F440310

General Info

Members Datasets Scaffolds Average Seq Length
422 219 421 154

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100071967|Ga0307408_1000719672
Length 154
Sequence MSPLFSIKPEAVAVIDAADKQTILEKLSETFAASYGLDRGEVLEHLEERERLGSTGFGRGVAIPHARMPAVMRRPVAALLKLRQPADFASADGLPVDLVFGLLSPENSGATHLHALAAISRLMRDDRVHEALSDAPNKEALYGLLTNATDRDAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
113 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
146 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
165 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
210 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.59
Nodule 0.47
Rhizoplane 5.69
Rhizosphere 72.27
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2098723 2162886007 Bacteria 1375
2 SwRhRL2b_contig_780398 2162886007 Bacteria 36690
3 JGI24738J21930_10022556 3300002075 Bacteria 1301
4 JGI24751J29686_10000290 3300002459 Bacteria 19108
5 Ga0070658_10032460 3300005327 Bacteria 4197
6 Ga0070658_10062359 3300005327 Bacteria 3038
7 Ga0070658_10189015 3300005327 Bacteria 1735
8 Ga0070658_10405769 3300005327 Bacteria 1171
9 Ga0070658_10594889 3300005327 Bacteria 958
10 Ga0070658_10958742 3300005327 Bacteria 744
11 Ga0070658_11055124 3300005327 Bacteria 707
12 Ga0070683_100046822 3300005329 Bacteria 3996
13 Ga0070683_100906285 3300005329 Bacteria 846
14 Ga0070690_100010163 3300005330 Bacteria 5466
15 Ga0070680_100014192 3300005336 Bacteria 6222
16 Ga0070680_100247186 3300005336 Bacteria 1508
17 Ga0070660_100013261 3300005339 Bacteria 5907
18 Ga0070660_100017606 3300005339 Bacteria 5210
19 Ga0070661_100004232 3300005344 Bacteria 9896
20 Ga0070661_100041071 3300005344 Bacteria 3375
21 Ga0070668_100046662 3300005347 Bacteria 3328
22 Ga0070668_100167867 3300005347 Bacteria 1785
23 Ga0070668_100365085 3300005347 Bacteria 1225
24 Ga0070669_100001055 3300005353 Bacteria 20165
25 Ga0070669_100077123 3300005353 Bacteria 2475
26 Ga0070675_100573425 3300005354 Bacteria 1022
27 Ga0070671_100000005 3300005355 Bacteria 256547
28 Ga0070671_100050221 3300005355 Bacteria 3469
29 Ga0070659_100028249 3300005366 Bacteria 4330
30 Ga0070659_100044225 3300005366 Bacteria 3486
31 Ga0070659_100190894 3300005366 Bacteria 1684
32 Ga0070667_100000160 3300005367 Bacteria 83754
33 Ga0070667_100002480 3300005367 Bacteria 16110
34 Ga0070667_100039174 3300005367 Bacteria 3971
35 Ga0070667_101903451 3300005367 Bacteria 560
36 Ga0070708_100564501 3300005445 Bacteria 1073
37 Ga0070663_100030672 3300005455 Bacteria 3688
38 Ga0070663_100046863 3300005455 Bacteria 3061
39 Ga0070663_100193597 3300005455 Bacteria 1583
40 Ga0070663_100730078 3300005455 Bacteria 844
41 Ga0070678_100650822 3300005456 Bacteria 945
42 Ga0070662_100000798 3300005457 Bacteria 19365
43 Ga0070662_100009032 3300005457 Bacteria 6502
44 Ga0070662_100041916 3300005457 Bacteria 3268
45 Ga0070681_10099035 3300005458 Bacteria 2861
46 Ga0070681_10279261 3300005458 Bacteria 1581
47 Ga0070685_10225930 3300005466 Bacteria 1229
48 Ga0070707_100215669 3300005468 Bacteria 1870
49 Ga0070698_101672785 3300005471 Bacteria 589
50 Ga0070679_100033381 3300005530 Bacteria 5096
51 Ga0070679_100078108 3300005530 Bacteria 3299
52 Ga0070679_100196112 3300005530 Bacteria 1987
53 Ga0070684_100068573 3300005535 Bacteria 3118
54 Ga0070684_100121038 3300005535 Bacteria 2354
55 Ga0070684_100844304 3300005535 Bacteria 857
56 Ga0068853_100000627 3300005539 Bacteria 24278
57 Ga0068853_100848689 3300005539 Bacteria 876
58 Ga0068853_101386015 3300005539 Bacteria 680
59 Ga0070686_100748418 3300005544 Bacteria 784
60 Ga0070665_100005846 3300005548 Bacteria 12619
61 Ga0070665_100190010 3300005548 Bacteria 2055
62 Ga0070665_101035151 3300005548 Bacteria 833
63 Ga0068855_100006162 3300005563 Bacteria 14623
64 Ga0068855_100009292 3300005563 Bacteria 11873
65 Ga0068855_100014586 3300005563 Bacteria 9465
66 Ga0068855_100426616 3300005563 Bacteria 1450
67 Ga0068855_100969338 3300005563 Bacteria 895
68 Ga0068855_101224600 3300005563 Bacteria 780
69 Ga0070664_100026361 3300005564 Bacteria 4821
70 Ga0070664_100079567 3300005564 Bacteria 2822
71 Ga0068857_100040307 3300005577 Bacteria 4141
72 Ga0068854_100038562 3300005578 Bacteria 3361
73 Ga0068854_100430031 3300005578 Bacteria 1098
74 Ga0068854_100655401 3300005578 Bacteria 902
75 Ga0068856_100013898 3300005614 Bacteria 7787
76 Ga0068856_100143458 3300005614 Bacteria 2396
77 Ga0068852_100036235 3300005616 Bacteria 4126
78 Ga0068852_100100665 3300005616 Bacteria 2608
79 Ga0068852_100113316 3300005616 Bacteria 2469
80 Ga0068852_100723297 3300005616 Bacteria 1006
81 Ga0068852_100798087 3300005616 Bacteria 958
82 Ga0068852_101091588 3300005616 Bacteria 818
83 Ga0068852_101517765 3300005616 Bacteria 692
84 Ga0068859_100220738 3300005617 Bacteria 1983
85 Ga0068859_100285522 3300005617 Bacteria 1743
86 Ga0068864_100009381 3300005618 Bacteria 8073
87 Ga0068864_100144065 3300005618 Bacteria 2152
88 Ga0068864_100880947 3300005618 Bacteria 883
89 Ga0068861_100696833 3300005719 Bacteria 943
90 Ga0068863_100000090 3300005841 Bacteria 100887
91 Ga0068863_100009722 3300005841 Bacteria 9382
92 Ga0068863_100134276 3300005841 Bacteria 2364
93 Ga0068863_100583769 3300005841 Bacteria 1105
94 Ga0068858_100003571 3300005842 Bacteria 15390
95 Ga0068858_100010173 3300005842 Bacteria 8928
96 Ga0068860_100000089 3300005843 Bacteria 152667
97 Ga0068860_100023485 3300005843 Bacteria 5959
98 Ga0068860_100031443 3300005843 Bacteria 5103
99 Ga0075368_10001348 3300006042 Bacteria 7811
100 Ga0075363_100002455 3300006048 Bacteria 7580
101 Ga0075363_100028458 3300006048 Bacteria 2875
102 Ga0075364_10000854 3300006051 Bacteria 16048
103 Ga0075364_10006492 3300006051 Bacteria 6875
104 Ga0075364_10026011 3300006051 Bacteria 3730
105 Ga0075432_10000533 3300006058 Bacteria 11418
106 Ga0075362_10000110 3300006177 Bacteria 22774
107 Ga0075362_10001068 3300006177 Bacteria 8470
108 Ga0075362_10003739 3300006177 Bacteria 5381
109 Ga0075367_10008038 3300006178 Bacteria 5440
110 Ga0075369_10001156 3300006186 Bacteria 8910
111 Ga0075369_10015984 3300006186 Bacteria 3021
