F440356

General Info

Members Datasets Scaffolds Average Seq Length
422 258 420 156

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0001296|Ga0495651_0001296_4677_5222
Length 181
Sequence MQTASCYRRKQALAPAPTALGTKGAIMPSHAPLSPQEAADRLAIRELIDAYAHCADRRDAKGQMALFTEDTRFLVFMDATAAEPTQELRGRDSLAPVFDNLNSYKVTTHFNGESTVSLDGDRASGESYCLAHHVSFGTDAERTIMIASIRYLDEFVKQDGEWLFAERRLMVDWTETRPCVP

Samples

Sample ID Description Type Environment
1 2687453737 Frankia sp. BMG5.36 Isolate Nodule
2 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
244 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
245 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
246 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
247 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
248 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
252 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
253 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
254 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
255 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
256 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
257 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
258 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 0.24
Rhizoplane 4.5
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1008326 3300002705 Unclassified 2623
2 rootH2_10008368 3300003320 Bacteria 5278
3 Ga0055535_1000056 3300003761 Bacteria 128204
4 Ga0055529_1000165 3300003763 Bacteria 91442
5 Ga0070683_101494166 3300005329 Bacteria 649
6 Ga0068869_100069257 3300005334 Bacteria 2608
7 Ga0068869_100176372 3300005334 Bacteria 1673
8 Ga0070682_100180970 3300005337 Bacteria 1472
9 Ga0068868_100391807 3300005338 Bacteria 1197
10 Ga0070689_100001333 3300005340 Bacteria 15704
11 Ga0070692_10067380 3300005345 Bacteria 1900
12 Ga0070674_100632206 3300005356 Bacteria 908
13 Ga0070688_100000192 3300005365 Bacteria 32260
14 Ga0070688_100737196 3300005365 Unclassified 766
15 Ga0070659_100241998 3300005366 Bacteria 1493
16 Ga0070714_100205053 3300005435 Bacteria 1805
17 Ga0070714_100233474 3300005435 Bacteria 1695
18 Ga0070714_101984997 3300005435 Unclassified 567
19 Ga0070713_100779949 3300005436 Unclassified 915
20 Ga0070710_10030953 3300005437 Bacteria 2884
21 Ga0070701_10065076 3300005438 Bacteria 1934
22 Ga0070701_10621929 3300005438 Unclassified 718
23 Ga0070711_100339120 3300005439 Bacteria 1205
24 Ga0070700_100085989 3300005441 Bacteria 2041
25 Ga0070694_100028809 3300005444 Bacteria 3618
26 Ga0070694_100032913 3300005444 Bacteria 3406
27 Ga0070694_100503405 3300005444 Bacteria 964
28 Ga0070708_100541122 3300005445 Bacteria 1099
29 Ga0070708_100921030 3300005445 Bacteria 820
30 Ga0070708_101473033 3300005445 Bacteria 634
31 Ga0070663_100462315 3300005455 Bacteria 1048
32 Ga0070662_100032473 3300005457 Bacteria 3669
33 Ga0070662_100388501 3300005457 Unclassified 1150
34 Ga0070685_10001326 3300005466 Bacteria 12999
35 Ga0070685_10278214 3300005466 Bacteria 1119
36 Ga0070706_100008954 3300005467 Bacteria 9320
37 Ga0070706_100013861 3300005467 Bacteria 7454
38 Ga0070706_100219680 3300005467 Bacteria 1774
39 Ga0070706_100512743 3300005467 Bacteria 1115
40 Ga0070707_100066417 3300005468 Bacteria 3466
41 Ga0070707_101029658 3300005468 Bacteria 789
42 Ga0070707_101269003 3300005468 Bacteria 703
43 Ga0070698_100003396 3300005471 Bacteria 17512
44 Ga0070698_100018808 3300005471 Bacteria 7269
45 Ga0070698_100052139 3300005471 Plasmid 4164
46 Ga0070698_100080911 3300005471 Bacteria 3243
47 Ga0070698_100094413 3300005471 Bacteria 2970
48 Ga0070698_101272268 3300005471 Bacteria 685
49 Ga0070699_100107789 3300005518 Bacteria 2444
50 Ga0070697_100270472 3300005536 Bacteria 1456
51 Ga0070697_100584029 3300005536 Bacteria 981
52 Ga0070665_100645892 3300005548 Bacteria 1071
53 Ga0070704_100436124 3300005549 Unclassified 1125
54 Ga0068854_100328290 3300005578 Unclassified 1246
55 Ga0070702_100090036 3300005615 Bacteria 1859
56 Ga0068852_100052028 3300005616 Bacteria 3518
57 Ga0068859_100026872 3300005617 Bacteria 5773
58 Ga0068859_100859288 3300005617 Bacteria 993
59 Ga0068864_100018120 3300005618 Bacteria 5877
60 Ga0068866_10060869 3300005718 Bacteria 1959
61 Ga0068861_100197149 3300005719 Bacteria 1687
62 Ga0068851_10527978 3300005834 Bacteria 711
63 Ga0068863_100026239 3300005841 Bacteria 5560
64 Ga0068863_100055904 3300005841 Bacteria 3737
65 Ga0068860_100261884 3300005843 Bacteria 1686
66 Ga0068860_100546309 3300005843 Unclassified 1160
67 Ga0068860_101354756 3300005843 Bacteria 733
68 Ga0068862_100157286 3300005844 Bacteria 2026
69 Ga0068862_100759760 3300005844 Bacteria 944
70 Ga0081455_10009488 3300005937 Bacteria 10004
71 Ga0081538_10016658 3300005981 Bacteria 5622
72 Ga0081538_10038103 3300005981 Bacteria 3107
73 Ga0081538_10050270 3300005981 Bacteria 2519
74 Ga0081538_10094607 3300005981 Unclassified 1529
75 Ga0081540_1000176 3300005983 Bacteria 67057
76 Ga0081540_1041252 3300005983 Unclassified 2395
77 Ga0070717_10075471 3300006028 Bacteria 2820
78 Ga0070717_10169110 3300006028 Bacteria 1900
79 Ga0070717_10292494 3300006028 Bacteria 1446
80 Ga0075432_10002934 3300006058 Bacteria 5739
81 Ga0075432_10010301 3300006058 Bacteria 3170
82 Ga0075432_10117283 3300006058 Bacteria 997
83 Ga0070715_11033879 3300006163 Unclassified 514
84 Ga0070712_100103424 3300006175 Bacteria 2111
85 Ga0070712_100159657 3300006175 Bacteria 1740
86 Ga0070712_100206558 3300006175 Bacteria 1546
87 Ga0075428_100016257 3300006844 Bacteria 8225
88 Ga0075428_100023117 3300006844 Bacteria 6877
89 Ga0075428_100030944 3300006844 Bacteria 5918
90 Ga0075428_100701498 3300006844 Bacteria 1078
91 Ga0075428_100790800 3300006844 Bacteria 1009
92 Ga0075428_101513712 3300006844 Bacteria 703
93 Ga0075431_100240900 3300006847 Bacteria 1840
94 Ga0075431_100611828 3300006847 Bacteria 1073
95 Ga0075433_10016301 3300006852 Bacteria 6117
96 Ga0075433_10018681 3300006852 Bacteria 5765
97 Ga0075433_10393094 3300006852 Bacteria 1224
98 Ga0075433_10506026 3300006852 Bacteria 1063
99 Ga0075434_100000543 3300006871 Bacteria 28760
100 Ga0075434_100237465 3300006871 Bacteria 1842
