 | 152 |
| 42 | 3300047447 | Ga0495685_004874 | Ga0495685_004874_2482_2943 | 152 |
| 43 | 3300047470 | Ga0495681_0016671 | Ga0495681_0016671_2641_3102 | 152 |
| 44 | 3300053083 | Ga0495655_0035974 | Ga0495655_0035974_105_566 | 152 |
| 45 | 3300053086 | Ga0500578_0042229 | Ga0500578_0042229_897_1358 | 152 |
| 46 | 3300053093 | Ga0500651_0098317 | Ga0500651_0098317_278_739 | 152 |
| 47 | 3300053096 | Ga0500641_0094591 | Ga0500641_0094591_800_1261 | 152 |
| 48 | 3300053099 | Ga0500654_044857 | Ga0500654_044857_129_590 | 152 |
| 49 | 3300053109 | Ga0500569_000761 | Ga0500569_000761_885_1346 | 152 |
| 50 | 3300053129 | Ga0500628_003407 | Ga0500628_003407_692_1153 | 152 |
| 51 | 3300053131 | Ga0500652_002257 | Ga0500652_002257_1141_1602 | 152 |
| 52 | 3300053134 | Ga0500658_0004248 | Ga0500658_0004248_697_1158 | 152 |
| 53 | 3300053143 | Ga0500579_116251 | Ga0500579_116251_213_674 | 152 |
| 54 | 3300053146 | Ga0500588_0018753 | Ga0500588_0018753_58_519 | 152 |
| 55 | 3300053149 | Ga0500600_0037793 | Ga0500600_0037793_130_591 | 152 |
| 56 | 3300053160 | Ga0500633_0019398 | Ga0500633_0019398_1443_1904 | 152 |
| 57 | 3300053161 | Ga0500634_0008994 | Ga0500634_0008994_609_1070 | 152 |
| 58 | 3300053732 | Ga0500656_000575 | Ga0500656_000575_771_1232 | 152 |
| 59 | 3300005329 | Ga0070683_101494166 | Ga0070683_1014941661 | 153 |
| 60 | 3300005338 | Ga0068868_100391807 | Ga0068868_1003918072 | 153 |
| 61 | 3300005340 | Ga0070689_100001333 | Ga0070689_10000133312 | 153 |
| 62 | 3300005356 | Ga0070674_100632206 | Ga0070674_1006322062 | 153 |
| 63 | 3300005365 | Ga0070688_100000192 | Ga0070688_10000019215 | 153 |
| 64 | 3300005438 | Ga0070701_10065076 | Ga0070701_100650762 | 153 |
| 65 | 3300005444 | Ga0070694_100028809 | Ga0070694_1000288092 | 153 |
| 66 | 3300005444 | Ga0070694_100032913 | Ga0070694_1000329133 | 153 |
| 67 | 3300005445 | Ga0070708_101473033 | Ga0070708_1014730332 | 153 |
| 68 | 3300005455 | Ga0070663_100462315 | Ga0070663_1004623151 | 153 |
| 69 | 3300005466 | Ga0070685_10001326 | Ga0070685_100013269 | 153 |
| 70 | 3300005466 | Ga0070685_10278214 | Ga0070685_102782141 | 153 |
| 71 | 3300005468 | Ga0070707_100066417 | Ga0070707_1000664172 | 153 |
| 72 | 3300005468 | Ga0070707_101269003 | Ga0070707_1012690031 | 153 |
| 73 | 3300005471 | Ga0070698_100052139 | Ga0070698_1000521395 | 153 |
| 74 | 3300005471 | Ga0070698_101272268 | Ga0070698_1012722681 | 153 |
| 75 | 3300005518 | Ga0070699_100107789 | Ga0070699_1001077892 | 153 |
| 76 | 3300005617 | Ga0068859_100026872 | Ga0068859_1000268723 | 153 |
| 77 | 3300005617 | Ga0068859_100859288 | Ga0068859_1008592882 | 153 |
| 78 | 3300005618 | Ga0068864_100018120 | Ga0068864_1000181205 | 153 |
| 79 | 3300005841 | Ga0068863_100026239 | Ga0068863_1000262393 | 153 |
| 80 | 3300005841 | Ga0068863_100055904 | Ga0068863_1000559043 | 153 |
| 81 | 3300005937 | Ga0081455_10009488 | Ga0081455_100094882 | 153 |
| 82 | 3300006163 | Ga0070715_11033879 | Ga0070715_110338791 | 153 |
| 83 | 3300006175 | Ga0070712_100159657 | Ga0070712_1001596572 | 153 |
| 84 | 3300006175 | Ga0070712_100206558 | Ga0070712_1002065582 | 153 |
| 85 | 3300006852 | Ga0075433_10018681 | Ga0075433_100186814 | 153 |
| 86 | 3300006914 | Ga0075436_100089790 | Ga0075436_1000897902 | 153 |
| 87 | 3300006914 | Ga0075436_100569682 | Ga0075436_1005696821 | 153 |
| 88 | 3300006931 | Ga0097620_100026872 | Ga0097620_1000268723 | 153 |
| 89 | 3300006931 | Ga0097620_100859241 | Ga0097620_1008592412 | 153 |
| 90 | 3300007076 | Ga0075435_100002946 | Ga0075435_1000029463 | 153 |
| 91 | 3300009094 | Ga0111539_11966757 | Ga0111539_119667571 | 153 |
| 92 | 3300009177 | Ga0105248_10114888 | Ga0105248_101148884 | 153 |