112 Ga0075369_10023219 3300006186 Bacteria 2563
113 Ga0075366_10000832 3300006195 Bacteria 14827
114 Ga0075366_10105119 3300006195 Bacteria 1697
115 Ga0075366_10498820 3300006195 Bacteria 752
116 Ga0097621_100106760 3300006237 Bacteria 2362
117 Ga0075370_10002739 3300006353 Bacteria 8256
118 Ga0075370_10003733 3300006353 Bacteria 7288
119 Ga0075370_10028750 3300006353 Bacteria 3092
120 Ga0075370_10070257 3300006353 Bacteria 2002
121 Ga0075370_10078271 3300006353 Bacteria 1898
122 Ga0075370_10099181 3300006353 Bacteria 1685
123 Ga0075370_10181147 3300006353 Bacteria 1240
124 Ga0068871_100133674 3300006358 Bacteria 2105
125 Ga0097620_100220727 3300006931 Bacteria 1983
126 Ga0097620_100285530 3300006931 Bacteria 1743
127 Ga0079104_1009226 3300006946 Bacteria 3359
128 Ga0105250_10019061 3300009092 Bacteria 2774
129 Ga0105240_10796746 3300009093 Bacteria 1024
130 Ga0105240_10909419 3300009093 Bacteria 946
131 Ga0111539_10464773 3300009094 Bacteria 1473
132 Ga0105247_10083386 3300009101 Bacteria 2019
133 Ga0105247_10314283 3300009101 Bacteria 1091
134 Ga0105243_10113368 3300009148 Bacteria 2273
135 Ga0105241_10047031 3300009174 Bacteria 3279
136 Ga0105241_10394251 3300009174 Bacteria 1213
137 Ga0105248_10040914 3300009177 Bacteria 5196
138 Ga0105248_10041068 3300009177 Bacteria 5185
139 Ga0105246_10000074 3300011119 Bacteria 41753
140 Ga0157373_10011640 3300013100 Bacteria 6462
141 Ga0157373_10186092 3300013100 Bacteria 1463
142 Ga0157371_10001651 3300013102 Bacteria 22752
143 Ga0157371_10028260 3300013102 Bacteria 4062
144 Ga0157371_10957841 3300013102 Unclassified 651
145 Ga0157370_10028285 3300013104 Bacteria 5516
146 Ga0157369_10000384 3300013105 Bacteria 58625
147 Ga0157369_12109281 3300013105 Bacteria 572
148 Ga0163162_10103499 3300013306 Bacteria 2941
149 Ga0157372_10004422 3300013307 Bacteria 14988
150 Ga0157372_11767936 3300013307 Bacteria 711
151 Ga0157375_10792568 3300013308 Bacteria 1097
152 Ga0157380_10373319 3300014326 Bacteria 1343
153 Ga0157377_10579750 3300014745 Bacteria 797
154 Ga0157379_10165390 3300014968 Bacteria 1996
155 Ga0157376_11571305 3300014969 Bacteria 692
156 Ga0163161_10055785 3300017792 Bacteria 2869
157 Ga0207697_10024048 3300025315 Bacteria 2495
158 Ga0207682_10159901 3300025893 Bacteria 1020
159 Ga0207710_10044581 3300025900 Bacteria 1975
160 Ga0207680_10479144 3300025903 Bacteria 885
161 Ga0207647_10554594 3300025904 Bacteria 637
162 Ga0207705_10003812 3300025909 Bacteria 11467
163 Ga0207705_10039655 3300025909 Bacteria 3376
164 Ga0207705_10183344 3300025909 Bacteria 1580
165 Ga0207705_10194551 3300025909 Bacteria 1535
166 Ga0207705_10570469 3300025909 Bacteria 880
167 Ga0207654_10088595 3300025911 Bacteria 1881
168 Ga0207654_10527281 3300025911 Bacteria 837
169 Ga0207707_10064046 3300025912 Bacteria 3200
170 Ga0207660_10080859 3300025917 Bacteria 2387
171 Ga0207660_10202273 3300025917 Bacteria 1552
172 Ga0207657_10000156 3300025919 Bacteria 69892
173 Ga0207657_10014245 3300025919 Bacteria 7773
174 Ga0207657_10217140 3300025919 Bacteria 1533
175 Ga0207649_10030530 3300025920 Bacteria 3193
176 Ga0207652_10003649 3300025921 Bacteria 12670
177 Ga0207652_10089727 3300025921 Bacteria 2699
178 Ga0207652_10101271 3300025921 Bacteria 2544
179 Ga0207652_10185051 3300025921 Bacteria 1873
180 Ga0207646_10711925 3300025922 Bacteria 897
181 Ga0207681_10000288 3300025923 Bacteria 37371
182 Ga0207681_10143912 3300025923 Bacteria 1779
183 Ga0207650_10725094 3300025925 Bacteria 841
184 Ga0207659_10487624 3300025926 Bacteria 1042
185 Ga0207644_10000008 3300025931 Bacteria 354219
186 Ga0207644_10052625 3300025931 Bacteria 2927
187 Ga0207644_10380211 3300025931 Bacteria 1151
188 Ga0207690_10105652 3300025932 Bacteria 2019
189 Ga0207690_10112436 3300025932 Bacteria 1964
190 Ga0207690_10674811 3300025932 Bacteria 848
191 Ga0207690_10969596 3300025932 Bacteria 707
192 Ga0207706_10001346 3300025933 Bacteria 24541
193 Ga0207706_10003722 3300025933 Bacteria 14550
194 Ga0207706_10008748 3300025933 Bacteria 9319
195 Ga0207691_10934794 3300025940 Bacteria 725
196 Ga0207711_10216263 3300025941 Bacteria 1751
197 Ga0207711_10241827 3300025941 Bacteria 1655
198 Ga0207661_10245416 3300025944 Bacteria 1590
199 Ga0207661_10293639 3300025944 Bacteria 1455
200 Ga0207679_10053211 3300025945 Bacteria 2973
201 Ga0207667_10003313 3300025949 Bacteria 19874
202 Ga0207667_10004614 3300025949 Bacteria 16903
203 Ga0207667_10037411 3300025949 Bacteria 5187
204 Ga0207667_10047986 3300025949 Bacteria 4517
205 Ga0207667_10104022 3300025949 Bacteria 2928
206 Ga0207712_10130400 3300025961 Bacteria 1915
207 Ga0207668_10048867 3300025972 Bacteria 2905
208 Ga0207668_10448090 3300025972 Bacteria 1101
209 Ga0207640_10029659 3300025981 Bacteria 3361
210 Ga0207640_10932736 3300025981 Bacteria 760
211 Ga0207658_10001492 3300025986 Bacteria 18189
212 Ga0207658_10003386 3300025986 Bacteria 11284
213 Ga0207658_10201647 3300025986 Bacteria 1661
214 Ga0207703_10005939 3300026035 Bacteria 9782
215 Ga0207703_10015828 3300026035 Bacteria 5883
216 Ga0207639_10000808 3300026041 Bacteria 21259
217 Ga0207678_10035674 3300026067 Bacteria 4330
218 Ga0207678_10043681 3300026067 Bacteria 3878
219 Ga0207678_10045196 3300026067 Bacteria 3809
220 Ga0207678_10661370 3300026067 Bacteria 918
221 Ga0207702_10007553 3300026078 Bacteria 9267
222 Ga0207702_10500402 3300026078 Bacteria 1185
223 Ga0207702_10587723 3300026078 Bacteria 1092
224 Ga0207641_10000069 3300026088 Bacteria 154022
225 Ga0207641_10002819 3300026088 Bacteria 15805
226 Ga0207641_10184824 3300026088 Bacteria 1911
227 Ga0207676_10016695 3300026095 Bacteria 5317
228 Ga0207676_10143464 3300026095 Bacteria 2047
229 Ga0207676_10326580 3300026095 Bacteria 1410
230 Ga0207674_10109713 3300026116 Bacteria 2735
231 Ga0207674_10584256 3300026116 Bacteria 1079
232 Ga0207683_10054861 3300026121 Bacteria 3494
233 Ga0207698_10018961 3300026142 Bacteria 4698
234 Ga0207698_10066395 3300026142 Bacteria 2839
235 Ga0207698_10087401 3300026142 Bacteria 2539
236 Ga0207698_10093027 3300026142 Bacteria 2474
237 Ga0207698_10661078 3300026142 Bacteria 1036