101 Ga0075429_100081117 3300006880 Bacteria 2828
102 Ga0075429_100294820 3300006880 Unclassified 1420
103 Ga0068865_100317182 3300006881 Bacteria 1252
104 Ga0075436_100061527 3300006914 Bacteria 2593
105 Ga0075436_100089790 3300006914 Unclassified 2135
106 Ga0075436_100569682 3300006914 Bacteria 832
107 Ga0097620_100026872 3300006931 Bacteria 5773
108 Ga0097620_100859241 3300006931 Bacteria 993
109 Ga0075435_100002946 3300007076 Bacteria 11443
110 Ga0075435_100317391 3300007076 Bacteria 1333
111 Ga0105251_10062270 3300009011 Bacteria 1752
112 Ga0105240_10378801 3300009093 Bacteria 1598
113 Ga0105240_10815076 3300009093 Unclassified 1010
114 Ga0105240_11404467 3300009093 Bacteria 734
115 Ga0111539_10006838 3300009094 Bacteria 14655
116 Ga0111539_10391051 3300009094 Bacteria 1619
117 Ga0111539_11966757 3300009094 Bacteria 678
118 Ga0105245_10076649 3300009098 Bacteria 3046
119 Ga0105245_10094988 3300009098 Bacteria 2749
120 Ga0105245_10489957 3300009098 Bacteria 1244
121 Ga0114129_10026678 3300009147 Bacteria 8182
122 Ga0114129_10028650 3300009147 Bacteria 7890
123 Ga0114129_11683527 3300009147 Bacteria 774
124 Ga0105243_10035678 3300009148 Bacteria 3855
125 Ga0105242_10030951 3300009176 Bacteria 4274
126 Ga0105242_10144842 3300009176 Bacteria 2066
127 Ga0105248_10114888 3300009177 Bacteria 3036
128 Ga0105248_11401104 3300009177 Bacteria 791
129 Ga0105237_10182449 3300009545 Bacteria 2099
130 Ga0105238_10352472 3300009551 Bacteria 1461
131 Ga0105238_11551051 3300009551 Unclassified 692
132 Ga0105249_10018310 3300009553 Bacteria 6227
133 Ga0105249_10201587 3300009553 Bacteria 1947
134 Ga0105249_10335388 3300009553 Bacteria 1527
135 Ga0157326_1036387 3300012513 Bacteria 674
136 Ga0157369_10093477 3300013105 Bacteria 3210
137 Ga0157369_10533100 3300013105 Bacteria 1214
138 Ga0157369_10590552 3300013105 Bacteria 1147
139 Ga0163162_10140940 3300013306 Bacteria 2524
140 Ga0163162_10188017 3300013306 Bacteria 2192
141 Ga0163162_12323859 3300013306 Unclassified 616
142 Ga0157372_11071562 3300013307 Unclassified 933
143 Ga0157375_10211934 3300013308 Bacteria 2095
144 Ga0157375_10279946 3300013308 Bacteria 1831
145 Ga0157375_10885209 3300013308 Bacteria 1038
146 Ga0163163_11249880 3300014325 Unclassified 805
147 Ga0157380_10112428 3300014326 Bacteria 2291
148 Ga0157380_10151374 3300014326 Bacteria 2006
149 Ga0157377_10018130 3300014745 Bacteria 3655
150 Ga0157379_10340484 3300014968 Unclassified 1372
151 Ga0163161_10439433 3300017792 Bacteria 1053
152 Ga0209258_100071 3300025242 Bacteria 278319
153 Ga0209759_1000525 3300025256 Bacteria 40745
154 Ga0209455_1000030 3300025272 Bacteria 533479
155 Ga0207642_10011240 3300025899 Bacteria 3186
156 Ga0207642_10197431 3300025899 Bacteria 1109
157 Ga0207688_10002665 3300025901 Bacteria 9667
158 Ga0207688_10085006 3300025901 Bacteria 1812
159 Ga0207647_10045762 3300025904 Bacteria 2729
160 Ga0207647_10258891 3300025904 Bacteria 997
161 Ga0207685_10630309 3300025905 Unclassified 578
162 Ga0207684_10002131 3300025910 Bacteria 20280
163 Ga0207684_10207619 3300025910 Bacteria 1690
164 Ga0207684_10718437 3300025910 Unclassified 848
165 Ga0207671_10468255 3300025914 Bacteria 1004
166 Ga0207693_10034902 3300025915 Bacteria 3967
167 Ga0207693_10066396 3300025915 Bacteria 2824
168 Ga0207693_10711831 3300025915 Bacteria 777
169 Ga0207663_10133659 3300025916 Bacteria 1718
170 Ga0207657_10098606 3300025919 Bacteria 2428
171 Ga0207646_11002657 3300025922 Bacteria 738
172 Ga0207694_10164435 3300025924 Bacteria 1794
173 Ga0207694_10483817 3300025924 Bacteria 1035
174 Ga0207687_10613004 3300025927 Bacteria 918
175 Ga0207700_10643021 3300025928 Unclassified 945
176 Ga0207644_11485076 3300025931 Bacteria 569
177 Ga0207690_10192143 3300025932 Bacteria 1544
178 Ga0207690_10209993 3300025932 Unclassified 1484
179 Ga0207706_10006072 3300025933 Bacteria 11225
180 Ga0207706_10710792 3300025933 Unclassified 858
181 Ga0207709_10253723 3300025935 Bacteria 1286
182 Ga0207670_10000241 3300025936 Bacteria 34491
183 Ga0207669_10221547 3300025937 Bacteria 1389
184 Ga0207689_10048210 3300025942 Bacteria 3514
185 Ga0207689_10147398 3300025942 Bacteria 1939
186 Ga0207661_10317603 3300025944 Bacteria 1400
187 Ga0207668_10186433 3300025972 Bacteria 1641
188 Ga0207640_10173959 3300025981 Bacteria 1607
189 Ga0207640_10396181 3300025981 Bacteria 1123
190 Ga0207658_10255606 3300025986 Bacteria 1491
191 Ga0207677_10246522 3300026023 Bacteria 1448
192 Ga0207677_10276365 3300026023 Bacteria 1377
193 Ga0207677_10310474 3300026023 Bacteria 1306
194 Ga0207678_10457612 3300026067 Bacteria 1110
195 Ga0207708_10128323 3300026075 Bacteria 1981
196 Ga0207708_10220509 3300026075 Bacteria 1519
197 Ga0207708_10853345 3300026075 Bacteria 786
198 Ga0207641_10110811 3300026088 Bacteria 2433
199 Ga0207648_10048563 3300026089 Bacteria 3715
200 Ga0207676_10288061 3300026095 Bacteria 1494
201 Ga0207675_100016061 3300026118 Bacteria 6990
202 Ga0207675_100270798 3300026118 Bacteria 1648
203 Ga0207698_10042816 3300026142 Bacteria 3387
204 Ga0207698_10961840 3300026142 Bacteria 863
205 Ga0207428_10006357 3300027907 Bacteria 10927
206 Ga0207428_10053101 3300027907 Bacteria 3233
207 Ga0268266_10438152 3300028379 Bacteria 1241
208 Ga0268265_10042418 3300028380 Bacteria 3376
209 Ga0268265_10484026 3300028380 Bacteria 1163
210 Ga0268265_10547420 3300028380 Bacteria 1098
211 Ga0268264_10127020 3300028381 Bacteria 2255
212 Ga0307517_10022489 3300028786 Bacteria 7895
213 Ga0307517_10025008 3300028786 Bacteria 7328
214 Ga0307517_10338040 3300028786 Bacteria 824
215 Ga0307515_10000106 3300028794 Bacteria 197218
216 Ga0307511_10002051 3300030521 Bacteria 21091
217 Ga0307512_10001704 3300030522 Bacteria 30048
218 Ga0307512_10099218 3300030522 Bacteria 1983
219 Ga0307513_10616108 3300031456 Bacteria 794
220 Ga0307509_10007222 3300031507 Bacteria 14623
221 Ga0307509_10021254 3300031507 Bacteria 7343
222 Ga0307508_10017515 3300031616 Bacteria 6512
223 Ga0307508_10040870 3300031616 Bacteria 4163
224 Ga0307508_10223267 3300031616 Bacteria 1483
225 Ga0307514_10003655 3300031649 Bacteria 14595
226 Ga0307516_10009394 3300031730 Bacteria 10908