| 93 | 3300009177 | Ga0105248_11401104 | Ga0105248_114011042 | 153 |
| 94 | 3300009545 | Ga0105237_10182449 | Ga0105237_101824494 | 153 |
| 95 | 3300013306 | Ga0163162_12323859 | Ga0163162_123238591 | 153 |
| 96 | 3300013308 | Ga0157375_10211934 | Ga0157375_102119342 | 153 |
| 97 | 3300014325 | Ga0163163_11249880 | Ga0163163_112498801 | 153 |
| 98 | 3300025899 | Ga0207642_10197431 | Ga0207642_101974311 | 153 |
| 99 | 3300025905 | Ga0207685_10630309 | Ga0207685_106303091 | 153 |
| 100 | 3300025910 | Ga0207684_10207619 | Ga0207684_102076192 | 153 |
| 101 | 3300025915 | Ga0207693_10711831 | Ga0207693_107118311 | 153 |
| 102 | 3300025922 | Ga0207646_11002657 | Ga0207646_110026571 | 153 |
| 103 | 3300025936 | Ga0207670_10000241 | Ga0207670_1000024118 | 153 |
| 104 | 3300025986 | Ga0207658_10255606 | Ga0207658_102556062 | 153 |
| 105 | 3300026023 | Ga0207677_10276365 | Ga0207677_102763651 | 153 |
| 106 | 3300026067 | Ga0207678_10457612 | Ga0207678_104576121 | 153 |
| 107 | 3300026075 | Ga0207708_10220509 | Ga0207708_102205093 | 153 |
| 108 | 3300026088 | Ga0207641_10110811 | Ga0207641_101108112 | 153 |
| 109 | 3300026095 | Ga0207676_10288061 | Ga0207676_102880612 | 153 |
| 110 | 3300028380 | Ga0268265_10484026 | Ga0268265_104840262 | 153 |
| 111 | 3300031456 | Ga0307513_10616108 | Ga0307513_106161081 | 153 |
| 112 | 3300044673 | Ga0453683_0769660 | Ga0453683_0769660_131_595 | 153 |
| 113 | 3300046462 | Ga0495651_0579933 | Ga0495651_0579933_189_653 | 153 |
| 114 | 3300046559 | Ga0495667_0372549 | Ga0495667_0372549_272_736 | 153 |
| 115 | 3300047317 | Ga0495604_0307604 | Ga0495604_0307604_375_836 | 153 |
| 116 | 3300048903 | Ga0496100_0021753 | Ga0496100_0021753_1910_2371 | 153 |
| 117 | 3300048904 | Ga0496101_0034192 | Ga0496101_0034192_1495_1956 | 153 |
| 118 | 3300048905 | Ga0496102_0017562 | Ga0496102_0017562_5615_6076 | 153 |
| 119 | 3300048906 | Ga0496103_0218430 | Ga0496103_0218430_266_727 | 153 |
| 120 | 3300048907 | Ga0496104_0136162 | Ga0496104_0136162_258_722 | 153 |
| 121 | 3300048909 | Ga0496106_0017301 | Ga0496106_0017301_884_1345 | 153 |
| 122 | 3300048909 | Ga0496106_1416818 | Ga0496106_1416818_52_516 | 153 |
| 123 | 3300048910 | Ga0496107_0021520 | Ga0496107_0021520_1024_1485 | 153 |
| 124 | 3300048910 | Ga0496107_0374772 | Ga0496107_0374772_119_583 | 153 |
| 125 | 3300048911 | Ga0496108_0376491 | Ga0496108_0376491_25_489 | 153 |
| 126 | 3300048913 | Ga0496110_0216744 | Ga0496110_0216744_594_1058 | 153 |
| 127 | 3300048913 | Ga0496110_0279457 | Ga0496110_0279457_492_956 | 153 |
| 128 | 3300048915 | Ga0496112_0359900 | Ga0496112_0359900_422_886 | 153 |
| 129 | 3300048918 | Ga0496115_0136420 | Ga0496115_0136420_1189_1650 | 153 |
| 130 | 3300050511 | nmdc:mga08y16_1089530_c1 | nmdc:mga08y16_1089530_c1_96_560 | 153 |
| 131 | 3300050512 | nmdc:mga0n895_160242_c1 | nmdc:mga0n895_160242_c1_1265_1729 | 153 |
| 132 | 3300050513 | nmdc:mga0rr50_43471_c1 | nmdc:mga0rr50_43471_c1_798_1262 | 153 |
| 133 | 3300050514 | nmdc:mga08x19_307526_c1 | nmdc:mga08x19_307526_c1_85_549 | 153 |
| 134 | 3300050515 | nmdc:mga0a205_71998_c1 | nmdc:mga0a205_71998_c1_1260_1724 | 153 |
| 135 | 3300053077 | Ga0495601_0638072 | Ga0495601_0638072_106_567 | 153 |
| 136 | 3300003320 | rootH2_10008368 | rootH2_100083684 | 154 |
| 137 | 3300005334 | Ga0068869_100069257 | Ga0068869_1000692574 | 154 |
| 138 | 3300005334 | Ga0068869_100176372 | Ga0068869_1001763722 | 154 |
| 139 | 3300005337 | Ga0070682_100180970 | Ga0070682_1001809702 | 154 |
| 140 | 3300005345 | Ga0070692_10067380 | Ga0070692_100673801 | 154 |
| 141 | 3300005365 | Ga0070688_100737196 | Ga0070688_1007371962 | 154 |
| 142 | 3300005366 | Ga0070659_100241998 | Ga0070659_1002419982 | 154 |