238 Ga0207698_10758242 3300026142 Bacteria 970
239 Ga0207698_11015385 3300026142 Bacteria 841
240 Ga0207698_11106495 3300026142 Bacteria 805
241 Ga0209281_1012035 3300027111 Bacteria 1915
242 Ga0209983_1010759 3300027665 Bacteria 1870
243 Ga0209813_10000027 3300027866 Bacteria 69637
244 Ga0209974_10009642 3300027876 Bacteria 3276
245 Ga0209974_10011556 3300027876 Bacteria 2963
246 Ga0207428_10069403 3300027907 Bacteria 2771
247 Ga0268266_10035190 3300028379 Bacteria 4260
248 Ga0268266_10417314 3300028379 Bacteria 1271
249 Ga0268265_10013638 3300028380 Bacteria 5527
250 Ga0268265_10418926 3300028380 Bacteria 1243
251 Ga0268264_10000160 3300028381 Bacteria 152653
252 Ga0268264_10013326 3300028381 Bacteria 6768
253 Ga0265331_10041051 3300031250 Bacteria 2249
254 Ga0265327_10072308 3300031251 Bacteria 1722
255 Ga0307408_100071967 3300031548 Bacteria 2558
256 Ga0307508_10010513 3300031616 Bacteria 8472
257 Ga0316579_10025901 3300031691 Bacteria 2651
258 Ga0316576_11173971 3300031727 Unclassified 543
259 Ga0307405_10866248 3300031731 Bacteria 762
260 Ga0307413_10131392 3300031824 Bacteria 1714
261 Ga0307413_10386392 3300031824 Bacteria 1092
262 Ga0307413_10645397 3300031824 Bacteria 872
263 Ga0307410_10076541 3300031852 Bacteria 2336
264 Ga0307410_10344824 3300031852 Bacteria 1188
265 Ga0307406_10018370 3300031901 Bacteria 4085
266 Ga0307412_10044566 3300031911 Bacteria 2894
267 Ga0307412_10148541 3300031911 Bacteria 1726
268 Ga0307412_10247204 3300031911 Bacteria 1383
269 Ga0307412_10484776 3300031911 Bacteria 1026
270 Ga0307409_100174218 3300031995 Bacteria 1897
271 Ga0307416_100018028 3300032002 Bacteria 4960
272 Ga0307414_10023564 3300032004 Bacteria 3907
273 Ga0307414_10041877 3300032004 Bacteria 3106
274 Ga0307414_10076247 3300032004 Bacteria 2436
275 Ga0307414_10113162 3300032004 Bacteria 2071
276 Ga0307414_10218440 3300032004 Bacteria 1563
277 Ga0307414_10291758 3300032004 Bacteria 1375
278 Ga0307411_10170337 3300032005 Bacteria 1641
279 Ga0307411_10271766 3300032005 Bacteria 1344
280 Ga0307411_10282551 3300032005 Bacteria 1322
281 Ga0307415_100190933 3300032126 Bacteria 1616
282 Ga0307415_101211299 3300032126 Bacteria 712
283 Ga0316583_10006180 3300032133 Bacteria 4308
284 Ga0307510_10145343 3300033180 Bacteria 2005
285 Ga0373939_0432033 3300035114 Unclassified 551
286 Ga0373931_0038570 3300035691 Bacteria 2500
287 Ga0373935_1356645 3300035692 Unclassified 531
288 Ga0316582_0381737 3300036647 Bacteria 970
289 Ga0316584_0008286 3300036712 Bacteria 7159
290 Ga0451853_1261533 3300041512 Bacteria 625
291 Ga0439448_0128838 3300042005 Bacteria 871
292 Ga0450912_009450 3300042116 Bacteria 822
293 Ga0450898_123778 3300042134 Unclassified 553
294 Ga0439435_0003482 3300042436 Bacteria 3280
295 Ga0450916_023502 3300042530 Bacteria 861
296 Ga0495650_0003812 3300046471 Bacteria 10726
297 Ga0495650_0168990 3300046471 Bacteria 775
298 Ga0495596_0000119 3300046500 Bacteria 54166
299 Ga0495596_0001077 3300046500 Bacteria 16192
300 Ga0495607_0003215 3300046501 Bacteria 12623
301 Ga0495606_0006170 3300046507 Bacteria 11153
302 Ga0495606_0461351 3300046507 Bacteria 649
303 Ga0495610_0000050 3300046512 Bacteria 143781
304 Ga0495610_0000352 3300046512 Bacteria 48332
305 Ga0495616_0089326 3300046513 Bacteria 1462
306 Ga0495620_0085579 3300046515 Bacteria 1270
307 Ga0495631_0133855 3300046518 Bacteria 1065
308 Ga0495632_0003354 3300046519 Bacteria 11413
309 Ga0495632_0008427 3300046519 Bacteria 6328
310 Ga0495643_0000036 3300046522 Bacteria 238374
311 Ga0495643_0014146 3300046522 Bacteria 4755
312 Ga0495643_0063068 3300046522 Bacteria 1961
313 Ga0495643_0079462 3300046522 Bacteria 1710
314 Ga0495609_0005187 3300046538 Bacteria 6934
315 Ga0495633_0173359 3300046558 Bacteria 994
316 Ga0495625_0007251 3300046660 Bacteria 9701
317 Ga0495681_0000095 3300047470 Bacteria 76975
318 Ga0495686_0499496 3300047472 Bacteria 641
319 Ga0495615_0000158 3300048090 Bacteria 17114
320 Ga0495626_0000585 3300048091 Bacteria 36107
321 Ga0496101_0064377 3300048904 Bacteria 2670
322 Ga0496102_0328132 3300048905 Bacteria 1441
323 Ga0496102_0413789 3300048905 Bacteria 1267
324 Ga0496102_0647097 3300048905 Bacteria 980
325 Ga0496103_0039843 3300048906 Bacteria 2887
326 Ga0496103_0046843 3300048906 Bacteria 2670
327 Ga0496104_0003255 3300048907 Bacteria 14004
328 Ga0496104_0467681 3300048907 Bacteria 1172
329 Ga0496105_0213854 3300048908 Bacteria 1571
330 Ga0496105_0326188 3300048908 Bacteria 1229
331 Ga0496106_0020623 3300048909 Bacteria 4892
332 Ga0496106_0887086 3300048909 Bacteria 705
333 Ga0496107_0009217 3300048910 Bacteria 6839
334 Ga0496107_0846833 3300048910 Bacteria 668
335 Ga0496108_0014063 3300048911 Bacteria 6530
336 Ga0496109_0106437 3300048912 Bacteria 2605
337 Ga0496109_0111289 3300048912 Bacteria 2546
338 Ga0496110_0076329 3300048913 Bacteria 2979
339 Ga0496111_0090113 3300048914 Bacteria 2246
340 Ga0496111_0220705 3300048914 Bacteria 1408
341 Ga0496112_0156538 3300048915 Bacteria 2245
342 Ga0496113_0001108 3300048916 Bacteria 14602
343 Ga0496114_0044120 3300048917 Bacteria 3698
344 Ga0496114_0296338 3300048917 Bacteria 1428
345 Ga0496116_0000149 3300048919 Bacteria 141841
346 Ga0496117_0213141 3300048920 Bacteria 1081
347 Ga0496118_0216450 3300048921 Bacteria 1119
348 Ga0496121_0000720 3300048924 Bacteria 61224
349 Ga0496121_0056479 3300048924 Bacteria 3261
350 Ga0496122_0006339 3300048925 Bacteria 13611
351 Ga0496122_0025675 3300048925 Bacteria 5108
352 Ga0496123_0000830 3300048926 Bacteria 49505
353 Ga0496123_0004529 3300048926 Bacteria 14518
354 Ga0496124_0004393 3300048927 Bacteria 16474
355 Ga0496124_0089188 3300048927 Bacteria 2518
356 Ga0496124_0143304 3300048927 Bacteria 1883
357 Ga0496124_0421551 3300048927 Bacteria 919
358 Ga0496125_0178119 3300048928 Bacteria 1420
359 Ga0496126_0000261 3300048929 Bacteria 112027
360 Ga0496126_0003215 3300048929 Bacteria 20931
361 Ga0496126_0031424 3300048929 Bacteria 5017
362 Ga0501033_0372523 3300049570 Bacteria 998
363 Ga0501034_0162353 3300049571 Bacteria 2205
364 Ga0501034_0171152 3300049571 Bacteria 2139