227 Ga0307516_10051547 3300031730 Bacteria 4033
228 Ga0307516_10077314 3300031730 Bacteria 3177
229 Ga0307518_10036585 3300031838 Bacteria 3568
230 Ga0307518_10113616 3300031838 Bacteria 1926
231 Ga0307507_10005664 3300033179 Bacteria 20263
232 Ga0307507_10005887 3300033179 Bacteria 19529
233 Ga0307510_10033747 3300033180 Bacteria 5742
234 Ga0307510_10039953 3300033180 Bacteria 5159
235 Ga0316215_1021706 3300033544 Bacteria 655
236 Ga0373931_0710868 3300035691 Bacteria 664
237 Ga0373925_0000072 3300037068 Bacteria 106707
238 Ga0395899_0048226 3300037312 Bacteria 3170
239 Ga0395900_0009595 3300037418 Bacteria 9922
240 Ga0395898_0007002 3300037466 Bacteria 11983
241 Ga0395905_0026494 3300037471 Bacteria 5465
242 Ga0395901_0005639 3300038443 Bacteria 12667
243 Ga0242419_006727 3300038698 Bacteria 840
244 Ga0453683_0769660 3300044673 Bacteria 633
245 Ga0495592_0001777 3300046454 Bacteria 15168
246 Ga0495592_0094619 3300046454 Bacteria 2138
247 Ga0495629_0007584 3300046459 Bacteria 7993
248 Ga0495629_0020104 3300046459 Bacteria 4767
249 Ga0495638_0008656 3300046460 Bacteria 7199
250 Ga0495638_0153269 3300046460 Bacteria 1335
251 Ga0495651_0001296 3300046462 Bacteria 19414
252 Ga0495651_0011552 3300046462 Bacteria 6783
253 Ga0495651_0579933 3300046462 Unclassified 709
254 Ga0495653_0024752 3300046463 Bacteria 4832
255 Ga0495580_0027166 3300046472 Bacteria 4165
256 Ga0495582_0029969 3300046473 Bacteria 2986
257 Ga0495605_0115413 3300046474 Bacteria 1222
258 Ga0495662_0002022 3300046476 Bacteria 10146
259 Ga0495662_0015633 3300046476 Bacteria 3682
260 Ga0495664_0003989 3300046477 Bacteria 8062
261 Ga0495664_0007333 3300046477 Bacteria 6122
262 Ga0495585_0057649 3300046492 Bacteria 2143
263 Ga0495594_0035749 3300046499 Bacteria 2707
264 Ga0495608_0000621 3300046511 Bacteria 24414
265 Ga0495610_0105208 3300046512 Bacteria 1258
266 Ga0495618_0125571 3300046514 Bacteria 1643
267 Ga0495628_0004128 3300046516 Bacteria 12919
268 Ga0495628_0200569 3300046516 Bacteria 1503
269 Ga0495630_0129259 3300046517 Bacteria 1918
270 Ga0495632_0087537 3300046519 Bacteria 1480
271 Ga0495643_0002710 3300046522 Bacteria 13641
272 Ga0495666_0001188 3300046526 Bacteria 12541
273 Ga0495652_0009693 3300046529 Bacteria 8736
274 Ga0495652_0079892 3300046529 Bacteria 2703
275 Ga0495665_0002856 3300046531 Bacteria 9333
276 Ga0495640_0013845 3300046533 Bacteria 6125
277 Ga0495640_0107176 3300046533 Bacteria 1829
278 Ga0495586_0131059 3300046535 Bacteria 1404
279 Ga0495587_0077146 3300046536 Bacteria 1935
280 Ga0495645_0037549 3300046543 Bacteria 3532
281 Ga0495645_0101419 3300046543 Bacteria 2046
282 Ga0495645_0125708 3300046543 Bacteria 1801
283 Ga0495645_0138536 3300046543 Bacteria 1700
284 Ga0495622_0144369 3300046557 Bacteria 1079
285 Ga0495633_0038962 3300046558 Bacteria 2269
286 Ga0495667_0043697 3300046559 Bacteria 2968
287 Ga0495667_0372549 3300046559 Unclassified 901
288 Ga0495656_0110102 3300046615 Bacteria 1287
289 Ga0495634_0003255 3300046642 Bacteria 13117
290 Ga0495611_0156502 3300046648 Bacteria 1064
291 Ga0495625_0007997 3300046660 Bacteria 9081
292 Ga0495625_0666086 3300046660 Bacteria 618
293 Ga0495635_0001628 3300046663 Bacteria 15131
294 Ga0495588_0015190 3300046674 Bacteria 3699
295 Ga0495588_0291663 3300046674 Bacteria 859
296 Ga0495657_0000602 3300046675 Bacteria 32915
297 Ga0495657_0004402 3300046675 Bacteria 11241
298 Ga0495646_0025311 3300046680 Bacteria 3733
299 Ga0495646_0067830 3300046680 Bacteria 2107
300 Ga0495613_0000692 3300046689 Bacteria 26583
301 Ga0495613_0073271 3300046689 Bacteria 2495
302 Ga0495613_0569370 3300046689 Bacteria 756
303 Ga0495613_0755790 3300046689 Unclassified 637
304 Ga0495624_0501525 3300046690 Bacteria 726
305 Ga0495670_0007291 3300046691 Bacteria 5435
306 Ga0495670_0736390 3300046691 Unclassified 538
307 Ga0495671_0130336 3300046692 Bacteria 1226
308 Ga0495649_0185455 3300046694 Bacteria 1084
309 Ga0495589_0103669 3300046794 Bacteria 1375
310 Ga0495600_0004965 3300046809 Bacteria 7987
311 Ga0495600_0023860 3300046809 Bacteria 3935
312 Ga0495660_0052971 3300046810 Bacteria 2204
313 Ga0495581_0005346 3300047315 Bacteria 7426
314 Ga0495581_0021503 3300047315 Bacteria 3738
315 Ga0495604_0000491 3300047317 Bacteria 34687
316 Ga0495604_0000721 3300047317 Bacteria 27964
317 Ga0495604_0307604 3300047317 Bacteria 1063
318 Ga0495604_0401219 3300047317 Bacteria 903
319 Ga0495636_0445066 3300047318 Bacteria 622
320 Ga0495674_0523691 3300047319 Bacteria 946
321 Ga0495676_0008112 3300047321 Bacteria 9635
322 Ga0495680_0871997 3300047322 Bacteria 583
323 Ga0495683_0046370 3300047323 Bacteria 2181
324 Ga0495687_002793 3300047443 Bacteria 13477
325 Ga0495687_010808 3300047443 Bacteria 4968
326 Ga0495687_024353 3300047443 Bacteria 2878
327 Ga0495687_032747 3300047443 Bacteria 2368
328 Ga0495687_035134 3300047443 Bacteria 2257
329 Ga0495675_0014341 3300047444 Bacteria 5006
330 Ga0495679_119150 3300047446 Bacteria 722
331 Ga0495685_004874 3300047447 Bacteria 4354
332 Ga0495681_0003170 3300047470 Bacteria 11499
333 Ga0495681_0016671 3300047470 Bacteria 4106
334 Ga0495684_0055074 3300047471 Bacteria 3033
335 Ga0495684_0258002 3300047471 Bacteria 1265
336 Ga0495686_0078652 3300047472 Bacteria 2018
337 Ga0495593_0084782 3300047673 Bacteria 1635
338 Ga0495602_0043267 3300048088 Bacteria 4097
339 Ga0495602_0200667 3300048088 Bacteria 1522
340 Ga0495614_0011944 3300048089 Bacteria 3815
341 Ga0495614_0026727 3300048089 Bacteria 2487
342 Ga0496100_0021753 3300048903 Bacteria 3869
343 Ga0496101_0034192 3300048904 Bacteria 3588
344 Ga0496101_0440795 3300048904 Unclassified 1027
345 Ga0496102_0017562 3300048905 Bacteria 6267
346 Ga0496103_0218430 3300048906 Bacteria 1226
347 Ga0496104_0136162 3300048907 Bacteria 2360
348 Ga0496106_0017301 3300048909 Bacteria 5336
349 Ga0496106_1416818 3300048909 Unclassified 537
350 Ga0496107_0021520 3300048910 Bacteria 4557
351 Ga0496107_0374772 3300048910 Bacteria 1058
352 Ga0496107_0537772 3300048910 Unclassified 866
353 Ga0496108_0376491 3300048911 Bacteria 1240
354 Ga0496108_0485737 3300048911 Bacteria 1079
355 Ga0496110_0216744 3300048913 Bacteria 1741