| 143 | 3300005435 | Ga0070714_100205053 | Ga0070714_1002050533 | 154 |
| 144 | 3300005435 | Ga0070714_100233474 | Ga0070714_1002334743 | 154 |
| 145 | 3300005435 | Ga0070714_101984997 | Ga0070714_1019849971 | 154 |
| 146 | 3300005436 | Ga0070713_100779949 | Ga0070713_1007799492 | 154 |
| 147 | 3300005437 | Ga0070710_10030953 | Ga0070710_100309533 | 154 |
| 148 | 3300005438 | Ga0070701_10621929 | Ga0070701_106219291 | 154 |
| 149 | 3300005439 | Ga0070711_100339120 | Ga0070711_1003391201 | 154 |
| 150 | 3300005441 | Ga0070700_100085989 | Ga0070700_1000859892 | 154 |
| 151 | 3300005444 | Ga0070694_100503405 | Ga0070694_1005034052 | 154 |
| 152 | 3300005445 | Ga0070708_100541122 | Ga0070708_1005411222 | 154 |
| 153 | 3300005445 | Ga0070708_100921030 | Ga0070708_1009210302 | 154 |
| 154 | 3300005457 | Ga0070662_100032473 | Ga0070662_1000324733 | 154 |
| 155 | 3300005457 | Ga0070662_100388501 | Ga0070662_1003885012 | 154 |
| 156 | 3300005467 | Ga0070706_100008954 | Ga0070706_1000089542 | 154 |
| 157 | 3300005467 | Ga0070706_100013861 | Ga0070706_1000138616 | 154 |
| 158 | 3300005467 | Ga0070706_100219680 | Ga0070706_1002196802 | 154 |
| 159 | 3300005467 | Ga0070706_100512743 | Ga0070706_1005127431 | 154 |
| 160 | 3300005468 | Ga0070707_101029658 | Ga0070707_1010296582 | 154 |
| 161 | 3300005471 | Ga0070698_100003396 | Ga0070698_1000033963 | 154 |
| 162 | 3300005471 | Ga0070698_100018808 | Ga0070698_1000188082 | 154 |
| 163 | 3300005471 | Ga0070698_100080911 | Ga0070698_1000809114 | 154 |
| 164 | 3300005471 | Ga0070698_100094413 | Ga0070698_1000944132 | 154 |
| 165 | 3300005536 | Ga0070697_100270472 | Ga0070697_1002704722 | 154 |
| 166 | 3300005536 | Ga0070697_100584029 | Ga0070697_1005840292 | 154 |
| 167 | 3300005548 | Ga0070665_100645892 | Ga0070665_1006458922 | 154 |
| 168 | 3300005549 | Ga0070704_100436124 | Ga0070704_1004361242 | 154 |
| 169 | 3300005578 | Ga0068854_100328290 | Ga0068854_1003282901 | 154 |
| 170 | 3300005615 | Ga0070702_100090036 | Ga0070702_1000900362 | 154 |
| 171 | 3300005616 | Ga0068852_100052028 | Ga0068852_1000520283 | 154 |
| 172 | 3300005718 | Ga0068866_10060869 | Ga0068866_100608692 | 154 |
| 173 | 3300005719 | Ga0068861_100197149 | Ga0068861_1001971491 | 154 |
| 174 | 3300005834 | Ga0068851_10527978 | Ga0068851_105279781 | 154 |
| 175 | 3300005843 | Ga0068860_100261884 | Ga0068860_1002618843 | 154 |
| 176 | 3300005843 | Ga0068860_101354756 | Ga0068860_1013547561 | 154 |
| 177 | 3300005844 | Ga0068862_100157286 | Ga0068862_1001572862 | 154 |
| 178 | 3300005844 | Ga0068862_100759760 | Ga0068862_1007597601 | 154 |
| 179 | 3300005981 | Ga0081538_10016658 | Ga0081538_100166583 | 154 |
| 180 | 3300005981 | Ga0081538_10038103 | Ga0081538_100381032 | 154 |
| 181 | 3300005983 | Ga0081540_1000176 | Ga0081540_100017614 | 154 |
| 182 | 3300006028 | Ga0070717_10075471 | Ga0070717_100754712 | 154 |
| 183 | 3300006028 | Ga0070717_10169110 | Ga0070717_101691101 | 154 |
| 184 | 3300006028 | Ga0070717_10292494 | Ga0070717_102924942 | 154 |
| 185 | 3300006058 | Ga0075432_10002934 | Ga0075432_100029349 | 154 |
| 186 | 3300006058 | Ga0075432_10010301 | Ga0075432_100103013 | 154 |
| 187 | 3300006175 | Ga0070712_100103424 | Ga0070712_1001034244 | 154 |
| 188 | 3300006844 | Ga0075428_100016257 | Ga0075428_1000162571 | 154 |
| 189 | 3300006844 | Ga0075428_100701498 | Ga0075428_1007014983 | 154 |
| 190 | 3300006844 | Ga0075428_100790800 | Ga0075428_1007908002 | 154 |
| 191 | 3300006847 | Ga0075431_100240900 | Ga0075431_1002409003 | 154 |
| 192 | 3300006847 | Ga0075431_100611828 | Ga0075431_1006118282 | 154 |
| 193 | 3300006852 | Ga0075433_10016301 | Ga0075433_100163013 | 154 |
| 194 | 3300006852 | Ga0075433_10393094 | Ga0075433_103930942 | 154 |