365 Ga0501034_0629582 3300049571 Bacteria 976
366 Ga0501036_0086463 3300049572 Bacteria 2650
367 Ga0501038_0424026 3300049574 Bacteria 1026
368 Ga0501042_0256567 3300049578 Bacteria 1262
369 Ga0501043_0541190 3300049579 Bacteria 866
370 Ga0501043_0799726 3300049579 Bacteria 682
371 Ga0501073_0696792 3300049589 Bacteria 701
372 Ga0501044_0003900 3300049823 Bacteria 16715
373 Ga0501044_0146232 3300049823 Bacteria 2349
374 Ga0501044_0165431 3300049823 Bacteria 2186
375 Ga0501044_0220138 3300049823 Bacteria 1849
376 nmdc:mga03683_2944_c1 3300050489 Bacteria 5381
377 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
378 nmdc:mga03683_94_c1 3300050489 Bacteria 32220
379 nmdc:mga03n38_424631_c1 3300050490 Bacteria 736
380 nmdc:mga03n38_591_c1 3300050490 Bacteria 7911
381 nmdc:mga00v17_1706_c2 3300050491 Bacteria 8146
382 nmdc:mga00v17_210154_c1 3300050491 Bacteria 1259
383 nmdc:mga00v17_2789_c1 3300050491 Bacteria 8971
384 nmdc:mga00v17_36230_c1 3300050491 Bacteria 2940
385 nmdc:mga0yw44_619269_c1 3300050492 Bacteria 736
386 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
387 nmdc:mga0k408_30931_c1 3300050493 Bacteria 3054
388 nmdc:mga0k408_336553_c1 3300050493 Bacteria 900
389 nmdc:mga0k408_5427_c1 3300050493 Bacteria 6783
390 nmdc:mga0k408_57077_c1 3300050493 Bacteria 2266
391 nmdc:mga0k408_617545_c1 3300050493 Bacteria 639
392 nmdc:mga06z11_300_c1 3300050494 Bacteria 19031
393 nmdc:mga04h51_3092_c1 3300050495 Bacteria 4018
394 nmdc:mga07m45_14505_c1 3300050496 Bacteria 4199
395 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
396 nmdc:mga07m45_28948_c1 3300050496 Bacteria 3059
397 nmdc:mga07m45_338974_c1 3300050496 Bacteria 874
398 nmdc:mga07m45_3826_c1 3300050496 Bacteria 7288
399 nmdc:mga07m45_63394_c1 3300050496 Bacteria 2096
400 nmdc:mga07m45_9_c1 3300050496 Bacteria 171776
401 nmdc:mga0sz30_1249_c1 3300050516 Bacteria 9100
402 nmdc:mga0sz30_50_c1 3300050516 Bacteria 43433
403 nmdc:mga0sz30_84_c1 3300050516 Bacteria 36247
404 Ga0500643_000005 3300053087 Bacteria 539775
405 Ga0500566_0077481 3300053094 Bacteria 1856
406 Ga0500562_019972 3300053108 Bacteria 1738
407 Ga0500607_000473 3300053121 Bacteria 38991
408 Ga0500607_001970 3300053121 Bacteria 17449
409 Ga0500608_013864 3300053122 Bacteria 3584
410 Ga0500618_015502 3300053125 Bacteria 1925
411 Ga0500642_0336586 3300053130 Bacteria 673
412 Ga0500559_0001290 3300053136 Bacteria 14517
413 Ga0500568_0352453 3300053139 Bacteria 534
414 Ga0500590_000274 3300053148 Bacteria 16192
415 Ga0500590_065495 3300053148 Bacteria 1817
416 Ga0500604_0060436 3300053151 Bacteria 1189
417 Ga0500616_0001672 3300053153 Bacteria 20446
418 Ga0500616_0339346 3300053153 Bacteria 614
419 Ga0500637_0001632 3300053178 Bacteria 9626
420 Ga0500645_002935 3300053730 Bacteria 7259
421 Ga0500645_005870 3300053730 Bacteria 4454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2848297114 2848297944 149
2 3300046522 Ga0495643_0063068 Ga0495643_0063068_1044_1502 152
3 3300053087 Ga0500643_000005 Ga0500643_000005_328280_328738 152
4 3300053108 Ga0500562_019972 Ga0500562_019972_527_985 152
5 3300053151 Ga0500604_0060436 Ga0500604_0060436_503_961 152
6 3300053153 Ga0500616_0001672 Ga0500616_0001672_6924_7382 152
7 2162886007 SwRhRL2b_contig_2098723 SwRhRL2b_0309.00009480 153
8 2162886007 SwRhRL2b_contig_780398 SwRhRL2b_0866.00007330 153
9 3300002075 JGI24738J21930_10022556 JGI24738J21930_100225561 153
10 3300002459 JGI24751J29686_10000290 JGI24751J29686_1000029016 153
11 3300005327 Ga0070658_10032460 Ga0070658_100324605 153
12 3300005327 Ga0070658_10062359 Ga0070658_100623593 153
13 3300005327 Ga0070658_10189015 Ga0070658_101890152 153
14 3300005327 Ga0070658_10405769 Ga0070658_104057691 153
15 3300005327 Ga0070658_10594889 Ga0070658_105948892 153
16 3300005327 Ga0070658_10958742 Ga0070658_109587422 153
17 3300005327 Ga0070658_11055124 Ga0070658_110551241 153
18 3300005329 Ga0070683_100046822 Ga0070683_1000468225 153
19 3300005329 Ga0070683_100906285 Ga0070683_1009062851 153
20 3300005330 Ga0070690_100010163 Ga0070690_1000101637 153
21 3300005336 Ga0070680_100014192 Ga0070680_1000141928 153
22 3300005336 Ga0070680_100247186 Ga0070680_1002471861 153
23 3300005339 Ga0070660_100013261 Ga0070660_1000132618 153
24 3300005339 Ga0070660_100017606 Ga0070660_1000176062 153
25 3300005344 Ga0070661_100004232 Ga0070661_10000423213 153
26 3300005344 Ga0070661_100041071 Ga0070661_1000410716 153
27 3300005347 Ga0070668_100046662 Ga0070668_1000466625 153
28 3300005347 Ga0070668_100167867 Ga0070668_1001678672 153
29 3300005347 Ga0070668_100365085 Ga0070668_1003650852 153
30 3300005353 Ga0070669_100001055 Ga0070669_10000105523 153
31 3300005353 Ga0070669_100077123 Ga0070669_1000771232 153
32 3300005354 Ga0070675_100573425 Ga0070675_1005734251 153
33 3300005355 Ga0070671_100000005 Ga0070671_10000000571 153
34 3300005355 Ga0070671_100050221 Ga0070671_1000502215 153
35 3300005366 Ga0070659_100028249 Ga0070659_1000282493 153
36 3300005366 Ga0070659_100044225 Ga0070659_1000442253 153
37 3300005366 Ga0070659_100190894 Ga0070659_1001908941 153
38 3300005367 Ga0070667_100000160 Ga0070667_10000016042 153
39 3300005367 Ga0070667_100002480 Ga0070667_1000024809 153
40 3300005367 Ga0070667_100039174 Ga0070667_1000391745 153
41 3300005367 Ga0070667_101903451 Ga0070667_1019034511 153
42 3300005445 Ga0070708_100564501 Ga0070708_1005645012 153
43 3300005455 Ga0070663_100030672 Ga0070663_1000306724 153
44 3300005455 Ga0070663_100046863 Ga0070663_1000468635 153
45 3300005455 Ga0070663_100193597 Ga0070663_1001935972 153
46 3300005455 Ga0070663_100730078 Ga0070663_1007300782 153
47 3300005456 Ga0070678_100650822 Ga0070678_1006508222 153
48 3300005457 Ga0070662_100000798 Ga0070662_1000007988 153
49 3300005457 Ga0070662_100009032 Ga0070662_1000090327 153
50 3300005457 Ga0070662_100041916 Ga0070662_1000419165 153
51 3300005458 Ga0070681_10099035 Ga0070681_100990352 153
52 3300005458 Ga0070681_10279261 Ga0070681_102792613 153
53 3300005466 Ga0070685_10225930 Ga0070685_102259302 153
54 3300005468 Ga0070707_100215669 Ga0070707_1002156693 153