356 Ga0496110_0264985 3300048913 Bacteria 1564
357 Ga0496110_0279457 3300048913 Bacteria 1520
358 Ga0496111_0513917 3300048914 Bacteria 881
359 Ga0496112_0359900 3300048915 Unclassified 1397
360 Ga0496115_0136420 3300048918 Bacteria 2023
361 Ga0501033_0447490 3300049570 Bacteria 897
362 Ga0501034_0379603 3300049571 Bacteria 1338
363 Ga0501036_1114720 3300049572 Bacteria 644
364 Ga0501038_0252268 3300049574 Bacteria 1397
365 Ga0501039_0470204 3300049575 Bacteria 987
366 Ga0501043_0223061 3300049579 Bacteria 1457
367 Ga0501047_0210835 3300049581 Bacteria 1801
368 Ga0501047_0451781 3300049581 Bacteria 1114
369 nmdc:mga05p37_24310_c1 3300050507 Bacteria 7362
370 nmdc:mga05p37_381041_c1 3300050507 Bacteria 1653
371 nmdc:mga05p37_39023_c1 3300050507 Bacteria 5826
372 nmdc:mga09592_464182_c1 3300050508 Unclassified 1092
373 nmdc:mga09592_93609_c1 3300050508 Bacteria 2570
374 nmdc:mga0qj67_789811_c1 3300050509 Bacteria 752
375 nmdc:mga06r32_23642_c1 3300050510 Bacteria 5689
376 nmdc:mga06r32_42926_c1 3300050510 Bacteria 4301
377 nmdc:mga08y16_1089530_c1 3300050511 Bacteria 774
378 nmdc:mga08y16_21113_c1 3300050511 Bacteria 6875
379 nmdc:mga08y16_57914_c1 3300050511 Bacteria 4049
380 nmdc:mga0n895_117441_c1 3300050512 Bacteria 2680
381 nmdc:mga0n895_160242_c1 3300050512 Bacteria 2282
382 nmdc:mga0n895_53772_c1 3300050512 Bacteria 3958
383 nmdc:mga0rr50_43471_c1 3300050513 Unclassified 3289
384 nmdc:mga0rr50_66750_c1 3300050513 Bacteria 2730
385 nmdc:mga08x19_307526_c1 3300050514 Bacteria 1102
386 nmdc:mga08x19_41666_c1 3300050514 Bacteria 2925
387 nmdc:mga0a205_32448_c1 3300050515 Bacteria 5007
388 nmdc:mga0a205_40101_c1 3300050515 Bacteria 4508
389 nmdc:mga0a205_71998_c1 3300050515 Unclassified 3339
390 Ga0495601_0004917 3300053077 Bacteria 7758
391 Ga0495601_0038766 3300053077 Bacteria 2980
392 Ga0495601_0406554 3300053077 Bacteria 882
393 Ga0495601_0638072 3300053077 Bacteria 682
394 Ga0495612_0008854 3300053078 Bacteria 4078
395 Ga0495612_0025556 3300053078 Bacteria 2371
396 Ga0495655_0035974 3300053083 Bacteria 1235
397 Ga0495619_0106841 3300053085 Bacteria 1909
398 Ga0500578_0042229 3300053086 Bacteria 2928
399 Ga0500644_0024249 3300053088 Bacteria 1852
400 Ga0500651_0098317 3300053093 Bacteria 1797
401 Ga0500566_0013310 3300053094 Bacteria 4844
402 Ga0500640_000618 3300053095 Bacteria 9237
403 Ga0500641_0094591 3300053096 Bacteria 1278
404 Ga0500654_044857 3300053099 Bacteria 2458
405 Ga0500660_031932 3300053100 Bacteria 2742
406 Ga0500560_034407 3300053107 Bacteria 1554
407 Ga0500569_000761 3300053109 Bacteria 5643
408 Ga0500572_055444 3300053111 Bacteria 1192
409 Ga0500628_003407 3300053129 Bacteria 2626
410 Ga0500652_002257 3300053131 Bacteria 5790
411 Ga0500658_0004248 3300053134 Bacteria 5373
412 Ga0500573_0475399 3300053140 Bacteria 571
413 Ga0500579_116251 3300053143 Bacteria 1320
414 Ga0500588_0018753 3300053146 Bacteria 1829
415 Ga0500600_0037793 3300053149 Bacteria 2797
416 Ga0500600_0332677 3300053149 Bacteria 634
417 Ga0500624_019272 3300053157 Bacteria 1083
418 Ga0500633_0019398 3300053160 Bacteria 2032
419 Ga0500634_0008994 3300053161 Bacteria 5024
420 Ga0500656_000575 3300053732 Bacteria 2802

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10885209 Ga0157375_108852092 125
2 3300037312 Ga0395899_0048226 Ga0395899_0048226_2376_2765 127
3 3300037418 Ga0395900_0009595 Ga0395900_0009595_7158_7547 127
4 3300037466 Ga0395898_0007002 Ga0395898_0007002_376_765 127
5 3300037471 Ga0395905_0026494 Ga0395905_0026494_2337_2726 127
6 3300038443 Ga0395901_0005639 Ga0395901_0005639_9903_10292 127
7 3300006844 Ga0075428_100030944 Ga0075428_1000309446 131
8 3300006880 Ga0075429_100294820 Ga0075429_1002948202 131
9 3300050507 nmdc:mga05p37_39023_c1 nmdc:mga05p37_39023_c1_2677_3147 131
10 3300050508 nmdc:mga09592_464182_c1 nmdc:mga09592_464182_c1_220_690 131
11 3300038698 Ga0242419_006727 Ga0242419_006727_294_710 134
12 3300005983 Ga0081540_1041252 Ga0081540_10412523 146
13 3300006844 Ga0075428_101513712 Ga0075428_1015137122 148
14 3300046694 Ga0495649_0185455 Ga0495649_0185455_618_1067 148
15 3300012513 Ga0157326_1036387 Ga0157326_10363871 149
16 iso_pu_bacteria 2687453737 2689959158 150
17 iso_pu_bacteria 2995463766 2995463997 150
18 3300006844 Ga0075428_100023117 Ga0075428_1000231174 151
19 3300009147 Ga0114129_10028650 Ga0114129_100286507 151
20 3300050507 nmdc:mga05p37_24310_c1 nmdc:mga05p37_24310_c1_143_598 151
21 3300005843 Ga0068860_100546309 Ga0068860_1005463092 152
22 3300005981 Ga0081538_10050270 Ga0081538_100502702 152
23 3300005981 Ga0081538_10094607 Ga0081538_100946072 152
24 3300006058 Ga0075432_10117283 Ga0075432_101172832 152
25 3300028381 Ga0268264_10127020 Ga0268264_101270202 152
26 3300028786 Ga0307517_10022489 Ga0307517_100224899 152
27 3300031616 Ga0307508_10017515 Ga0307508_100175154 152
28 3300031730 Ga0307516_10051547 Ga0307516_100515473 152
29 3300046460 Ga0495638_0008656 Ga0495638_0008656_3928_4389 152
30 3300046492 Ga0495585_0057649 Ga0495585_0057649_551_1012 152
31 3300046512 Ga0495610_0105208 Ga0495610_0105208_565_1026 152
32 3300046519 Ga0495632_0087537 Ga0495632_0087537_263_724 152
33 3300046522 Ga0495643_0002710 Ga0495643_0002710_5484_5945 152
34 3300046558 Ga0495633_0038962 Ga0495633_0038962_1598_2059 152
35 3300046648 Ga0495611_0156502 Ga0495611_0156502_169_630 152
36 3300046691 Ga0495670_0007291 Ga0495670_0007291_4293_4754 152
37 3300046794 Ga0495589_0103669 Ga0495589_0103669_129_590 152
38 3300046810 Ga0495660_0052971 Ga0495660_0052971_1615_2076 152
39 3300047323 Ga0495683_0046370 Ga0495683_0046370_642_1103 152
40 3300047443 Ga0495687_010808 Ga0495687_010808_2146_2607 152
41 3300047446 Ga0495679_119150 Ga0495679_119150_217_678 152
42 3300047447 Ga0495685_004874 Ga0495685_004874_2482_2943 152
43 3300047470 Ga0495681_0016671 Ga0495681_0016671_2641_3102 152
44 3300053083 Ga0495655_0035974 Ga0495655_0035974_105_566 152
45 3300053086 Ga0500578_0042229 Ga0500578_0042229_897_1358 152
46 3300053093 Ga0500651_0098317 Ga0500651_0098317_278_739 152
47 3300053096 Ga0500641_0094591 Ga0500641_0094591_800_1261 152
48 3300053099 Ga0500654_044857 Ga0500654_044857_129_590 152