| 195 | 3300006852 | Ga0075433_10506026 | Ga0075433_105060264 | 154 |
| 196 | 3300006871 | Ga0075434_100000543 | Ga0075434_10000054317 | 154 |
| 197 | 3300006871 | Ga0075434_100237465 | Ga0075434_1002374652 | 154 |
| 198 | 3300006880 | Ga0075429_100081117 | Ga0075429_1000811172 | 154 |
| 199 | 3300006881 | Ga0068865_100317182 | Ga0068865_1003171822 | 154 |
| 200 | 3300006914 | Ga0075436_100061527 | Ga0075436_1000615272 | 154 |
| 201 | 3300007076 | Ga0075435_100317391 | Ga0075435_1003173912 | 154 |
| 202 | 3300009011 | Ga0105251_10062270 | Ga0105251_100622703 | 154 |
| 203 | 3300009093 | Ga0105240_10378801 | Ga0105240_103788012 | 154 |
| 204 | 3300009093 | Ga0105240_10815076 | Ga0105240_108150763 | 154 |
| 205 | 3300009093 | Ga0105240_11404467 | Ga0105240_114044671 | 154 |
| 206 | 3300009094 | Ga0111539_10006838 | Ga0111539_1000683813 | 154 |
| 207 | 3300009094 | Ga0111539_10391051 | Ga0111539_103910512 | 154 |
| 208 | 3300009098 | Ga0105245_10076649 | Ga0105245_100766491 | 154 |
| 209 | 3300009098 | Ga0105245_10094988 | Ga0105245_100949883 | 154 |
| 210 | 3300009098 | Ga0105245_10489957 | Ga0105245_104899572 | 154 |
| 211 | 3300009147 | Ga0114129_10026678 | Ga0114129_100266784 | 154 |
| 212 | 3300009147 | Ga0114129_11683527 | Ga0114129_116835272 | 154 |
| 213 | 3300009148 | Ga0105243_10035678 | Ga0105243_100356784 | 154 |
| 214 | 3300009176 | Ga0105242_10030951 | Ga0105242_100309512 | 154 |
| 215 | 3300009176 | Ga0105242_10144842 | Ga0105242_101448422 | 154 |
| 216 | 3300009551 | Ga0105238_10352472 | Ga0105238_103524721 | 154 |
| 217 | 3300009551 | Ga0105238_11551051 | Ga0105238_115510511 | 154 |
| 218 | 3300009553 | Ga0105249_10018310 | Ga0105249_100183107 | 154 |
| 219 | 3300009553 | Ga0105249_10201587 | Ga0105249_102015872 | 154 |
| 220 | 3300009553 | Ga0105249_10335388 | Ga0105249_103353882 | 154 |
| 221 | 3300013105 | Ga0157369_10093477 | Ga0157369_100934775 | 154 |
| 222 | 3300013105 | Ga0157369_10533100 | Ga0157369_105331002 | 154 |
| 223 | 3300013105 | Ga0157369_10590552 | Ga0157369_105905521 | 154 |
| 224 | 3300013306 | Ga0163162_10140940 | Ga0163162_101409402 | 154 |
| 225 | 3300013306 | Ga0163162_10188017 | Ga0163162_101880171 | 154 |
| 226 | 3300013307 | Ga0157372_11071562 | Ga0157372_110715622 | 154 |
| 227 | 3300013308 | Ga0157375_10279946 | Ga0157375_102799462 | 154 |
| 228 | 3300014326 | Ga0157380_10112428 | Ga0157380_101124284 | 154 |
| 229 | 3300014326 | Ga0157380_10151374 | Ga0157380_101513741 | 154 |
| 230 | 3300014745 | Ga0157377_10018130 | Ga0157377_100181305 | 154 |
| 231 | 3300014968 | Ga0157379_10340484 | Ga0157379_103404842 | 154 |
| 232 | 3300017792 | Ga0163161_10439433 | Ga0163161_104394331 | 154 |
| 233 | 3300025899 | Ga0207642_10011240 | Ga0207642_100112404 | 154 |
| 234 | 3300025901 | Ga0207688_10002665 | Ga0207688_100026655 | 154 |
| 235 | 3300025901 | Ga0207688_10085006 | Ga0207688_100850061 | 154 |
| 236 | 3300025904 | Ga0207647_10045762 | Ga0207647_100457622 | 154 |
| 237 | 3300025904 | Ga0207647_10258891 | Ga0207647_102588911 | 154 |
| 238 | 3300025910 | Ga0207684_10002131 | Ga0207684_1000213111 | 154 |
| 239 | 3300025910 | Ga0207684_10718437 | Ga0207684_107184371 | 154 |
| 240 | 3300025914 | Ga0207671_10468255 | Ga0207671_104682552 | 154 |
| 241 | 3300025915 | Ga0207693_10034902 | Ga0207693_100349023 | 154 |
| 242 | 3300025915 | Ga0207693_10066396 | Ga0207693_100663964 | 154 |
| 243 | 3300025916 | Ga0207663_10133659 | Ga0207663_101336591 | 154 |
| 244 | 3300025919 | Ga0207657_10098606 | Ga0207657_100986064 | 154 |
| 245 | 3300025924 | Ga0207694_10164435 | Ga0207694_101644352 | 154 |
| 246 | 3300025924 | Ga0207694_10483817 | Ga0207694_104838172 | 154 |