55 3300005471 Ga0070698_101672785 Ga0070698_1016727851 153
56 3300005530 Ga0070679_100033381 Ga0070679_1000333814 153
57 3300005530 Ga0070679_100078108 Ga0070679_1000781083 153
58 3300005530 Ga0070679_100196112 Ga0070679_1001961122 153
59 3300005535 Ga0070684_100068573 Ga0070684_1000685734 153
60 3300005535 Ga0070684_100121038 Ga0070684_1001210383 153
61 3300005535 Ga0070684_100844304 Ga0070684_1008443042 153
62 3300005539 Ga0068853_100000627 Ga0068853_10000062716 153
63 3300005539 Ga0068853_100848689 Ga0068853_1008486891 153
64 3300005539 Ga0068853_101386015 Ga0068853_1013860151 153
65 3300005544 Ga0070686_100748418 Ga0070686_1007484181 153
66 3300005548 Ga0070665_100005846 Ga0070665_10000584615 153
67 3300005548 Ga0070665_100190010 Ga0070665_1001900104 153
68 3300005548 Ga0070665_101035151 Ga0070665_1010351512 153
69 3300005563 Ga0068855_100006162 Ga0068855_10000616211 153
70 3300005563 Ga0068855_100009292 Ga0068855_1000092927 153
71 3300005563 Ga0068855_100014586 Ga0068855_1000145869 153
72 3300005563 Ga0068855_100426616 Ga0068855_1004266163 153
73 3300005563 Ga0068855_100969338 Ga0068855_1009693382 153
74 3300005563 Ga0068855_101224600 Ga0068855_1012246002 153
75 3300005564 Ga0070664_100026361 Ga0070664_1000263615 153
76 3300005564 Ga0070664_100079567 Ga0070664_1000795672 153
77 3300005577 Ga0068857_100040307 Ga0068857_1000403076 153
78 3300005578 Ga0068854_100038562 Ga0068854_1000385624 153
79 3300005578 Ga0068854_100430031 Ga0068854_1004300312 153
80 3300005578 Ga0068854_100655401 Ga0068854_1006554012 153
81 3300005614 Ga0068856_100013898 Ga0068856_10001389811 153
82 3300005614 Ga0068856_100143458 Ga0068856_1001434584 153
83 3300005616 Ga0068852_100036235 Ga0068852_1000362353 153
84 3300005616 Ga0068852_100100665 Ga0068852_1001006654 153
85 3300005616 Ga0068852_100113316 Ga0068852_1001133164 153
86 3300005616 Ga0068852_100723297 Ga0068852_1007232972 153
87 3300005616 Ga0068852_100798087 Ga0068852_1007980872 153
88 3300005616 Ga0068852_101091588 Ga0068852_1010915881 153
89 3300005616 Ga0068852_101517765 Ga0068852_1015177652 153
90 3300005617 Ga0068859_100220738 Ga0068859_1002207384 153
91 3300005617 Ga0068859_100285522 Ga0068859_1002855222 153
92 3300005618 Ga0068864_100009381 Ga0068864_1000093816 153
93 3300005618 Ga0068864_100144065 Ga0068864_1001440653 153
94 3300005618 Ga0068864_100880947 Ga0068864_1008809472 153
95 3300005719 Ga0068861_100696833 Ga0068861_1006968332 153
96 3300005841 Ga0068863_100000090 Ga0068863_10000009088 153
97 3300005841 Ga0068863_100009722 Ga0068863_1000097225 153
98 3300005841 Ga0068863_100134276 Ga0068863_1001342764 153
99 3300005841 Ga0068863_100583769 Ga0068863_1005837692 153
100 3300005842 Ga0068858_100003571 Ga0068858_10000357117 153
101 3300005842 Ga0068858_100010173 Ga0068858_10001017310 153
102 3300005843 Ga0068860_100000089 Ga0068860_10000008960 153
103 3300005843 Ga0068860_100023485 Ga0068860_10002348510 153
104 3300005843 Ga0068860_100031443 Ga0068860_1000314437 153
105 3300006042 Ga0075368_10001348 Ga0075368_100013485 153
106 3300006048 Ga0075363_100002455 Ga0075363_1000024555 153
107 3300006048 Ga0075363_100028458 Ga0075363_1000284583 153
108 3300006051 Ga0075364_10000854 Ga0075364_1000085413 153
109 3300006051 Ga0075364_10006492 Ga0075364_100064923 153
110 3300006051 Ga0075364_10026011 Ga0075364_100260115 153
111 3300006058 Ga0075432_10000533 Ga0075432_100005335 153
112 3300006177 Ga0075362_10000110 Ga0075362_1000011020 153
113 3300006177 Ga0075362_10001068 Ga0075362_1000106812 153
114 3300006177 Ga0075362_10003739 Ga0075362_100037397 153
115 3300006178 Ga0075367_10008038 Ga0075367_100080385 153
116 3300006186 Ga0075369_10001156 Ga0075369_1000115610 153
117 3300006186 Ga0075369_10015984 Ga0075369_100159843 153
118 3300006186 Ga0075369_10023219 Ga0075369_100232193 153
119 3300006195 Ga0075366_10000832 Ga0075366_1000083221 153
120 3300006195 Ga0075366_10105119 Ga0075366_101051193 153
121 3300006195 Ga0075366_10498820 Ga0075366_104988202 153
122 3300006237 Ga0097621_100106760 Ga0097621_1001067604 153
123 3300006353 Ga0075370_10002739 Ga0075370_100027394 153
124 3300006353 Ga0075370_10003733 Ga0075370_100037335 153
125 3300006353 Ga0075370_10028750 Ga0075370_100287503 153
126 3300006353 Ga0075370_10070257 Ga0075370_100702573 153
127 3300006353 Ga0075370_10078271 Ga0075370_100782712 153
128 3300006353 Ga0075370_10099181 Ga0075370_100991812 153
129 3300006353 Ga0075370_10181147 Ga0075370_101811472 153
130 3300006358 Ga0068871_100133674 Ga0068871_1001336743 153
131 3300006931 Ga0097620_100220727 Ga0097620_1002207274 153
132 3300006931 Ga0097620_100285530 Ga0097620_1002855303 153
133 3300006946 Ga0079104_1009226 Ga0079104_10092264 153
134 3300009092 Ga0105250_10019061 Ga0105250_100190615 153
135 3300009093 Ga0105240_10796746 Ga0105240_107967462 153
136 3300009093 Ga0105240_10909419 Ga0105240_109094192 153
137 3300009094 Ga0111539_10464773 Ga0111539_104647733 153
138 3300009101 Ga0105247_10083386 Ga0105247_100833861 153
139 3300009101 Ga0105247_10314283 Ga0105247_103142832 153
140 3300009148 Ga0105243_10113368 Ga0105243_101133682 153
141 3300009174 Ga0105241_10047031 Ga0105241_100470312 153
142 3300009174 Ga0105241_10394251 Ga0105241_103942512 153
143 3300009177 Ga0105248_10040914 Ga0105248_100409149 153
144 3300009177 Ga0105248_10041068 Ga0105248_100410685 153
145 3300011119 Ga0105246_10000074 Ga0105246_1000007421 153
146 3300013100 Ga0157373_10011640 Ga0157373_100116409 153
147 3300013100 Ga0157373_10186092 Ga0157373_101860921 153
148 3300013102 Ga0157371_10001651 Ga0157371_1000165125 153
149 3300013102 Ga0157371_10028260 Ga0157371_100282603 153
150 3300013102 Ga0157371_10957841 Ga0157371_109578411 153
151 3300013104 Ga0157370_10028285 Ga0157370_100282857 153
152 3300013105 Ga0157369_10000384 Ga0157369_1000038448 153
153 3300013105 Ga0157369_12109281 Ga0157369_121092811 153
154 3300013306 Ga0163162_10103499 Ga0163162_101034993 153
155 3300013307 Ga0157372_10004422 Ga0157372_1000442211 153
156 3300013307 Ga0157372_11767936 Ga0157372_117679361 153
157 3300013308 Ga0157375_10792568 Ga0157375_107925682 153