49 3300053109 Ga0500569_000761 Ga0500569_000761_885_1346 152
50 3300053129 Ga0500628_003407 Ga0500628_003407_692_1153 152
51 3300053131 Ga0500652_002257 Ga0500652_002257_1141_1602 152
52 3300053134 Ga0500658_0004248 Ga0500658_0004248_697_1158 152
53 3300053143 Ga0500579_116251 Ga0500579_116251_213_674 152
54 3300053146 Ga0500588_0018753 Ga0500588_0018753_58_519 152
55 3300053149 Ga0500600_0037793 Ga0500600_0037793_130_591 152
56 3300053160 Ga0500633_0019398 Ga0500633_0019398_1443_1904 152
57 3300053161 Ga0500634_0008994 Ga0500634_0008994_609_1070 152
58 3300053732 Ga0500656_000575 Ga0500656_000575_771_1232 152
59 3300005329 Ga0070683_101494166 Ga0070683_1014941661 153
60 3300005338 Ga0068868_100391807 Ga0068868_1003918072 153
61 3300005340 Ga0070689_100001333 Ga0070689_10000133312 153
62 3300005356 Ga0070674_100632206 Ga0070674_1006322062 153
63 3300005365 Ga0070688_100000192 Ga0070688_10000019215 153
64 3300005438 Ga0070701_10065076 Ga0070701_100650762 153
65 3300005444 Ga0070694_100028809 Ga0070694_1000288092 153
66 3300005444 Ga0070694_100032913 Ga0070694_1000329133 153
67 3300005445 Ga0070708_101473033 Ga0070708_1014730332 153
68 3300005455 Ga0070663_100462315 Ga0070663_1004623151 153
69 3300005466 Ga0070685_10001326 Ga0070685_100013269 153
70 3300005466 Ga0070685_10278214 Ga0070685_102782141 153
71 3300005468 Ga0070707_100066417 Ga0070707_1000664172 153
72 3300005468 Ga0070707_101269003 Ga0070707_1012690031 153
73 3300005471 Ga0070698_100052139 Ga0070698_1000521395 153
74 3300005471 Ga0070698_101272268 Ga0070698_1012722681 153
75 3300005518 Ga0070699_100107789 Ga0070699_1001077892 153
76 3300005617 Ga0068859_100026872 Ga0068859_1000268723 153
77 3300005617 Ga0068859_100859288 Ga0068859_1008592882 153
78 3300005618 Ga0068864_100018120 Ga0068864_1000181205 153
79 3300005841 Ga0068863_100026239 Ga0068863_1000262393 153
80 3300005841 Ga0068863_100055904 Ga0068863_1000559043 153
81 3300005937 Ga0081455_10009488 Ga0081455_100094882 153
82 3300006163 Ga0070715_11033879 Ga0070715_110338791 153
83 3300006175 Ga0070712_100159657 Ga0070712_1001596572 153
84 3300006175 Ga0070712_100206558 Ga0070712_1002065582 153
85 3300006852 Ga0075433_10018681 Ga0075433_100186814 153
86 3300006914 Ga0075436_100089790 Ga0075436_1000897902 153
87 3300006914 Ga0075436_100569682 Ga0075436_1005696821 153
88 3300006931 Ga0097620_100026872 Ga0097620_1000268723 153
89 3300006931 Ga0097620_100859241 Ga0097620_1008592412 153
90 3300007076 Ga0075435_100002946 Ga0075435_1000029463 153
91 3300009094 Ga0111539_11966757 Ga0111539_119667571 153
92 3300009177 Ga0105248_10114888 Ga0105248_101148884 153
93 3300009177 Ga0105248_11401104 Ga0105248_114011042 153
94 3300009545 Ga0105237_10182449 Ga0105237_101824494 153
95 3300013306 Ga0163162_12323859 Ga0163162_123238591 153
96 3300013308 Ga0157375_10211934 Ga0157375_102119342 153
97 3300014325 Ga0163163_11249880 Ga0163163_112498801 153
98 3300025899 Ga0207642_10197431 Ga0207642_101974311 153
99 3300025905 Ga0207685_10630309 Ga0207685_106303091 153
100 3300025910 Ga0207684_10207619 Ga0207684_102076192 153
101 3300025915 Ga0207693_10711831 Ga0207693_107118311 153
102 3300025922 Ga0207646_11002657 Ga0207646_110026571 153
103 3300025936 Ga0207670_10000241 Ga0207670_1000024118 153
104 3300025986 Ga0207658_10255606 Ga0207658_102556062 153
105 3300026023 Ga0207677_10276365 Ga0207677_102763651 153
106 3300026067 Ga0207678_10457612 Ga0207678_104576121 153
107 3300026075 Ga0207708_10220509 Ga0207708_102205093 153
108 3300026088 Ga0207641_10110811 Ga0207641_101108112 153
109 3300026095 Ga0207676_10288061 Ga0207676_102880612 153
110 3300028380 Ga0268265_10484026 Ga0268265_104840262 153
111 3300031456 Ga0307513_10616108 Ga0307513_106161081 153
112 3300044673 Ga0453683_0769660 Ga0453683_0769660_131_595 153
113 3300046462 Ga0495651_0579933 Ga0495651_0579933_189_653 153
114 3300046559 Ga0495667_0372549 Ga0495667_0372549_272_736 153
115 3300047317 Ga0495604_0307604 Ga0495604_0307604_375_836 153
116 3300048903 Ga0496100_0021753 Ga0496100_0021753_1910_2371 153
117 3300048904 Ga0496101_0034192 Ga0496101_0034192_1495_1956 153
118 3300048905 Ga0496102_0017562 Ga0496102_0017562_5615_6076 153
119 3300048906 Ga0496103_0218430 Ga0496103_0218430_266_727 153
120 3300048907 Ga0496104_0136162 Ga0496104_0136162_258_722 153
121 3300048909 Ga0496106_0017301 Ga0496106_0017301_884_1345 153
122 3300048909 Ga0496106_1416818 Ga0496106_1416818_52_516 153
123 3300048910 Ga0496107_0021520 Ga0496107_0021520_1024_1485 153
124 3300048910 Ga0496107_0374772 Ga0496107_0374772_119_583 153
125 3300048911 Ga0496108_0376491 Ga0496108_0376491_25_489 153
126 3300048913 Ga0496110_0216744 Ga0496110_0216744_594_1058 153
127 3300048913 Ga0496110_0279457 Ga0496110_0279457_492_956 153
128 3300048915 Ga0496112_0359900 Ga0496112_0359900_422_886 153
129 3300048918 Ga0496115_0136420 Ga0496115_0136420_1189_1650 153
130 3300050511 nmdc:mga08y16_1089530_c1 nmdc:mga08y16_1089530_c1_96_560 153
131 3300050512 nmdc:mga0n895_160242_c1 nmdc:mga0n895_160242_c1_1265_1729 153
132 3300050513 nmdc:mga0rr50_43471_c1 nmdc:mga0rr50_43471_c1_798_1262 153
133 3300050514 nmdc:mga08x19_307526_c1 nmdc:mga08x19_307526_c1_85_549 153
134 3300050515 nmdc:mga0a205_71998_c1 nmdc:mga0a205_71998_c1_1260_1724 153
135 3300053077 Ga0495601_0638072 Ga0495601_0638072_106_567 153
136 3300003320 rootH2_10008368 rootH2_100083684 154
137 3300005334 Ga0068869_100069257 Ga0068869_1000692574 154
138 3300005334 Ga0068869_100176372 Ga0068869_1001763722 154
139 3300005337 Ga0070682_100180970 Ga0070682_1001809702 154
140 3300005345 Ga0070692_10067380 Ga0070692_100673801 154
141 3300005365 Ga0070688_100737196 Ga0070688_1007371962 154
142 3300005366 Ga0070659_100241998 Ga0070659_1002419982 154
143 3300005435 Ga0070714_100205053 Ga0070714_1002050533 154
144 3300005435 Ga0070714_100233474 Ga0070714_1002334743 154
145 3300005435 Ga0070714_101984997 Ga0070714_1019849971 154
146 3300005436 Ga0070713_100779949 Ga0070713_1007799492 154
147 3300005437 Ga0070710_10030953 Ga0070710_100309533 154
148 3300005438 Ga0070701_10621929 Ga0070701_106219291 154
149 3300005439 Ga0070711_100339120 Ga0070711_1003391201 154