| 247 | 3300025927 | Ga0207687_10613004 | Ga0207687_106130041 | 154 |
| 248 | 3300025928 | Ga0207700_10643021 | Ga0207700_106430212 | 154 |
| 249 | 3300025931 | Ga0207644_11485076 | Ga0207644_114850761 | 154 |
| 250 | 3300025932 | Ga0207690_10192143 | Ga0207690_101921431 | 154 |
| 251 | 3300025932 | Ga0207690_10209993 | Ga0207690_102099932 | 154 |
| 252 | 3300025933 | Ga0207706_10006072 | Ga0207706_100060726 | 154 |
| 253 | 3300025933 | Ga0207706_10710792 | Ga0207706_107107922 | 154 |
| 254 | 3300025935 | Ga0207709_10253723 | Ga0207709_102537232 | 154 |
| 255 | 3300025937 | Ga0207669_10221547 | Ga0207669_102215472 | 154 |
| 256 | 3300025942 | Ga0207689_10048210 | Ga0207689_100482105 | 154 |
| 257 | 3300025942 | Ga0207689_10147398 | Ga0207689_101473984 | 154 |
| 258 | 3300025944 | Ga0207661_10317603 | Ga0207661_103176033 | 154 |
| 259 | 3300025972 | Ga0207668_10186433 | Ga0207668_101864332 | 154 |
| 260 | 3300025981 | Ga0207640_10173959 | Ga0207640_101739592 | 154 |
| 261 | 3300025981 | Ga0207640_10396181 | Ga0207640_103961811 | 154 |
| 262 | 3300026023 | Ga0207677_10246522 | Ga0207677_102465221 | 154 |
| 263 | 3300026023 | Ga0207677_10310474 | Ga0207677_103104742 | 154 |
| 264 | 3300026075 | Ga0207708_10128323 | Ga0207708_101283233 | 154 |
| 265 | 3300026075 | Ga0207708_10853345 | Ga0207708_108533451 | 154 |
| 266 | 3300026089 | Ga0207648_10048563 | Ga0207648_100485635 | 154 |
| 267 | 3300026118 | Ga0207675_100016061 | Ga0207675_1000160615 | 154 |
| 268 | 3300026118 | Ga0207675_100270798 | Ga0207675_1002707982 | 154 |
| 269 | 3300026142 | Ga0207698_10042816 | Ga0207698_100428164 | 154 |
| 270 | 3300026142 | Ga0207698_10961840 | Ga0207698_109618402 | 154 |
| 271 | 3300027907 | Ga0207428_10006357 | Ga0207428_100063577 | 154 |
| 272 | 3300027907 | Ga0207428_10053101 | Ga0207428_100531015 | 154 |
| 273 | 3300028379 | Ga0268266_10438152 | Ga0268266_104381522 | 154 |
| 274 | 3300028380 | Ga0268265_10042418 | Ga0268265_100424184 | 154 |
| 275 | 3300028380 | Ga0268265_10547420 | Ga0268265_105474202 | 154 |
| 276 | 3300028786 | Ga0307517_10338040 | Ga0307517_103380402 | 154 |
| 277 | 3300030521 | Ga0307511_10002051 | Ga0307511_100020514 | 154 |
| 278 | 3300030522 | Ga0307512_10001704 | Ga0307512_1000170425 | 154 |
| 279 | 3300031507 | Ga0307509_10007222 | Ga0307509_100072224 | 154 |
| 280 | 3300031507 | Ga0307509_10021254 | Ga0307509_100212548 | 154 |
| 281 | 3300031616 | Ga0307508_10223267 | Ga0307508_102232672 | 154 |
| 282 | 3300031649 | Ga0307514_10003655 | Ga0307514_100036558 | 154 |
| 283 | 3300031730 | Ga0307516_10009394 | Ga0307516_100093945 | 154 |
| 284 | 3300031730 | Ga0307516_10077314 | Ga0307516_100773144 | 154 |
| 285 | 3300031838 | Ga0307518_10036585 | Ga0307518_100365852 | 154 |
| 286 | 3300031838 | Ga0307518_10113616 | Ga0307518_101136163 | 154 |
| 287 | 3300033179 | Ga0307507_10005887 | Ga0307507_1000588710 | 154 |
| 288 | 3300033180 | Ga0307510_10033747 | Ga0307510_100337473 | 154 |
| 289 | 3300033544 | Ga0316215_1021706 | Ga0316215_10217062 | 154 |
| 290 | 3300035691 | Ga0373931_0710868 | Ga0373931_0710868_88_555 | 154 |
| 291 | 3300037068 | Ga0373925_0000072 | Ga0373925_0000072_12137_12604 | 154 |
| 292 | 3300046454 | Ga0495592_0001777 | Ga0495592_0001777_9115_9582 | 154 |
| 293 | 3300046454 | Ga0495592_0094619 | Ga0495592_0094619_1611_2078 | 154 |
| 294 | 3300046459 | Ga0495629_0020104 | Ga0495629_0020104_1683_2150 | 154 |
| 295 | 3300046460 | Ga0495638_0153269 | Ga0495638_0153269_580_1047 | 154 |
| 296 | 3300046462 | Ga0495651_0011552 | Ga0495651_0011552_818_1285 | 154 |
| 297 | 3300046473 | Ga0495582_0029969 | Ga0495582_0029969_2473_2940 | 154 |
| 298 | 3300046474 | Ga0495605_0115413 | Ga0495605_0115413_35_499 | 154 |