158 3300014326 Ga0157380_10373319 Ga0157380_103733192 153
159 3300014745 Ga0157377_10579750 Ga0157377_105797502 153
160 3300014968 Ga0157379_10165390 Ga0157379_101653904 153
161 3300014969 Ga0157376_11571305 Ga0157376_115713051 153
162 3300017792 Ga0163161_10055785 Ga0163161_100557852 153
163 3300025315 Ga0207697_10024048 Ga0207697_100240482 153
164 3300025893 Ga0207682_10159901 Ga0207682_101599012 153
165 3300025900 Ga0207710_10044581 Ga0207710_100445811 153
166 3300025903 Ga0207680_10479144 Ga0207680_104791442 153
167 3300025904 Ga0207647_10554594 Ga0207647_105545942 153
168 3300025909 Ga0207705_10003812 Ga0207705_1000381212 153
169 3300025909 Ga0207705_10039655 Ga0207705_100396555 153
170 3300025909 Ga0207705_10183344 Ga0207705_101833442 153
171 3300025909 Ga0207705_10194551 Ga0207705_101945512 153
172 3300025909 Ga0207705_10570469 Ga0207705_105704692 153
173 3300025911 Ga0207654_10088595 Ga0207654_100885953 153
174 3300025911 Ga0207654_10527281 Ga0207654_105272811 153
175 3300025912 Ga0207707_10064046 Ga0207707_100640464 153
176 3300025917 Ga0207660_10080859 Ga0207660_100808592 153
177 3300025917 Ga0207660_10202273 Ga0207660_102022733 153
178 3300025919 Ga0207657_10000156 Ga0207657_1000015610 153
179 3300025919 Ga0207657_10014245 Ga0207657_1001424510 153
180 3300025919 Ga0207657_10217140 Ga0207657_102171403 153
181 3300025920 Ga0207649_10030530 Ga0207649_100305302 153
182 3300025921 Ga0207652_10003649 Ga0207652_1000364910 153
183 3300025921 Ga0207652_10089727 Ga0207652_100897273 153
184 3300025921 Ga0207652_10101271 Ga0207652_101012712 153
185 3300025921 Ga0207652_10185051 Ga0207652_101850513 153
186 3300025922 Ga0207646_10711925 Ga0207646_107119252 153
187 3300025923 Ga0207681_10000288 Ga0207681_1000028827 153
188 3300025923 Ga0207681_10143912 Ga0207681_101439122 153
189 3300025925 Ga0207650_10725094 Ga0207650_107250942 153
190 3300025926 Ga0207659_10487624 Ga0207659_104876242 153
191 3300025931 Ga0207644_10000008 Ga0207644_10000008254 153
192 3300025931 Ga0207644_10052625 Ga0207644_100526254 153
193 3300025931 Ga0207644_10380211 Ga0207644_103802113 153
194 3300025932 Ga0207690_10105652 Ga0207690_101056522 153
195 3300025932 Ga0207690_10112436 Ga0207690_101124364 153
196 3300025932 Ga0207690_10674811 Ga0207690_106748111 153
197 3300025932 Ga0207690_10969596 Ga0207690_109695962 153
198 3300025933 Ga0207706_10001346 Ga0207706_1000134625 153
199 3300025933 Ga0207706_10003722 Ga0207706_1000372214 153
200 3300025933 Ga0207706_10008748 Ga0207706_100087488 153
201 3300025940 Ga0207691_10934794 Ga0207691_109347942 153
202 3300025941 Ga0207711_10216263 Ga0207711_102162633 153
203 3300025941 Ga0207711_10241827 Ga0207711_102418271 153
204 3300025944 Ga0207661_10245416 Ga0207661_102454163 153
205 3300025944 Ga0207661_10293639 Ga0207661_102936392 153
206 3300025945 Ga0207679_10053211 Ga0207679_100532112 153
207 3300025949 Ga0207667_10003313 Ga0207667_100033134 153
208 3300025949 Ga0207667_10004614 Ga0207667_1000461417 153
209 3300025949 Ga0207667_10037411 Ga0207667_100374119 153
210 3300025949 Ga0207667_10047986 Ga0207667_100479862 153
211 3300025949 Ga0207667_10104022 Ga0207667_101040224 153
212 3300025961 Ga0207712_10130400 Ga0207712_101304004 153
213 3300025972 Ga0207668_10048867 Ga0207668_100488674 153
214 3300025972 Ga0207668_10448090 Ga0207668_104480902 153
215 3300025981 Ga0207640_10029659 Ga0207640_100296594 153
216 3300025981 Ga0207640_10932736 Ga0207640_109327361 153
217 3300025986 Ga0207658_10001492 Ga0207658_100014927 153
218 3300025986 Ga0207658_10003386 Ga0207658_100033866 153
219 3300025986 Ga0207658_10201647 Ga0207658_102016472 153
220 3300026035 Ga0207703_10005939 Ga0207703_1000593911 153
221 3300026035 Ga0207703_10015828 Ga0207703_100158286 153
222 3300026041 Ga0207639_10000808 Ga0207639_100008087 153
223 3300026067 Ga0207678_10035674 Ga0207678_100356745 153
224 3300026067 Ga0207678_10043681 Ga0207678_100436813 153
225 3300026067 Ga0207678_10045196 Ga0207678_100451962 153
226 3300026067 Ga0207678_10661370 Ga0207678_106613702 153
227 3300026078 Ga0207702_10007553 Ga0207702_1000755313 153
228 3300026078 Ga0207702_10500402 Ga0207702_105004021 153
229 3300026078 Ga0207702_10587723 Ga0207702_105877232 153
230 3300026088 Ga0207641_10000069 Ga0207641_1000006989 153
231 3300026088 Ga0207641_10002819 Ga0207641_1000281917 153
232 3300026088 Ga0207641_10184824 Ga0207641_101848242 153
233 3300026095 Ga0207676_10016695 Ga0207676_100166956 153
234 3300026095 Ga0207676_10143464 Ga0207676_101434643 153
235 3300026095 Ga0207676_10326580 Ga0207676_103265802 153
236 3300026116 Ga0207674_10109713 Ga0207674_101097132 153
237 3300026116 Ga0207674_10584256 Ga0207674_105842563 153
238 3300026121 Ga0207683_10054861 Ga0207683_100548615 153
239 3300026142 Ga0207698_10018961 Ga0207698_100189613 153
240 3300026142 Ga0207698_10066395 Ga0207698_100663953 153
241 3300026142 Ga0207698_10087401 Ga0207698_100874015 153
242 3300026142 Ga0207698_10093027 Ga0207698_100930274 153
243 3300026142 Ga0207698_10661078 Ga0207698_106610782 153
244 3300026142 Ga0207698_10758242 Ga0207698_107582421 153
245 3300026142 Ga0207698_11015385 Ga0207698_110153852 153
246 3300026142 Ga0207698_11106495 Ga0207698_111064952 153
247 3300027111 Ga0209281_1012035 Ga0209281_10120353 153
248 3300027665 Ga0209983_1010759 Ga0209983_10107593 153
249 3300027866 Ga0209813_10000027 Ga0209813_1000002716 153
250 3300027876 Ga0209974_10009642 Ga0209974_100096423 153
251 3300027876 Ga0209974_10011556 Ga0209974_100115563 153
252 3300027907 Ga0207428_10069403 Ga0207428_100694034 153
253 3300028379 Ga0268266_10035190 Ga0268266_100351902 153
254 3300028379 Ga0268266_10417314 Ga0268266_104173142 153
255 3300028380 Ga0268265_10013638 Ga0268265_100136385 153
256 3300028380 Ga0268265_10418926 Ga0268265_104189261 153
257 3300028381 Ga0268264_10000160 Ga0268264_1000016088 153
258 3300028381 Ga0268264_10013326 Ga0268264_100133263 153
259 3300031250 Ga0265331_10041051 Ga0265331_100410514 153
260 3300031251 Ga0265327_10072308 Ga0265327_100723082 153
261 3300031548 Ga0307408_100071967 Ga0307408_1000719672 153