150 3300005441 Ga0070700_100085989 Ga0070700_1000859892 154
151 3300005444 Ga0070694_100503405 Ga0070694_1005034052 154
152 3300005445 Ga0070708_100541122 Ga0070708_1005411222 154
153 3300005445 Ga0070708_100921030 Ga0070708_1009210302 154
154 3300005457 Ga0070662_100032473 Ga0070662_1000324733 154
155 3300005457 Ga0070662_100388501 Ga0070662_1003885012 154
156 3300005467 Ga0070706_100008954 Ga0070706_1000089542 154
157 3300005467 Ga0070706_100013861 Ga0070706_1000138616 154
158 3300005467 Ga0070706_100219680 Ga0070706_1002196802 154
159 3300005467 Ga0070706_100512743 Ga0070706_1005127431 154
160 3300005468 Ga0070707_101029658 Ga0070707_1010296582 154
161 3300005471 Ga0070698_100003396 Ga0070698_1000033963 154
162 3300005471 Ga0070698_100018808 Ga0070698_1000188082 154
163 3300005471 Ga0070698_100080911 Ga0070698_1000809114 154
164 3300005471 Ga0070698_100094413 Ga0070698_1000944132 154
165 3300005536 Ga0070697_100270472 Ga0070697_1002704722 154
166 3300005536 Ga0070697_100584029 Ga0070697_1005840292 154
167 3300005548 Ga0070665_100645892 Ga0070665_1006458922 154
168 3300005549 Ga0070704_100436124 Ga0070704_1004361242 154
169 3300005578 Ga0068854_100328290 Ga0068854_1003282901 154
170 3300005615 Ga0070702_100090036 Ga0070702_1000900362 154
171 3300005616 Ga0068852_100052028 Ga0068852_1000520283 154
172 3300005718 Ga0068866_10060869 Ga0068866_100608692 154
173 3300005719 Ga0068861_100197149 Ga0068861_1001971491 154
174 3300005834 Ga0068851_10527978 Ga0068851_105279781 154
175 3300005843 Ga0068860_100261884 Ga0068860_1002618843 154
176 3300005843 Ga0068860_101354756 Ga0068860_1013547561 154
177 3300005844 Ga0068862_100157286 Ga0068862_1001572862 154
178 3300005844 Ga0068862_100759760 Ga0068862_1007597601 154
179 3300005981 Ga0081538_10016658 Ga0081538_100166583 154
180 3300005981 Ga0081538_10038103 Ga0081538_100381032 154
181 3300005983 Ga0081540_1000176 Ga0081540_100017614 154
182 3300006028 Ga0070717_10075471 Ga0070717_100754712 154
183 3300006028 Ga0070717_10169110 Ga0070717_101691101 154
184 3300006028 Ga0070717_10292494 Ga0070717_102924942 154
185 3300006058 Ga0075432_10002934 Ga0075432_100029349 154
186 3300006058 Ga0075432_10010301 Ga0075432_100103013 154
187 3300006175 Ga0070712_100103424 Ga0070712_1001034244 154
188 3300006844 Ga0075428_100016257 Ga0075428_1000162571 154
189 3300006844 Ga0075428_100701498 Ga0075428_1007014983 154
190 3300006844 Ga0075428_100790800 Ga0075428_1007908002 154
191 3300006847 Ga0075431_100240900 Ga0075431_1002409003 154
192 3300006847 Ga0075431_100611828 Ga0075431_1006118282 154
193 3300006852 Ga0075433_10016301 Ga0075433_100163013 154
194 3300006852 Ga0075433_10393094 Ga0075433_103930942 154
195 3300006852 Ga0075433_10506026 Ga0075433_105060264 154
196 3300006871 Ga0075434_100000543 Ga0075434_10000054317 154
197 3300006871 Ga0075434_100237465 Ga0075434_1002374652 154
198 3300006880 Ga0075429_100081117 Ga0075429_1000811172 154
199 3300006881 Ga0068865_100317182 Ga0068865_1003171822 154
200 3300006914 Ga0075436_100061527 Ga0075436_1000615272 154
201 3300007076 Ga0075435_100317391 Ga0075435_1003173912 154
202 3300009011 Ga0105251_10062270 Ga0105251_100622703 154
203 3300009093 Ga0105240_10378801 Ga0105240_103788012 154
204 3300009093 Ga0105240_10815076 Ga0105240_108150763 154
205 3300009093 Ga0105240_11404467 Ga0105240_114044671 154
206 3300009094 Ga0111539_10006838 Ga0111539_1000683813 154
207 3300009094 Ga0111539_10391051 Ga0111539_103910512 154
208 3300009098 Ga0105245_10076649 Ga0105245_100766491 154
209 3300009098 Ga0105245_10094988 Ga0105245_100949883 154
210 3300009098 Ga0105245_10489957 Ga0105245_104899572 154
211 3300009147 Ga0114129_10026678 Ga0114129_100266784 154
212 3300009147 Ga0114129_11683527 Ga0114129_116835272 154
213 3300009148 Ga0105243_10035678 Ga0105243_100356784 154
214 3300009176 Ga0105242_10030951 Ga0105242_100309512 154
215 3300009176 Ga0105242_10144842 Ga0105242_101448422 154
216 3300009551 Ga0105238_10352472 Ga0105238_103524721 154
217 3300009551 Ga0105238_11551051 Ga0105238_115510511 154
218 3300009553 Ga0105249_10018310 Ga0105249_100183107 154
219 3300009553 Ga0105249_10201587 Ga0105249_102015872 154
220 3300009553 Ga0105249_10335388 Ga0105249_103353882 154
221 3300013105 Ga0157369_10093477 Ga0157369_100934775 154
222 3300013105 Ga0157369_10533100 Ga0157369_105331002 154
223 3300013105 Ga0157369_10590552 Ga0157369_105905521 154
224 3300013306 Ga0163162_10140940 Ga0163162_101409402 154
225 3300013306 Ga0163162_10188017 Ga0163162_101880171 154
226 3300013307 Ga0157372_11071562 Ga0157372_110715622 154
227 3300013308 Ga0157375_10279946 Ga0157375_102799462 154
228 3300014326 Ga0157380_10112428 Ga0157380_101124284 154
229 3300014326 Ga0157380_10151374 Ga0157380_101513741 154
230 3300014745 Ga0157377_10018130 Ga0157377_100181305 154
231 3300014968 Ga0157379_10340484 Ga0157379_103404842 154
232 3300017792 Ga0163161_10439433 Ga0163161_104394331 154
233 3300025899 Ga0207642_10011240 Ga0207642_100112404 154
234 3300025901 Ga0207688_10002665 Ga0207688_100026655 154
235 3300025901 Ga0207688_10085006 Ga0207688_100850061 154
236 3300025904 Ga0207647_10045762 Ga0207647_100457622 154
237 3300025904 Ga0207647_10258891 Ga0207647_102588911 154
238 3300025910 Ga0207684_10002131 Ga0207684_1000213111 154
239 3300025910 Ga0207684_10718437 Ga0207684_107184371 154
240 3300025914 Ga0207671_10468255 Ga0207671_104682552 154
241 3300025915 Ga0207693_10034902 Ga0207693_100349023 154
242 3300025915 Ga0207693_10066396 Ga0207693_100663964 154
243 3300025916 Ga0207663_10133659 Ga0207663_101336591 154
244 3300025919 Ga0207657_10098606 Ga0207657_100986064 154
245 3300025924 Ga0207694_10164435 Ga0207694_101644352 154
246 3300025924 Ga0207694_10483817 Ga0207694_104838172 154
247 3300025927 Ga0207687_10613004 Ga0207687_106130041 154
248 3300025928 Ga0207700_10643021 Ga0207700_106430212 154
249 3300025931 Ga0207644_11485076 Ga0207644_114850761 154
250 3300025932 Ga0207690_10192143 Ga0207690_101921431 154
251 3300025932 Ga0207690_10209993 Ga0207690_102099932 154
252 3300025933 Ga0207706_10006072 Ga0207706_100060726 154
253 3300025933 Ga0207706_10710792 Ga0207706_107107922 154
254 3300025935 Ga0207709_10253723 Ga0207709_102537232 154
255 3300025937 Ga0207669_10221547 Ga0207669_102215472 154
256 3300025942 Ga0207689_10048210 Ga0207689_100482105 154
257 3300025942 Ga0207689_10147398 Ga0207689_101473984 154
258 3300025944 Ga0207661_10317603 Ga0207661_103176033 154
259 3300025972 Ga0207668_10186433 Ga0207668_101864332 154
260 3300025981 Ga0207640_10173959 Ga0207640_101739592 154
261 3300025981 Ga0207640_10396181 Ga0207640_103961811 154
262 3300026023 Ga0207677_10246522 Ga0207677_102465221 154
263 3300026023 Ga0207677_10310474 Ga0207677_103104742 154
264 3300026075 Ga0207708_10128323 Ga0207708_101283233 154
265 3300026075 Ga0207708_10853345 Ga0207708_108533451 154
266 3300026089 Ga0207648_10048563 Ga0207648_100485635 154
267 3300026118 Ga0207675_100016061 Ga0207675_1000160615 154
268 3300026118 Ga0207675_100270798 Ga0207675_1002707982 154
269 3300026142 Ga0207698_10042816 Ga0207698_100428164 154
270 3300026142 Ga0207698_10961840 Ga0207698_109618402 154
271 3300027907 Ga0207428_10006357 Ga0207428_100063577 154
272 3300027907 Ga0207428_10053101 Ga0207428_100531015 154
273 3300028379 Ga0268266_10438152 Ga0268266_104381522 154
274 3300028380 Ga0268265_10042418 Ga0268265_100424184 154
275 3300028380 Ga0268265_10547420 Ga0268265_105474202 154
276 3300028786 Ga0307517_10338040 Ga0307517_103380402 154
277 3300030521 Ga0307511_10002051 Ga0307511_100020514 154
278 3300030522 Ga0307512_10001704 Ga0307512_1000170425 154
279 3300031507 Ga0307509_10007222 Ga0307509_100072224 154
280 3300031507 Ga0307509_10021254 Ga0307509_100212548 154
281 3300031616 Ga0307508_10223267 Ga0307508_102232672 154
282 3300031649 Ga0307514_10003655 Ga0307514_100036558 154
283 3300031730 Ga0307516_10009394 Ga0307516_100093945 154
284 3300031730 Ga0307516_10077314 Ga0307516_100773144 154
285 3300031838 Ga0307518_10036585 Ga0307518_100365852 154
286 3300031838 Ga0307518_10113616 Ga0307518_101136163 154
287 3300033179 Ga0307507_10005887 Ga0307507_1000588710 154
288 3300033180 Ga0307510_10033747 Ga0307510_100337473 154
289 3300033544 Ga0316215_1021706 Ga0316215_10217062 154
290 3300035691 Ga0373931_0710868 Ga0373931_0710868_88_555 154
291 3300037068 Ga0373925_0000072 Ga0373925_0000072_12137_12604 154
292 3300046454 Ga0495592_0001777 Ga0495592_0001777_9115_9582 154
293 3300046454 Ga0495592_0094619 Ga0495592_0094619_1611_2078 154
294 3300046459 Ga0495629_0020104 Ga0495629_0020104_1683_2150 154
295 3300046460 Ga0495638_0153269 Ga0495638_0153269_580_1047 154
296 3300046462 Ga0495651_0011552 Ga0495651_0011552_818_1285 154
297 3300046473 Ga0495582_0029969 Ga0495582_0029969_2473_2940 154
298 3300046474 Ga0495605_0115413 Ga0495605_0115413_35_499 154
299 3300046476 Ga0495662_0002022 Ga0495662_0002022_3226_3693 154
300 3300046477 Ga0495664_0007333 Ga0495664_0007333_3038_3505 154
301 3300046499 Ga0495594_0035749 Ga0495594_0035749_372_839 154
302 3300046514 Ga0495618_0125571 Ga0495618_0125571_226_693 154
303 3300046516 Ga0495628_0200569 Ga0495628_0200569_149_616 154
304 3300046517 Ga0495630_0129259 Ga0495630_0129259_1080_1547 154
305 3300046529 Ga0495652_0009693 Ga0495652_0009693_123_590 154
306 3300046529 Ga0495652_0079892 Ga0495652_0079892_1730_2197 154
307 3300046533 Ga0495640_0013845 Ga0495640_0013845_5582_6049 154
308 3300046533 Ga0495640_0107176 Ga0495640_0107176_1031_1498 154
309 3300046535 Ga0495586_0131059 Ga0495586_0131059_113_580 154
310 3300046543 Ga0495645_0037549 Ga0495645_0037549_314_781 154
311 3300046543 Ga0495645_0138536 Ga0495645_0138536_510_977 154
312 3300046557 Ga0495622_0144369 Ga0495622_0144369_456_923 154
313 3300046615 Ga0495656_0110102 Ga0495656_0110102_264_731 154
314 3300046642 Ga0495634_0003255 Ga0495634_0003255_8118_8585 154
315 3300046660 Ga0495625_0666086 Ga0495625_0666086_44_511 154
316 3300046663 Ga0495635_0001628 Ga0495635_0001628_11330_11797 154
317 3300046674 Ga0495588_0291663 Ga0495588_0291663_14_481 154
318 3300046675 Ga0495657_0000602 Ga0495657_0000602_17554_18021 154
319 3300046689 Ga0495613_0000692 Ga0495613_0000692_12883_13350 154
320 3300046689 Ga0495613_0755790 Ga0495613_0755790_131_616 154
321 3300046690 Ga0495624_0501525 Ga0495624_0501525_156_623 154
322 3300046691 Ga0495670_0736390 Ga0495670_0736390_60_527 154
323 3300046692 Ga0495671_0130336 Ga0495671_0130336_103_570 154
324 3300046809 Ga0495600_0004965 Ga0495600_0004965_2354_2821 154
325 3300046809 Ga0495600_0023860 Ga0495600_0023860_2209_2676 154
326 3300047315 Ga0495581_0021503 Ga0495581_0021503_3080_3547 154
327 3300047317 Ga0495604_0000721 Ga0495604_0000721_3820_4287 154
328 3300047317 Ga0495604_0401219 Ga0495604_0401219_100_567 154
329 3300047318 Ga0495636_0445066 Ga0495636_0445066_76_558 154
330 3300047319 Ga0495674_0523691 Ga0495674_0523691_265_732 154
331 3300047321 Ga0495676_0008112 Ga0495676_0008112_116_583 154
332 3300047322 Ga0495680_0871997 Ga0495680_0871997_54_521 154
333 3300047443 Ga0495687_002793 Ga0495687_002793_12976_13443 154
334 3300047443 Ga0495687_024353 Ga0495687_024353_1861_2328 154
335 3300047443 Ga0495687_032747 Ga0495687_032747_1719_2186 154
336 3300047443 Ga0495687_035134 Ga0495687_035134_232_699 154
337 3300047471 Ga0495684_0055074 Ga0495684_0055074_373_840 154
338 3300047472 Ga0495686_0078652 Ga0495686_0078652_186_653 154
339 3300047673 Ga0495593_0084782 Ga0495593_0084782_977_1444 154
340 3300048088 Ga0495602_0043267 Ga0495602_0043267_2687_3154 154
341 3300048089 Ga0495614_0011944 Ga0495614_0011944_1232_1699 154
342 3300048904 Ga0496101_0440795 Ga0496101_0440795_27_503 154
343 3300048910 Ga0496107_0537772 Ga0496107_0537772_192_668 154
344 3300048911 Ga0496108_0485737 Ga0496108_0485737_459_926 154
345 3300048913 Ga0496110_0264985 Ga0496110_0264985_1058_1525 154
346 3300048914 Ga0496111_0513917 Ga0496111_0513917_253_720 154
347 3300049572 Ga0501036_1114720 Ga0501036_1114720_25_492 154
348 3300050507 nmdc:mga05p37_381041_c1 nmdc:mga05p37_381041_c1_451_918 154
349 3300050508 nmdc:mga09592_93609_c1 nmdc:mga09592_93609_c1_986_1453 154
350 3300050509 nmdc:mga0qj67_789811_c1 nmdc:mga0qj67_789811_c1_81_548 154
351 3300050510 nmdc:mga06r32_23642_c1 nmdc:mga06r32_23642_c1_270_737 154
352 3300050510 nmdc:mga06r32_42926_c1 nmdc:mga06r32_42926_c1_610_1086 154
353 3300050511 nmdc:mga08y16_21113_c1 nmdc:mga08y16_21113_c1_1769_2236 154
354 3300050511 nmdc:mga08y16_57914_c1 nmdc:mga08y16_57914_c1_857_1324 154
355 3300050512 nmdc:mga0n895_117441_c1 nmdc:mga0n895_117441_c1_730_1197 154
356 3300050512 nmdc:mga0n895_53772_c1 nmdc:mga0n895_53772_c1_1712_2179 154
357 3300050513 nmdc:mga0rr50_66750_c1 nmdc:mga0rr50_66750_c1_1744_2211 154
358 3300050514 nmdc:mga08x19_41666_c1 nmdc:mga08x19_41666_c1_1189_1656 154
359 3300050515 nmdc:mga0a205_32448_c1 nmdc:mga0a205_32448_c1_1187_1654 154
360 3300050515 nmdc:mga0a205_40101_c1 nmdc:mga0a205_40101_c1_1590_2057 154
361 3300053077 Ga0495601_0406554 Ga0495601_0406554_164_640 154
362 3300053078 Ga0495612_0008854 Ga0495612_0008854_3253_3720 154
363 3300053078 Ga0495612_0025556 Ga0495612_0025556_183_650 154
364 3300053085 Ga0495619_0106841 Ga0495619_0106841_667_1134 154
365 3300053088 Ga0500644_0024249 Ga0500644_0024249_305_772 154
366 3300053095 Ga0500640_000618 Ga0500640_000618_5090_5557 154
367 3300053100 Ga0500660_031932 Ga0500660_031932_356_823 154
368 3300053107 Ga0500560_034407 Ga0500560_034407_769_1236 154
369 3300053111 Ga0500572_055444 Ga0500572_055444_29_496 154
370 3300053140 Ga0500573_0475399 Ga0500573_0475399_22_489 154
371 3300053149 Ga0500600_0332677 Ga0500600_0332677_77_544 154
372 3300053157 Ga0500624_019272 Ga0500624_019272_525_992 154
373 3300028786 Ga0307517_10025008 Ga0307517_100250085 155
374 3300028794 Ga0307515_10000106 Ga0307515_1000010668 155
375 3300030522 Ga0307512_10099218 Ga0307512_100992183 155
376 3300031616 Ga0307508_10040870 Ga0307508_100408702 155
377 3300033179 Ga0307507_10005664 Ga0307507_100056644 155
378 3300033180 Ga0307510_10039953 Ga0307510_100399533 155
379 3300046459 Ga0495629_0007584 Ga0495629_0007584_3202_3672 155
380 3300046660 Ga0495625_0007997 Ga0495625_0007997_6904_7374 155
381 3300046674 Ga0495588_0015190 Ga0495588_0015190_2631_3101 155
382 3300046689 Ga0495613_0569370 Ga0495613_0569370_96_566 155
383 3300047470 Ga0495681_0003170 Ga0495681_0003170_10551_11021 155
384 3300048089 Ga0495614_0026727 Ga0495614_0026727_353_823 155
385 3300046536 Ga0495587_0077146 Ga0495587_0077146_947_1429 159
386 3300046543 Ga0495645_0101419 Ga0495645_0101419_126_608 159
387 3300046680 Ga0495646_0025311 Ga0495646_0025311_1421_1903 159
388 3300048088 Ga0495602_0200667 Ga0495602_0200667_878_1360 159
389 3300049570 Ga0501033_0447490 Ga0501033_0447490_311_808 159
390 3300049571 Ga0501034_0379603 Ga0501034_0379603_19_516 159
391 3300049574 Ga0501038_0252268 Ga0501038_0252268_442_939 159
392 3300049575 Ga0501039_0470204 Ga0501039_0470204_388_885 159
393 3300049579 Ga0501043_0223061 Ga0501043_0223061_921_1418 159
394 3300049581 Ga0501047_0451781 Ga0501047_0451781_438_935 159
395 3300053077 Ga0495601_0038766 Ga0495601_0038766_1494_1976 159
396 3300049581 Ga0501047_0210835 Ga0501047_0210835_759_1256 164
397 3300053094 Ga0500566_0013310 Ga0500566_0013310_1474_2010 169
398 3300046462 Ga0495651_0001296 Ga0495651_0001296_4677_5222 172
399 3300046463 Ga0495653_0024752 Ga0495653_0024752_3754_4299 172
400 3300046472 Ga0495580_0027166 Ga0495580_0027166_677_1222 172
401 3300046476 Ga0495662_0015633 Ga0495662_0015633_1048_1593 172
402 3300046477 Ga0495664_0003989 Ga0495664_0003989_6415_6960 172
403 3300046511 Ga0495608_0000621 Ga0495608_0000621_19390_19935 172
404 3300046516 Ga0495628_0004128 Ga0495628_0004128_10368_10913 172
405 3300046526 Ga0495666_0001188 Ga0495666_0001188_5582_6127 172
406 3300046531 Ga0495665_0002856 Ga0495665_0002856_4169_4714 172
407 3300046543 Ga0495645_0125708 Ga0495645_0125708_409_954 172
408 3300046559 Ga0495667_0043697 Ga0495667_0043697_334_879 172
409 3300046675 Ga0495657_0004402 Ga0495657_0004402_4357_4902 172
410 3300046680 Ga0495646_0067830 Ga0495646_0067830_1176_1721 172
411 3300046689 Ga0495613_0073271 Ga0495613_0073271_1896_2441 172
412 3300047315 Ga0495581_0005346 Ga0495581_0005346_1740_2285 172
413 3300047317 Ga0495604_0000491 Ga0495604_0000491_5279_5824 172
414 3300047444 Ga0495675_0014341 Ga0495675_0014341_184_729 172
415 3300047471 Ga0495684_0258002 Ga0495684_0258002_334_879 172
416 3300053077 Ga0495601_0004917 Ga0495601_0004917_4157_4702 172
417 3300002705 JGI25156J39149_1008326 JGI25156J39149_10083262 176
418 3300003761 Ga0055535_1000056 Ga0055535_100005677 176
419 3300003763 Ga0055529_1000165 Ga0055529_100016530 176
420 3300025242 Ga0209258_100071 Ga0209258_10007146 176
421 3300025256 Ga0209759_1000525 Ga0209759_100052522 176
422 3300025272 Ga0209455_1000030 Ga0209455_1000030225 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

36

168

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2chc-assembly1.cif.gz_A structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.8783 31 167
3a76-assembly1.cif.gz_A the crystal structure of lina 0.8754 31 169
1ask-assembly1.cif.gz_B nuclear transport factor 2 (ntf2) h66a mutant 0.8747 28 168
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.8698 33 166
3ef8-assembly1.cif.gz_A crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.8685 31 176
ID Description Score Start End Superfamily
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8811 32 167 3.10.450.50
3a76A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8754 31 169 3.10.450.50
4lehA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8586 31 176 3.10.450.50
3robD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8585 33 166 3.10.450.50
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8356 29 170 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1I0S4B8-F1-model_v4 SnoaL-like domain-containing protein 0.9843 31 172
AF-A0A1M5PRG7-F1-model_v4 NADPH-dependent curcumin reductase CurA 0.9825 26 176 GO:0016628
AF-A0A191TPE1-F1-model_v4 SnoaL-like domain-containing protein 0.982 34 176
AF-A0A3T1DBT6-F1-model_v4 SnoaL-like domain-containing protein 0.977 28 176
AF-A0A191TPE1-F1-model_v4 SnoaL-like domain-containing protein 0.9683 34 176

Feature Viewer

pLDDT pTM Quality
88.09 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map