| 299 | 3300046476 | Ga0495662_0002022 | Ga0495662_0002022_3226_3693 | 154 |
| 300 | 3300046477 | Ga0495664_0007333 | Ga0495664_0007333_3038_3505 | 154 |
| 301 | 3300046499 | Ga0495594_0035749 | Ga0495594_0035749_372_839 | 154 |
| 302 | 3300046514 | Ga0495618_0125571 | Ga0495618_0125571_226_693 | 154 |
| 303 | 3300046516 | Ga0495628_0200569 | Ga0495628_0200569_149_616 | 154 |
| 304 | 3300046517 | Ga0495630_0129259 | Ga0495630_0129259_1080_1547 | 154 |
| 305 | 3300046529 | Ga0495652_0009693 | Ga0495652_0009693_123_590 | 154 |
| 306 | 3300046529 | Ga0495652_0079892 | Ga0495652_0079892_1730_2197 | 154 |
| 307 | 3300046533 | Ga0495640_0013845 | Ga0495640_0013845_5582_6049 | 154 |
| 308 | 3300046533 | Ga0495640_0107176 | Ga0495640_0107176_1031_1498 | 154 |
| 309 | 3300046535 | Ga0495586_0131059 | Ga0495586_0131059_113_580 | 154 |
| 310 | 3300046543 | Ga0495645_0037549 | Ga0495645_0037549_314_781 | 154 |
| 311 | 3300046543 | Ga0495645_0138536 | Ga0495645_0138536_510_977 | 154 |
| 312 | 3300046557 | Ga0495622_0144369 | Ga0495622_0144369_456_923 | 154 |
| 313 | 3300046615 | Ga0495656_0110102 | Ga0495656_0110102_264_731 | 154 |
| 314 | 3300046642 | Ga0495634_0003255 | Ga0495634_0003255_8118_8585 | 154 |
| 315 | 3300046660 | Ga0495625_0666086 | Ga0495625_0666086_44_511 | 154 |
| 316 | 3300046663 | Ga0495635_0001628 | Ga0495635_0001628_11330_11797 | 154 |
| 317 | 3300046674 | Ga0495588_0291663 | Ga0495588_0291663_14_481 | 154 |
| 318 | 3300046675 | Ga0495657_0000602 | Ga0495657_0000602_17554_18021 | 154 |
| 319 | 3300046689 | Ga0495613_0000692 | Ga0495613_0000692_12883_13350 | 154 |
| 320 | 3300046689 | Ga0495613_0755790 | Ga0495613_0755790_131_616 | 154 |
| 321 | 3300046690 | Ga0495624_0501525 | Ga0495624_0501525_156_623 | 154 |
| 322 | 3300046691 | Ga0495670_0736390 | Ga0495670_0736390_60_527 | 154 |
| 323 | 3300046692 | Ga0495671_0130336 | Ga0495671_0130336_103_570 | 154 |
| 324 | 3300046809 | Ga0495600_0004965 | Ga0495600_0004965_2354_2821 | 154 |
| 325 | 3300046809 | Ga0495600_0023860 | Ga0495600_0023860_2209_2676 | 154 |
| 326 | 3300047315 | Ga0495581_0021503 | Ga0495581_0021503_3080_3547 | 154 |
| 327 | 3300047317 | Ga0495604_0000721 | Ga0495604_0000721_3820_4287 | 154 |
| 328 | 3300047317 | Ga0495604_0401219 | Ga0495604_0401219_100_567 | 154 |
| 329 | 3300047318 | Ga0495636_0445066 | Ga0495636_0445066_76_558 | 154 |
| 330 | 3300047319 | Ga0495674_0523691 | Ga0495674_0523691_265_732 | 154 |
| 331 | 3300047321 | Ga0495676_0008112 | Ga0495676_0008112_116_583 | 154 |
| 332 | 3300047322 | Ga0495680_0871997 | Ga0495680_0871997_54_521 | 154 |
| 333 | 3300047443 | Ga0495687_002793 | Ga0495687_002793_12976_13443 | 154 |
| 334 | 3300047443 | Ga0495687_024353 | Ga0495687_024353_1861_2328 | 154 |
| 335 | 3300047443 | Ga0495687_032747 | Ga0495687_032747_1719_2186 | 154 |
| 336 | 3300047443 | Ga0495687_035134 | Ga0495687_035134_232_699 | 154 |
| 337 | 3300047471 | Ga0495684_0055074 | Ga0495684_0055074_373_840 | 154 |
| 338 | 3300047472 | Ga0495686_0078652 | Ga0495686_0078652_186_653 | 154 |
| 339 | 3300047673 | Ga0495593_0084782 | Ga0495593_0084782_977_1444 | 154 |
| 340 | 3300048088 | Ga0495602_0043267 | Ga0495602_0043267_2687_3154 | 154 |
| 341 | 3300048089 | Ga0495614_0011944 | Ga0495614_0011944_1232_1699 | 154 |
| 342 | 3300048904 | Ga0496101_0440795 | Ga0496101_0440795_27_503 | 154 |
| 343 | 3300048910 | Ga0496107_0537772 | Ga0496107_0537772_192_668 | 154 |
| 344 | 3300048911 | Ga0496108_0485737 | Ga0496108_0485737_459_926 | 154 |
| 345 | 3300048913 | Ga0496110_0264985 | Ga0496110_0264985_1058_1525 | 154 |
| 346 | 3300048914 | Ga0496111_0513917 | Ga0496111_0513917_253_720 | 154 |
| 347 | 3300049572 | Ga0501036_1114720 | Ga0501036_1114720_25_492 | 154 |