262 3300031616 Ga0307508_10010513 Ga0307508_100105135 153
263 3300031691 Ga0316579_10025901 Ga0316579_100259013 153
264 3300031727 Ga0316576_11173971 Ga0316576_111739711 153
265 3300031731 Ga0307405_10866248 Ga0307405_108662482 153
266 3300031824 Ga0307413_10131392 Ga0307413_101313923 153
267 3300031824 Ga0307413_10386392 Ga0307413_103863922 153
268 3300031824 Ga0307413_10645397 Ga0307413_106453972 153
269 3300031852 Ga0307410_10076541 Ga0307410_100765413 153
270 3300031852 Ga0307410_10344824 Ga0307410_103448241 153
271 3300031901 Ga0307406_10018370 Ga0307406_100183704 153
272 3300031911 Ga0307412_10044566 Ga0307412_100445663 153
273 3300031911 Ga0307412_10148541 Ga0307412_101485412 153
274 3300031911 Ga0307412_10247204 Ga0307412_102472043 153
275 3300031911 Ga0307412_10484776 Ga0307412_104847762 153
276 3300031995 Ga0307409_100174218 Ga0307409_1001742182 153
277 3300032002 Ga0307416_100018028 Ga0307416_1000180285 153
278 3300032004 Ga0307414_10023564 Ga0307414_100235644 153
279 3300032004 Ga0307414_10041877 Ga0307414_100418772 153
280 3300032004 Ga0307414_10076247 Ga0307414_100762471 153
281 3300032004 Ga0307414_10113162 Ga0307414_101131623 153
282 3300032004 Ga0307414_10218440 Ga0307414_102184402 153
283 3300032004 Ga0307414_10291758 Ga0307414_102917582 153
284 3300032005 Ga0307411_10170337 Ga0307411_101703371 153
285 3300032005 Ga0307411_10271766 Ga0307411_102717663 153
286 3300032005 Ga0307411_10282551 Ga0307411_102825513 153
287 3300032126 Ga0307415_100190933 Ga0307415_1001909332 153
288 3300032126 Ga0307415_101211299 Ga0307415_1012112992 153
289 3300032133 Ga0316583_10006180 Ga0316583_100061803 153
290 3300033180 Ga0307510_10145343 Ga0307510_101453433 153
291 3300035114 Ga0373939_0432033 Ga0373939_0432033_63_524 153
292 3300035691 Ga0373931_0038570 Ga0373931_0038570_1353_1814 153
293 3300035692 Ga0373935_1356645 Ga0373935_1356645_35_496 153
294 3300036647 Ga0316582_0381737 Ga0316582_0381737_240_701 153
295 3300036712 Ga0316584_0008286 Ga0316584_0008286_1315_1776 153
296 3300041512 Ga0451853_1261533 Ga0451853_1261533_153_614 153
297 3300042005 Ga0439448_0128838 Ga0439448_0128838_148_690 153
298 3300042116 Ga0450912_009450 Ga0450912_009450_248_712 153
299 3300042134 Ga0450898_123778 Ga0450898_123778_14_475 153
300 3300042436 Ga0439435_0003482 Ga0439435_0003482_1156_1620 153
301 3300042530 Ga0450916_023502 Ga0450916_023502_302_766 153
302 3300046471 Ga0495650_0003812 Ga0495650_0003812_2765_3226 153
303 3300046471 Ga0495650_0168990 Ga0495650_0168990_91_552 153
304 3300046500 Ga0495596_0000119 Ga0495596_0000119_44602_45063 153
305 3300046500 Ga0495596_0001077 Ga0495596_0001077_7401_7862 153
306 3300046501 Ga0495607_0003215 Ga0495607_0003215_1251_1712 153
307 3300046507 Ga0495606_0006170 Ga0495606_0006170_9226_9687 153
308 3300046507 Ga0495606_0461351 Ga0495606_0461351_64_525 153
309 3300046512 Ga0495610_0000050 Ga0495610_0000050_105223_105684 153
310 3300046512 Ga0495610_0000352 Ga0495610_0000352_38838_39299 153
311 3300046513 Ga0495616_0089326 Ga0495616_0089326_854_1315 153
312 3300046515 Ga0495620_0085579 Ga0495620_0085579_215_676 153
313 3300046518 Ga0495631_0133855 Ga0495631_0133855_207_668 153
314 3300046519 Ga0495632_0003354 Ga0495632_0003354_8358_8819 153
315 3300046519 Ga0495632_0008427 Ga0495632_0008427_1750_2211 153
316 3300046522 Ga0495643_0000036 Ga0495643_0000036_139685_140146 153
317 3300046522 Ga0495643_0014146 Ga0495643_0014146_2391_2852 153
318 3300046522 Ga0495643_0079462 Ga0495643_0079462_319_780 153
319 3300046538 Ga0495609_0005187 Ga0495609_0005187_978_1439 153
320 3300046558 Ga0495633_0173359 Ga0495633_0173359_362_823 153
321 3300046660 Ga0495625_0007251 Ga0495625_0007251_3055_3516 153
322 3300047470 Ga0495681_0000095 Ga0495681_0000095_9526_9987 153
323 3300047472 Ga0495686_0499496 Ga0495686_0499496_42_503 153
324 3300048090 Ga0495615_0000158 Ga0495615_0000158_8300_8761 153
325 3300048091 Ga0495626_0000585 Ga0495626_0000585_245_706 153
326 3300048904 Ga0496101_0064377 Ga0496101_0064377_759_1220 153
327 3300048905 Ga0496102_0328132 Ga0496102_0328132_529_990 153
328 3300048905 Ga0496102_0413789 Ga0496102_0413789_415_876 153
329 3300048905 Ga0496102_0647097 Ga0496102_0647097_254_715 153
330 3300048906 Ga0496103_0039843 Ga0496103_0039843_415_876 153
331 3300048906 Ga0496103_0046843 Ga0496103_0046843_1139_1600 153
332 3300048907 Ga0496104_0003255 Ga0496104_0003255_10898_11359 153
333 3300048907 Ga0496104_0467681 Ga0496104_0467681_91_552 153
334 3300048908 Ga0496105_0213854 Ga0496105_0213854_100_561 153
335 3300048908 Ga0496105_0326188 Ga0496105_0326188_444_905 153
336 3300048909 Ga0496106_0020623 Ga0496106_0020623_174_635 153
337 3300048909 Ga0496106_0887086 Ga0496106_0887086_213_674 153
338 3300048910 Ga0496107_0009217 Ga0496107_0009217_4968_5429 153
339 3300048910 Ga0496107_0846833 Ga0496107_0846833_174_635 153
340 3300048911 Ga0496108_0014063 Ga0496108_0014063_3879_4340 153
341 3300048912 Ga0496109_0106437 Ga0496109_0106437_471_932 153
342 3300048912 Ga0496109_0111289 Ga0496109_0111289_1677_2138 153
343 3300048913 Ga0496110_0076329 Ga0496110_0076329_1891_2352 153
344 3300048914 Ga0496111_0090113 Ga0496111_0090113_1599_2060 153
345 3300048914 Ga0496111_0220705 Ga0496111_0220705_373_834 153
346 3300048915 Ga0496112_0156538 Ga0496112_0156538_149_610 153
347 3300048916 Ga0496113_0001108 Ga0496113_0001108_4119_4580 153
348 3300048917 Ga0496114_0044120 Ga0496114_0044120_1008_1469 153
349 3300048917 Ga0496114_0296338 Ga0496114_0296338_734_1195 153
350 3300048919 Ga0496116_0000149 Ga0496116_0000149_64586_65047 153
351 3300048920 Ga0496117_0213141 Ga0496117_0213141_252_713 153
352 3300048921 Ga0496118_0216450 Ga0496118_0216450_113_574 153
353 3300048924 Ga0496121_0000720 Ga0496121_0000720_21510_21971 153
354 3300048924 Ga0496121_0056479 Ga0496121_0056479_1627_2088 153
355 3300048925 Ga0496122_0006339 Ga0496122_0006339_5027_5488 153
356 3300048925 Ga0496122_0025675 Ga0496122_0025675_3400_3861 153
357 3300048926 Ga0496123_0000830 Ga0496123_0000830_39854_40315 153
358 3300048926 Ga0496123_0004529 Ga0496123_0004529_6751_7212 153
359 3300048927 Ga0496124_0004393 Ga0496124_0004393_6366_6827 153
360 3300048927 Ga0496124_0089188 Ga0496124_0089188_1090_1551 153
361 3300048927 Ga0496124_0143304 Ga0496124_0143304_89_550 153
362 3300048927 Ga0496124_0421551 Ga0496124_0421551_92_553 153
363 3300048928 Ga0496125_0178119 Ga0496125_0178119_708_1169 153
364 3300048929 Ga0496126_0000261 Ga0496126_0000261_76496_76957 153
365 3300048929 Ga0496126_0003215 Ga0496126_0003215_9045_9506 153
366 3300048929 Ga0496126_0031424 Ga0496126_0031424_3628_4089 153
367 3300049570 Ga0501033_0372523 Ga0501033_0372523_214_675 153
368 3300049571 Ga0501034_0162353 Ga0501034_0162353_536_1057 153
369 3300049571 Ga0501034_0171152 Ga0501034_0171152_1121_1582 153
370 3300049571 Ga0501034_0629582 Ga0501034_0629582_237_698 153
371 3300049572 Ga0501036_0086463 Ga0501036_0086463_648_1169 153
372 3300049574 Ga0501038_0424026 Ga0501038_0424026_257_718 153
373 3300049578 Ga0501042_0256567 Ga0501042_0256567_169_630 153
374 3300049579 Ga0501043_0541190 Ga0501043_0541190_20_481 153
375 3300049579 Ga0501043_0799726 Ga0501043_0799726_33_494 153
376 3300049589 Ga0501073_0696792 Ga0501073_0696792_27_488 153
377 3300049823 Ga0501044_0003900 Ga0501044_0003900_8915_9376 153
378 3300049823 Ga0501044_0146232 Ga0501044_0146232_1558_2019 153
379 3300049823 Ga0501044_0165431 Ga0501044_0165431_720_1241 153
380 3300049823 Ga0501044_0220138 Ga0501044_0220138_955_1416 153
381 3300050489 nmdc:mga03683_2944_c1 nmdc:mga03683_2944_c1_3205_3666 153
382 3300050489 nmdc:mga03683_3_c1 nmdc:mga03683_3_c1_159582_160043 153
383 3300050489 nmdc:mga03683_94_c1 nmdc:mga03683_94_c1_7577_8038 153
384 3300050490 nmdc:mga03n38_424631_c1 nmdc:mga03n38_424631_c1_124_585 153
385 3300050490 nmdc:mga03n38_591_c1 nmdc:mga03n38_591_c1_1553_2014 153
386 3300050491 nmdc:mga00v17_1706_c2 nmdc:mga00v17_1706_c2_6499_6960 153
387 3300050491 nmdc:mga00v17_210154_c1 nmdc:mga00v17_210154_c1_539_1000 153
388 3300050491 nmdc:mga00v17_2789_c1 nmdc:mga00v17_2789_c1_5411_5872 153
389 3300050491 nmdc:mga00v17_36230_c1 nmdc:mga00v17_36230_c1_1402_1863 153
390 3300050492 nmdc:mga0yw44_619269_c1 nmdc:mga0yw44_619269_c1_152_613 153
391 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_390580_391041 153
392 3300050493 nmdc:mga0k408_30931_c1 nmdc:mga0k408_30931_c1_1509_1970 153
393 3300050493 nmdc:mga0k408_336553_c1 nmdc:mga0k408_336553_c1_240_701 153
394 3300050493 nmdc:mga0k408_5427_c1 nmdc:mga0k408_5427_c1_2274_2735 153
395 3300050493 nmdc:mga0k408_57077_c1 nmdc:mga0k408_57077_c1_1700_2161 153
396 3300050493 nmdc:mga0k408_617545_c1 nmdc:mga0k408_617545_c1_150_611 153
397 3300050494 nmdc:mga06z11_300_c1 nmdc:mga06z11_300_c1_8137_8598 153
398 3300050495 nmdc:mga04h51_3092_c1 nmdc:mga04h51_3092_c1_279_740 153
399 3300050496 nmdc:mga07m45_14505_c1 nmdc:mga07m45_14505_c1_331_792 153
400 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_285486_285947 153
401 3300050496 nmdc:mga07m45_28948_c1 nmdc:mga07m45_28948_c1_1137_1598 153
402 3300050496 nmdc:mga07m45_338974_c1 nmdc:mga07m45_338974_c1_98_559 153
403 3300050496 nmdc:mga07m45_3826_c1 nmdc:mga07m45_3826_c1_3924_4385 153
404 3300050496 nmdc:mga07m45_63394_c1 nmdc:mga07m45_63394_c1_968_1429 153
405 3300050496 nmdc:mga07m45_9_c1 nmdc:mga07m45_9_c1_132424_132885 153
406 3300050516 nmdc:mga0sz30_1249_c1 nmdc:mga0sz30_1249_c1_7640_8101 153
407 3300050516 nmdc:mga0sz30_50_c1 nmdc:mga0sz30_50_c1_36639_37100 153
408 3300050516 nmdc:mga0sz30_84_c1 nmdc:mga0sz30_84_c1_11560_12021 153
409 3300053094 Ga0500566_0077481 Ga0500566_0077481_651_1112 153
410 3300053121 Ga0500607_000473 Ga0500607_000473_7331_7792 153
411 3300053121 Ga0500607_001970 Ga0500607_001970_166_627 153
412 3300053122 Ga0500608_013864 Ga0500608_013864_1401_1862 153
413 3300053125 Ga0500618_015502 Ga0500618_015502_1037_1528 153
414 3300053130 Ga0500642_0336586 Ga0500642_0336586_118_579 153
415 3300053136 Ga0500559_0001290 Ga0500559_0001290_6652_7113 153
416 3300053139 Ga0500568_0352453 Ga0500568_0352453_30_491 153
417 3300053148 Ga0500590_000274 Ga0500590_000274_8152_8643 153
418 3300053148 Ga0500590_065495 Ga0500590_065495_911_1372 153
419 3300053153 Ga0500616_0339346 Ga0500616_0339346_101_562 153
420 3300053178 Ga0500637_0001632 Ga0500637_0001632_7457_7918 153
421 3300053730 Ga0500645_002935 Ga0500645_002935_3804_4265 153
422 3300053730 Ga0500645_005870 Ga0500645_005870_1425_1886 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00359

PTS_EIIA_2

Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2

6

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a6j-assembly1.cif.gz_A-2 nitrogen regulatory bacterial protein iia-nitrogen 0.9646 6 146
3urr-assembly1.cif.gz_A structure of pts iia-like nitrogen-regulatory protein ptsn (bth_i0484) (ptsn) 0.9616 7 144
3urr-assembly1.cif.gz_B structure of pts iia-like nitrogen-regulatory protein ptsn (bth_i0484) (ptsn) 0.9427 7 144
4gqx-assembly1.cif.gz_B crystal structure of eiia(ntr) from burkholderia pseudomallei 0.9381 3 144
1a6j-assembly1.cif.gz_B-2 nitrogen regulatory bacterial protein iia-nitrogen 0.9296 5 149
ID Description Score Start End Superfamily
af_P69829_1_163_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9623 6 147 3.40.930.10
3urrA00 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9615 7 144 3.40.930.10
af_Q2FUX0_504_650_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9292 4 144 3.40.930.10
af_Q2G239_1_154_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9065 7 151 3.40.930.10
af_P32155_2_148_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.901 6 149 3.40.930.10
ID Description Score Start End GO Terms
AF-A0A529ZN94-F1-model_v4 deleted 0.9857 7 134
AF-A0A1H8HFF2-F1-model_v4 PTS IIA-like nitrogen-regulatory protein PtsN 0.9813 7 145 GO:0030295
AF-A0A1G2WQW5-F1-model_v4 deleted 0.9811 7 144
AF-K2H9N2-F1-model_v4 Nitrogen regulatory protein 0.9798 17 146 GO:0030295
AF-A0A1L3J9E7-F1-model_v4 PTS EIIA type-2 domain-containing protein 0.9796 2 144 GO:0030295

Feature Viewer

pLDDT pTM Quality
92.26 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map