| 348 | 3300050507 | nmdc:mga05p37_381041_c1 | nmdc:mga05p37_381041_c1_451_918 | 154 |
| 349 | 3300050508 | nmdc:mga09592_93609_c1 | nmdc:mga09592_93609_c1_986_1453 | 154 |
| 350 | 3300050509 | nmdc:mga0qj67_789811_c1 | nmdc:mga0qj67_789811_c1_81_548 | 154 |
| 351 | 3300050510 | nmdc:mga06r32_23642_c1 | nmdc:mga06r32_23642_c1_270_737 | 154 |
| 352 | 3300050510 | nmdc:mga06r32_42926_c1 | nmdc:mga06r32_42926_c1_610_1086 | 154 |
| 353 | 3300050511 | nmdc:mga08y16_21113_c1 | nmdc:mga08y16_21113_c1_1769_2236 | 154 |
| 354 | 3300050511 | nmdc:mga08y16_57914_c1 | nmdc:mga08y16_57914_c1_857_1324 | 154 |
| 355 | 3300050512 | nmdc:mga0n895_117441_c1 | nmdc:mga0n895_117441_c1_730_1197 | 154 |
| 356 | 3300050512 | nmdc:mga0n895_53772_c1 | nmdc:mga0n895_53772_c1_1712_2179 | 154 |
| 357 | 3300050513 | nmdc:mga0rr50_66750_c1 | nmdc:mga0rr50_66750_c1_1744_2211 | 154 |
| 358 | 3300050514 | nmdc:mga08x19_41666_c1 | nmdc:mga08x19_41666_c1_1189_1656 | 154 |
| 359 | 3300050515 | nmdc:mga0a205_32448_c1 | nmdc:mga0a205_32448_c1_1187_1654 | 154 |
| 360 | 3300050515 | nmdc:mga0a205_40101_c1 | nmdc:mga0a205_40101_c1_1590_2057 | 154 |
| 361 | 3300053077 | Ga0495601_0406554 | Ga0495601_0406554_164_640 | 154 |
| 362 | 3300053078 | Ga0495612_0008854 | Ga0495612_0008854_3253_3720 | 154 |
| 363 | 3300053078 | Ga0495612_0025556 | Ga0495612_0025556_183_650 | 154 |
| 364 | 3300053085 | Ga0495619_0106841 | Ga0495619_0106841_667_1134 | 154 |
| 365 | 3300053088 | Ga0500644_0024249 | Ga0500644_0024249_305_772 | 154 |
| 366 | 3300053095 | Ga0500640_000618 | Ga0500640_000618_5090_5557 | 154 |
| 367 | 3300053100 | Ga0500660_031932 | Ga0500660_031932_356_823 | 154 |
| 368 | 3300053107 | Ga0500560_034407 | Ga0500560_034407_769_1236 | 154 |
| 369 | 3300053111 | Ga0500572_055444 | Ga0500572_055444_29_496 | 154 |
| 370 | 3300053140 | Ga0500573_0475399 | Ga0500573_0475399_22_489 | 154 |
| 371 | 3300053149 | Ga0500600_0332677 | Ga0500600_0332677_77_544 | 154 |
| 372 | 3300053157 | Ga0500624_019272 | Ga0500624_019272_525_992 | 154 |
| 373 | 3300028786 | Ga0307517_10025008 | Ga0307517_100250085 | 155 |
| 374 | 3300028794 | Ga0307515_10000106 | Ga0307515_1000010668 | 155 |
| 375 | 3300030522 | Ga0307512_10099218 | Ga0307512_100992183 | 155 |
| 376 | 3300031616 | Ga0307508_10040870 | Ga0307508_100408702 | 155 |
| 377 | 3300033179 | Ga0307507_10005664 | Ga0307507_100056644 | 155 |
| 378 | 3300033180 | Ga0307510_10039953 | Ga0307510_100399533 | 155 |
| 379 | 3300046459 | Ga0495629_0007584 | Ga0495629_0007584_3202_3672 | 155 |
| 380 | 3300046660 | Ga0495625_0007997 | Ga0495625_0007997_6904_7374 | 155 |
| 381 | 3300046674 | Ga0495588_0015190 | Ga0495588_0015190_2631_3101 | 155 |
| 382 | 3300046689 | Ga0495613_0569370 | Ga0495613_0569370_96_566 | 155 |
| 383 | 3300047470 | Ga0495681_0003170 | Ga0495681_0003170_10551_11021 | 155 |
| 384 | 3300048089 | Ga0495614_0026727 | Ga0495614_0026727_353_823 | 155 |
| 385 | 3300046536 | Ga0495587_0077146 | Ga0495587_0077146_947_1429 | 159 |
| 386 | 3300046543 | Ga0495645_0101419 | Ga0495645_0101419_126_608 | 159 |
| 387 | 3300046680 | Ga0495646_0025311 | Ga0495646_0025311_1421_1903 | 159 |
| 388 | 3300048088 | Ga0495602_0200667 | Ga0495602_0200667_878_1360 | 159 |
| 389 | 3300049570 | Ga0501033_0447490 | Ga0501033_0447490_311_808 | 159 |
| 390 | 3300049571 | Ga0501034_0379603 | Ga0501034_0379603_19_516 | 159 |
| 391 | 3300049574 | Ga0501038_0252268 | Ga0501038_0252268_442_939 | 159 |
| 392 | 3300049575 | Ga0501039_0470204 | Ga0501039_0470204_388_885 | 159 |
| 393 | 3300049579 | Ga0501043_0223061 | Ga0501043_0223061_921_1418 | 159 |
| 394 | 3300049581 | Ga0501047_0451781 | Ga0501047_0451781_438_935 | 159 |
| 395 | 3300053077 | Ga0495601_0038766 | Ga0495601_0038766_1494_1976 | 159 |
| 396 | 3300049581 | Ga0501047_0210835 | Ga0501047_0210835_759_1256 | 164 |
| 397 | 3300053094 | Ga0500566_0013310 | Ga0500566_0013310_1474_2010 | 169 |
| 398 | 3300046462 | Ga0495651_0001296 | Ga0495651_0001296_4677_5222 | 172 |
| 399 | 3300046463 | Ga0495653_0024752 | Ga0495653_0024752_3754_4299 | 172 |
| 400 | 3300046472 | Ga0495580_0027166 | Ga0495580_0027166_677_1222 | 172 |
| 401 | 3300046476 | Ga0495662_0015633 | Ga0495662_0015633_1048_1593 | 172 |
| 402 | 3300046477 | Ga0495664_0003989 | Ga0495664_0003989_6415_6960 | 172 |
| 403 | 3300046511 | Ga0495608_0000621 | Ga0495608_0000621_19390_19935 | 172 |
| 404 | 3300046516 | Ga0495628_0004128 | Ga0495628_0004128_10368_10913 | 172 |
| 405 | 3300046526 | Ga0495666_0001188 | Ga0495666_0001188_5582_6127 | 172 |
| 406 | 3300046531 | Ga0495665_0002856 | Ga0495665_0002856_4169_4714 | 172 |
| 407 | 3300046543 | Ga0495645_0125708 | Ga0495645_0125708_409_954 | 172 |
| 408 | 3300046559 | Ga0495667_0043697 | Ga0495667_0043697_334_879 | 172 |
| 409 | 3300046675 | Ga0495657_0004402 | Ga0495657_0004402_4357_4902 | 172 |
| 410 | 3300046680 | Ga0495646_0067830 | Ga0495646_0067830_1176_1721 | 172 |
| 411 | 3300046689 | Ga0495613_0073271 | Ga0495613_0073271_1896_2441 | 172 |
| 412 | 3300047315 | Ga0495581_0005346 | Ga0495581_0005346_1740_2285 | 172 |
| 413 | 3300047317 | Ga0495604_0000491 | Ga0495604_0000491_5279_5824 | 172 |
| 414 | 3300047444 | Ga0495675_0014341 | Ga0495675_0014341_184_729 | 172 |
| 415 | 3300047471 | Ga0495684_0258002 | Ga0495684_0258002_334_879 | 172 |
| 416 | 3300053077 | Ga0495601_0004917 | Ga0495601_0004917_4157_4702 | 172 |
| 417 | 3300002705 | JGI25156J39149_1008326 | JGI25156J39149_10083262 | 176 |
| 418 | 3300003761 | Ga0055535_1000056 | Ga0055535_100005677 | 176 |
| 419 | 3300003763 | Ga0055529_1000165 | Ga0055529_100016530 | 176 |
| 420 | 3300025242 | Ga0209258_100071 | Ga0209258_10007146 | 176 |
| 421 | 3300025256 | Ga0209759_1000525 | Ga0209759_100052522 | 176 |
| 422 | 3300025272 | Ga0209455_1000030 | Ga0209455_1000030225 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2chc-assembly1.cif.gz_A | structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis | 0.8783 | 31 | 167 |
| 3a76-assembly1.cif.gz_A | the crystal structure of lina | 0.8754 | 31 | 169 |
| 1ask-assembly1.cif.gz_B | nuclear transport factor 2 (ntf2) h66a mutant | 0.8747 | 28 | 168 |
| 3rob-assembly2.cif.gz_D | the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 | 0.8698 | 33 | 166 |
| 3ef8-assembly1.cif.gz_A | crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution | 0.8685 | 31 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2chcB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8811 | 32 | 167 | 3.10.450.50 |
| 3a76A01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8754 | 31 | 169 | 3.10.450.50 |
| 4lehA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8586 | 31 | 176 | 3.10.450.50 |
| 3robD00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8585 | 33 | 166 | 3.10.450.50 |
| af_P9WL25_11_145_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8356 | 29 | 170 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I0S4B8-F1-model_v4 | SnoaL-like domain-containing protein | 0.9843 | 31 | 172 |
|
| AF-A0A1M5PRG7-F1-model_v4 | NADPH-dependent curcumin reductase CurA | 0.9825 | 26 | 176 |
GO:0016628
|
| AF-A0A191TPE1-F1-model_v4 | SnoaL-like domain-containing protein | 0.982 | 34 | 176 |
|
| AF-A0A3T1DBT6-F1-model_v4 | SnoaL-like domain-containing protein | 0.977 | 28 | 176 |
|
| AF-A0A191TPE1-F1-model_v4 | SnoaL-like domain-containing protein | 0.9683 | 34 | 176 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar