F437699

General Info

Members Datasets Scaffolds Average Seq Length
412 250 412 122

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10067479|rootH1_100674792
Length 124
Sequence MANEKQLLEMFGKIEGDVNGVIATAVVDLESGMTLAAKTNRSDFDLAVASAYNSELVKQKMKIMRALNLKATLEDMLITLSDQFHLIKFLPGGSSFVYLAADRSGTNLAILRNAVNKHVGALPA

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
129 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
130 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
131 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
132 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
133 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
136 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
139 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
180 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
199 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
206 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
207 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
208 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
213 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
217 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
218 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
219 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
220 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
221 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
222 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
230 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
231 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
232 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
233 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
237 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
238 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
239 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
240 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
241 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
242 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.2
Metatranscriptomes 6.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.64
Nodule 0
Rhizoplane 7.28
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 14.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10015903 3300003316 Bacteria 1038
2 rootH1_10067479 3300003316 Bacteria 3071
3 rootH2_10171781 3300003320 Bacteria 1231
4 rootL2_10032189 3300003322 Bacteria 3430
5 rootL2_10091734 3300003322 Unclassified 1093
6 rootH1_10140546 3300003323 Bacteria 1503
7 rootH1_10175959 3300003323 Bacteria 2351
8 rootH1_10271981 3300003323 Bacteria 1485
9 Ga0058859_11639446 3300004798 Bacteria 585
10 Ga0058859_11681338 3300004798 Bacteria 545
11 Ga0058861_10966217 3300004800 Bacteria 901
12 Ga0070658_10095034 3300005327 Bacteria 2460
13 Ga0070690_100760288 3300005330 Bacteria 749
14 Ga0070670_100040891 3300005331 Bacteria 3984
15 Ga0068869_100015010 3300005334 Bacteria 5183
16 Ga0068869_100491865 3300005334 Bacteria 1023
17 Ga0068869_100641251 3300005334 Bacteria 901
18 Ga0068869_100739433 3300005334 Bacteria 841
19 Ga0070666_10196017 3300005335 Bacteria 1420
20 Ga0070682_100011819 3300005337 Bacteria 4995
21 Ga0068868_100376780 3300005338 Bacteria 1220
22 Ga0070689_100546167 3300005340 Bacteria 998
23 Ga0070689_100649470 3300005340 Bacteria 917
24 Ga0070689_100838975 3300005340 Bacteria 810
25 Ga0070687_100492988 3300005343 Bacteria 823
26 Ga0070687_101311859 3300005343 Bacteria 538
27 Ga0070692_10689454 3300005345 Bacteria 686
28 Ga0070671_100000308 3300005355 Bacteria 33288
29 Ga0070688_100317411 3300005365 Bacteria 1131
30 Ga0070667_100012521 3300005367 Bacteria 7016
31 Ga0070667_100490262 3300005367 Bacteria 1126
32 Ga0070701_10087967 3300005438 Bacteria 1696
33 Ga0070705_101054063 3300005440 Bacteria 663
34 Ga0070705_101178004 3300005440 Unclassified 630
35 Ga0070694_101352697 3300005444 Bacteria 600
36 Ga0070685_10131222 3300005466 Bacteria 1567
37 Ga0070685_10617987 3300005466 Bacteria 782
38 Ga0070686_101176157 3300005544 Unclassified 636
39 Ga0070695_100341623 3300005545 Bacteria 1119
40 Ga0070665_100121688 3300005548 Bacteria 2611
41 Ga0070665_101299635 3300005548 Bacteria 737
42 Ga0070704_100549423 3300005549 Bacteria 1009
43 Ga0068855_100002055 3300005563 Bacteria 24938
44 Ga0068855_100012162 3300005563 Bacteria 10401
45 Ga0068855_100970719 3300005563 Bacteria 894
46 Ga0070702_101240543 3300005615 Bacteria 603
47 Ga0070702_101869186 3300005615 Bacteria 503
48 Ga0068859_100000316 3300005617 Bacteria 48198
49 Ga0068864_100337533 3300005618 Bacteria 1419
50 Ga0068864_101228741 3300005618 Bacteria 748
51 Ga0068866_10509018 3300005718 Bacteria 798
52 Ga0068861_100057620 3300005719 Bacteria 2968
53 Ga0068861_100658560 3300005719 Bacteria 968
54 Ga0068861_101338875 3300005719 Bacteria 697
55 Ga0068863_100195221 3300005841 Bacteria 1946
56 Ga0068858_100001821 3300005842 Bacteria 21695
57 Ga0068860_100010528 3300005843 Bacteria 9138
58 Ga0070717_10027826 3300006028 Bacteria 4520
59 Ga0075365_10039127 3300006038 Bacteria 3086
60 Ga0075368_10029653 3300006042 Bacteria 2116
61 Ga0075363_100364749 3300006048 Bacteria 845
62 Ga0075364_10569897 3300006051 Unclassified 774
63 Ga0075362_10303723 3300006177 Bacteria 792
64 Ga0075362_10350088 3300006177 Bacteria 739
65 Ga0075367_10052612 3300006178 Bacteria 2411
66 Ga0075367_10488708 3300006178 Bacteria 781
67 Ga0075367_10546629 3300006178 Bacteria 735
68 Ga0075366_10584898 3300006195 Bacteria 692
69 Ga0075366_10630231 3300006195 Bacteria 665
70 Ga0075370_10362141 3300006353 Bacteria 867
71 Ga0068871_100359145 3300006358 Bacteria 1290
72 Ga0075430_100552225 3300006846 Bacteria 950
73 Ga0075430_100701267 3300006846 Unclassified 834
74 Ga0075430_101085419 3300006846 Unclassified 659
75 Ga0075431_100045554 3300006847 Bacteria 4522
76 Ga0068865_100037145 3300006881 Bacteria 3288
77 Ga0097620_100000316 3300006931 Bacteria 48198
78 Ga0105250_10101951 3300009092 Bacteria 1171
79 Ga0105240_10009786 3300009093 Bacteria 13536
80 Ga0111539_10019293 3300009094 Bacteria 8419
81 Ga0111539_10214059 3300009094 Bacteria 2245
82 Ga0111539_10551249 3300009094 Bacteria 1343
83 Ga0111539_11300642 3300009094 Unclassified 844
84 Ga0105245_10110367 3300009098 Bacteria 2557
85 Ga0105245_13015403 3300009098 Unclassified 522
86 Ga0105247_10000119 3300009101 Bacteria 76975
87 Ga0105241_10199057 3300009174 Bacteria 1672
88 Ga0105241_10420736 3300009174 Bacteria 1176
89 Ga0105241_10528680 3300009174 Bacteria 1056
90 Ga0105242_10177396 3300009176 Bacteria 1877
91 Ga0105242_11704780 3300009176 Bacteria 666
92 Ga0105248_10053806 3300009177 Bacteria 4516
93 Ga0105248_12049681 3300009177 Bacteria 650
94 Ga0105248_12331429 3300009177 Unclassified 609
95 Ga0105237_11195548 3300009545 Unclassified 767
96 Ga0105237_11207488 3300009545 Bacteria 763
97 Ga0105238_10494447 3300009551 Bacteria 1223
98 Ga0105238_10967178 3300009551 Unclassified 871
99 Ga0105238_11036979 3300009551 Bacteria 842
100 Ga0105249_11109592 3300009553 Unclassified 861
101 Ga0105249_11122736 3300009553 Bacteria 856
102 Ga0105239_10159511 3300010375 Unclassified 2519
103 Ga0105239_10519026 3300010375 Bacteria 1355
104 Ga0105239_10561557 3300010375 Bacteria 1300
105 Ga0157374_10134270 3300013296 Bacteria 2398
106 Ga0157374_11496173 3300013296 Unclassified 698
107 Ga0157374_11721861 3300013296 Bacteria 652
108 Ga0157378_10152705 3300013297 Bacteria 2152
109 Ga0157378_11445324 3300013297 Bacteria 731
110 Ga0157378_11985051 3300013297 Bacteria 632
111 Ga0157375_12065095 3300013308 Bacteria 678
112 Ga0163163_10003650 3300014325 Bacteria 13084
113 Ga0157380_10051702 3300014326 Bacteria 3251
114 Ga0182008_10267311 3300014497 Bacteria 886
115 Ga0157379_10009373 3300014968 Bacteria 8531
116 Ga0157376_12220635 3300014969 Bacteria 588
117 Ga0206352_10347464 3300020078 Bacteria 1206
118 Ga0213876_10022031 3300021384 Bacteria 3370
119 Ga0213876_10033645 3300021384 Bacteria 2702
120 Ga0207642_10347436 3300025899 Bacteria 874
121 Ga0207710_10001054 3300025900 Bacteria 14250
122 Ga0207680_10269308 3300025903 Bacteria 1181
123 Ga0207680_10278427 3300025903 Unclassified 1162
124 Ga0207654_10123329 3300025911 Bacteria 1630
125 Ga0207654_10386375 3300025911 Bacteria 970
126 Ga0207654_10867045 3300025911 Bacteria 654
127 Ga0207695_10023143 3300025913 Bacteria 7029
128 Ga0207695_10378266 3300025913 Bacteria 1302
129 Ga0207695_10804009 3300025913 Bacteria 820
130 Ga0207671_11105954 3300025914 Bacteria 622
131 Ga0207662_10167571 3300025918 Bacteria 1407
132 Ga0207694_10673763 3300025924 Unclassified 872
133 Ga0207694_10764076 3300025924 Bacteria 816
134 Ga0207650_10296123 3300025925 Bacteria 1320
135 Ga0207687_10082232 3300025927 Bacteria 2329
136 Ga0207687_10085715 3300025927 Bacteria 2286
137 Ga0207644_10034614 3300025931 Bacteria 3535
138 Ga0207670_10163926 3300025936 Bacteria 1662
139 Ga0207704_10311943 3300025938 Bacteria 1210
140 Ga0207704_10760958 3300025938 Bacteria 806
141 Ga0207711_10735984 3300025941 Bacteria 919
142 Ga0207689_10010672 3300025942 Bacteria 7904
143 Ga0207689_10044730 3300025942 Bacteria 3661
144 Ga0207689_11050651 3300025942 Unclassified 687
145 Ga0207689_11131307 3300025942 Bacteria 660
146 Ga0207667_10000476 3300025949 Bacteria 53499
147 Ga0207667_10000977 3300025949 Bacteria 36491
148 Ga0207667_10001652 3300025949 Bacteria 28106
149 Ga0207667_10871477 3300025949 Bacteria 894
150 Ga0207712_11639569 3300025961 Bacteria 576
151 Ga0207640_10866711 3300025981 Bacteria 787
152 Ga0207658_10003495 3300025986 Bacteria 11088
153 Ga0207658_10271334 3300025986 Bacteria 1450
154 Ga0207677_10296006 3300026023 Bacteria 1335
155 Ga0207703_10015005 3300026035 Bacteria 6046
156 Ga0207641_10004867 3300026088 Bacteria 11558
157 Ga0207676_10183401 3300026095 Bacteria 1835
158 Ga0207675_101311475 3300026118 Unclassified 744
159 Ga0207683_11342057 3300026121 Bacteria 662
160 Ga0209813_10103630 3300027866 Bacteria 971
161 Ga0207428_10073150 3300027907 Bacteria 2690
162 Ga0268266_11173061 3300028379 Bacteria 743
163 Ga0268265_10425645 3300028380 Unclassified 1234
164 Ga0268265_10435140 3300028380 Bacteria 1221
165 Ga0268264_10021225 3300028381 Bacteria 5305
166 Ga0268264_11753493 3300028381 Bacteria 631
167 Ga0307517_10029617 3300028786 Bacteria 6453
168 Ga0307517_10302681 3300028786 Bacteria 896
169 Ga0307515_10014912 3300028794 Bacteria 14364
170 Ga0307515_10019765 3300028794 Bacteria 12086
171 Ga0307515_10032255 3300028794 Bacteria 8689
172 Ga0307515_10273971 3300028794 Bacteria 1404
173 Ga0307515_10380574 3300028794 Bacteria 1044
174 Ga0307515_10487150 3300028794 Bacteria 845
175 Ga0307515_10642678 3300028794 Bacteria 673
176 Ga0307511_10051466 3300030521 Bacteria 3302
177 Ga0265332_10015139 3300031238 Bacteria 3407
178 Ga0265332_10026276 3300031238 Bacteria 2553
179 Ga0265339_10000242 3300031249 Bacteria 43798
180 Ga0265316_10001123 3300031344 Bacteria 29023
181 Ga0307513_10016304 3300031456 Bacteria 8968
182 Ga0307513_10077817 3300031456 Bacteria 3433
183 Ga0307509_10000037 3300031507 Bacteria 188517
184 Ga0307509_10150664 3300031507 Bacteria 2242
185 Ga0307509_10173228 3300031507 Bacteria 2034
186 Ga0307509_10187162 3300031507 Bacteria 1927
187 Ga0307509_10247497 3300031507 Bacteria 1569
188 Ga0307509_10307657 3300031507 Bacteria 1329
189 Ga0307508_10224901 3300031616 Bacteria 1476
190 Ga0307508_10289002 3300031616 Bacteria 1233
191 Ga0265314_10000001 3300031711 Bacteria 3792860
192 Ga0307516_10082326 3300031730 Bacteria 3060
193 Ga0307413_10821978 3300031824 Bacteria 783
194 Ga0307415_102364748 3300032126 Unclassified 522
195 Ga0307507_10282287 3300033179 Bacteria 1037
196 Ga0307510_10000004 3300033180 Bacteria 654130
197 Ga0316586_1048517 3300033527 Bacteria 757
198 Ga0373950_0172516 3300034818 Unclassified 505
199 Ga0373932_0142764 3300035112 Bacteria 816
200 Ga0373936_0009805 3300035113 Bacteria 3615
201 Ga0373941_0021734 3300035115 Bacteria 1814
202 Ga0373927_0412628 3300035695 Bacteria 891
203 Ga0373947_0139146 3300035725 Bacteria 1556
204 Ga0395905_1285337 3300037471 Unclassified 635
205 Ga0400483_212389 3300039062 Bacteria 14410
206 Ga0436365_0784037 3300039437 Bacteria 5688
207 Ga0436365_1307404 3300039437 Bacteria 13494
208 Ga0436365_1917473 3300039437 Bacteria 501
209 Ga0451787_070622 3300041441 Bacteria 710
210 Ga0451787_510280 3300041441 Bacteria 887
211 Ga0451789_0182757 3300041443 Unclassified 633
212 Ga0451789_0519786 3300041443 Bacteria 672
213 Ga0451791_0518569 3300041451 Unclassified 647
214 Ga0451791_1169263 3300041451 Bacteria 651
215 Ga0451791_1792014 3300041451 Bacteria 540
216 Ga0451793_0350853 3300041452 Unclassified 599
217 Ga0451797_0320699 3300041453 Bacteria 735
218 Ga0451797_0389745 3300041453 Unclassified 610
219 Ga0451797_0809132 3300041453 Bacteria 1648
220 Ga0451798_0003540 3300041458 Unclassified 690
221 Ga0451800_0490019 3300041459 Bacteria 648
222 Ga0451800_1174692 3300041459 Bacteria 736
223 Ga0451800_1183314 3300041459 Unclassified 961
224 Ga0451802_1222266 3300041460 Unclassified 653
225 Ga0451804_0637333 3300041463 Bacteria 1637
226 Ga0451807_0029773 3300041486 Bacteria 600
227 Ga0451807_0712427 3300041486 Bacteria 593
228 Ga0451807_1020107 3300041486 Unclassified 765
229 Ga0451807_1410082 3300041486 Unclassified 764
230 Ga0451807_1573912 3300041486 Bacteria 1516
231 Ga0451807_2038635 3300041486 Bacteria 833
232 Ga0451807_2070482 3300041486 Unclassified 919
233 Ga0451807_2290264 3300041486 Bacteria 3192
234 Ga0451807_2590435 3300041486 Bacteria 2131
235 Ga0451833_0071948 3300041491 Bacteria 718
236 Ga0451835_0784975 3300041492 Bacteria 1750
237 Ga0451837_0633327 3300041494 Bacteria 831
238 Ga0451839_0142514 3300041496 Unclassified 767
239 Ga0451841_0403691 3300041498 Unclassified 784
240 Ga0451845_0847431 3300041501 Unclassified 732
241 Ga0451849_0475999 3300041505 Bacteria 2080
242 Ga0451843_0204413 3300041509 Bacteria 1158
243 Ga0451853_0604344 3300041512 Bacteria 1137
244 Ga0451853_1473748 3300041512 Bacteria 2212
245 Ga0451853_1678263 3300041512 Bacteria 1445
246 Ga0451853_1707796 3300041512 Bacteria 41346
247 Ga0451853_1829211 3300041512 Bacteria 762
248 Ga0451853_2524784 3300041512 Bacteria 635
249 Ga0466969_0030686 3300044656 Bacteria 2739
250 Ga0495638_0036631 3300046460 Bacteria 3124
251 Ga0495650_0092975 3300046471 Bacteria 1144
252 Ga0495585_0200945 3300046492 Bacteria 1015
253 Ga0495620_0296028 3300046515 Bacteria 615
254 Ga0495632_0036495 3300046519 Bacteria 2500
255 Ga0495632_0046487 3300046519 Bacteria 2156
256 Ga0495632_0406754 3300046519 Bacteria 594
257 Ga0495668_0139112 3300046616 Bacteria 1329
258 Ga0495649_0286310 3300046694 Bacteria 841
259 Ga0495674_0496808 3300047319 Bacteria 976
260 Ga0495686_0527901 3300047472 Unclassified 619
261 Ga0496104_1456213 3300048907 Bacteria 588
262 Ga0496108_0094928 3300048911 Bacteria 2539
263 Ga0496112_0059427 3300048915 Bacteria 3767
264 Ga0496114_0000001 3300048917 Bacteria 893286
265 Ga0496119_0316927 3300048922 Bacteria 764
266 Ga0496119_0337322 3300048922 Unclassified 734
267 Ga0496121_0010774 3300048924 Bacteria 10248
268 Ga0496124_0696545 3300048927 Unclassified 645
269 Ga0496125_0009668 3300048928 Bacteria 9856
270 Ga0501306_085381 3300049127 Bacteria 549
271 Ga0501308_019445 3300049128 Bacteria 838
272 Ga0501308_040032 3300049128 Bacteria 657
273 Ga0501304_005405 3300049160 Bacteria 1000
274 Ga0501305_008154 3300049161 Bacteria 1349
275 Ga0501305_030541 3300049161 Unclassified 838
276 Ga0501307_012251 3300049162 Bacteria 1018
277 Ga0501307_034111 3300049162 Bacteria 718
278 Ga0501307_091046 3300049162 Bacteria 509
279 Ga0501311_009617 3300049527 Bacteria 1158
280 Ga0501311_033140 3300049527 Bacteria 756
281 Ga0501312_022622 3300049528 Bacteria 942
282 Ga0501314_003732 3300049530 Bacteria 1239
283 Ga0501315_017203 3300049531 Bacteria 943
284 Ga0501315_105726 3300049531 Bacteria 501
285 Ga0501317_042738 3300049533 Bacteria 697
286 Ga0501323_029420 3300049539 Bacteria 765
287 Ga0501325_027494 3300049541 Unclassified 635
288 Ga0501069_0718614 3300049585 Unclassified 603
289 Ga0501074_0070302 3300049590 Bacteria 2517
290 Ga0501235_015620 3300049669 Bacteria 1675
291 Ga0501225_0032418 3300049705 Bacteria 1437
292 Ga0501080_0127725 3300049742 Bacteria 2354
293 Ga0501083_0000862 3300049744 Bacteria 19996
294 nmdc:mga03683_265411_c1 3300050489 Bacteria 800
295 nmdc:mga03n38_18811_c1 3300050490 Bacteria 2732
296 nmdc:mga00v17_364938_c1 3300050491 Bacteria 939
297 nmdc:mga0yw44_225206_c1 3300050492 Bacteria 1244
298 nmdc:mga0k408_300981_c1 3300050493 Bacteria 957
299 nmdc:mga0k408_666377_c1 3300050493 Bacteria 611
300 nmdc:mga06z11_147651_c1 3300050494 Unclassified 1334
301 nmdc:mga06z11_21223_c1 3300050494 Bacteria 3015
302 nmdc:mga06z11_503248_c1 3300050494 Bacteria 734
303 nmdc:mga04h51_118463_c1 3300050495 Bacteria 984
304 nmdc:mga09592_7224_c1 3300050508 Bacteria 9026
305 nmdc:mga0qj67_223040_c1 3300050509 Bacteria 1530
306 nmdc:mga0qj67_741321_c1 3300050509 Bacteria 780
307 nmdc:mga06r32_780861_c1 3300050510 Bacteria 917
308 nmdc:mga08y16_295922_c1 3300050511 Bacteria 1669
309 Ga0500610_0249235 3300053079 Bacteria 820
310 Ga0500635_0006824 3300053080 Bacteria 3066
311 Ga0500635_0453249 3300053080 Bacteria 508
312 Ga0500578_0053026 3300053086 Bacteria 2597
313 Ga0500644_0367946 3300053088 Unclassified 624
314 Ga0500646_0006172 3300053090 Bacteria 3045
315 Ga0500646_0051743 3300053090 Unclassified 1187
316 Ga0500647_0044127 3300053091 Bacteria 2140
317 Ga0500583_0018815 3300053092 Bacteria 2816
318 Ga0500583_0021637 3300053092 Bacteria 2679
319 Ga0500583_0023087 3300053092 Bacteria 2617
320 Ga0500583_0023724 3300053092 Bacteria 2590
321 Ga0500583_0024167 3300053092 Bacteria 2574
322 Ga0500583_0027360 3300053092 Bacteria 2461
323 Ga0500583_0032400 3300053092 Bacteria 2305
324 Ga0500583_0088383 3300053092 Bacteria 1506
325 Ga0500583_0099969 3300053092 Bacteria 1420
326 Ga0500583_0603868 3300053092 Unclassified 504
327 Ga0500651_0118090 3300053093 Bacteria 1613
328 Ga0500651_0344381 3300053093 Bacteria 847
329 Ga0500651_0432889 3300053093 Bacteria 734
330 Ga0500566_0000309 3300053094 Bacteria 26262
331 Ga0500566_0006498 3300053094 Bacteria 6927
332 Ga0500566_0034113 3300053094 Bacteria 2962
333 Ga0500566_0156553 3300053094 Bacteria 1192
334 Ga0500640_003351 3300053095 Bacteria 5573
335 Ga0500641_0068506 3300053096 Bacteria 1490
336 Ga0500641_0187431 3300053096 Bacteria 887
337 Ga0500650_0217338 3300053098 Bacteria 866
338 Ga0500654_053020 3300053099 Bacteria 2161
339 Ga0500654_141786 3300053099 Bacteria 873
340 Ga0500660_159836 3300053100 Bacteria 856
341 Ga0500554_005592 3300053102 Bacteria 2756
342 Ga0500556_0123245 3300053104 Bacteria 1012
343 Ga0500556_0348932 3300053104 Bacteria 573
344 Ga0500558_235521 3300053106 Bacteria 612
345 Ga0500558_281346 3300053106 Bacteria 529
346 Ga0500562_026411 3300053108 Bacteria 1522
347 Ga0500572_007191 3300053111 Bacteria 2573
348 Ga0500572_134501 3300053111 Bacteria 804
349 Ga0500591_213708 3300053115 Unclassified 648
350 Ga0500594_0182956 3300053118 Unclassified 684
351 Ga0500594_0211925 3300053118 Unclassified 639
352 Ga0500595_000292 3300053119 Bacteria 32909
353 Ga0500597_022302 3300053120 Bacteria 2515
354 Ga0500597_206348 3300053120 Bacteria 823
355 Ga0500597_230455 3300053120 Bacteria 766
356 Ga0500607_198114 3300053121 Bacteria 867
357 Ga0500608_160521 3300053122 Bacteria 975
358 Ga0500614_008513 3300053123 Bacteria 2175
359 Ga0500617_010740 3300053124 Bacteria 3799
360 Ga0500617_025643 3300053124 Bacteria 2620
361 Ga0500617_164595 3300053124 Bacteria 860
362 Ga0500617_204574 3300053124 Bacteria 720
363 Ga0500621_239699 3300053126 Bacteria 616
364 Ga0500623_208557 3300053127 Bacteria 710
365 Ga0500642_0120645 3300053130 Bacteria 1226
366 Ga0500642_0202478 3300053130 Bacteria 923
367 Ga0500652_119405 3300053131 Bacteria 1102
368 Ga0500652_379590 3300053131 Unclassified 528
369 Ga0500655_046930 3300053133 Bacteria 856
370 Ga0500658_0022325 3300053134 Bacteria 2405
371 Ga0500658_0031564 3300053134 Bacteria 2072
372 Ga0500658_0034406 3300053134 Bacteria 1999
373 Ga0500658_0223254 3300053134 Bacteria 864
374 Ga0500559_0144004 3300053136 Bacteria 1117
375 Ga0500559_0196482 3300053136 Bacteria 951
376 Ga0500559_0293454 3300053136 Bacteria 764
377 Ga0500568_0035521 3300053139 Bacteria 2033
378 Ga0500568_0057989 3300053139 Bacteria 1505
379 Ga0500568_0094021 3300053139 Bacteria 1129
380 Ga0500568_0111486 3300053139 Bacteria 1022
381 Ga0500577_0165924 3300053142 Bacteria 942
382 Ga0500585_012323 3300053144 Bacteria 2565
383 Ga0500588_0011882 3300053146 Bacteria 2144
384 Ga0500588_0015516 3300053146 Bacteria 1952
385 Ga0500588_0037086 3300053146 Bacteria 1445
386 Ga0500588_0209097 3300053146 Bacteria 725
387 Ga0500590_325659 3300053148 Unclassified 563
388 Ga0500603_010673 3300053150 Bacteria 2078
389 Ga0500616_0000018 3300053153 Bacteria 610976
390 Ga0500616_0000073 3300053153 Bacteria 231290
391 Ga0500622_0010886 3300053156 Bacteria 4968
392 Ga0500622_0044193 3300053156 Bacteria 2308
393 Ga0500622_0131252 3300053156 Unclassified 1204
394 Ga0500622_0202019 3300053156 Bacteria 903
395 Ga0500633_0184977 3300053160 Bacteria 781
396 Ga0500633_0284943 3300053160 Unclassified 610
397 Ga0500639_116398 3300053163 Bacteria 1291
398 Ga0500637_0155554 3300053178 Bacteria 1319
399 Ga0500637_0552776 3300053178 Bacteria 557
400 Ga0500611_050485 3300053727 Bacteria 951
401 Ga0500656_008399 3300053732 Bacteria 1095
402 Ga0500596_065901 3300053735 Bacteria 612
403 Ga0500601_011496 3300053737 Bacteria 995
404 Ga0501084_0029139 3300054114 Bacteria 4617
405 Ga0590071_131501 3300059421 Unclassified 643
406 Ga0590077_017830 3300059426 Bacteria 1496
407 Ga0587098_013903 3300059604 Bacteria 943
408 Ga0587068_092791 3300059641 Bacteria 625
409 Ga0587119_023998 3300059658 Bacteria 796
410 Ga0587111_0036675 3300060346 Bacteria 1027
411 Ga0587111_0045210 3300060346 Bacteria 953
412 Ga0501082_0019904 3300060353 Bacteria 5785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049669 Ga0501235_015620 Ga0501235_015620_303_620 105
2 3300033179 Ga0307507_10282287 Ga0307507_102822872 109
3 3300041494 Ga0451837_0633327 Ga0451837_0633327_15_356 113
4 3300048907 Ga0496104_1456213 Ga0496104_1456213_18_368 115
5 3300053088 Ga0500644_0367946 Ga0500644_0367946_219_569 115
6 3300053131 Ga0500652_119405 Ga0500652_119405_368_718 115
7 3300053131 Ga0500652_379590 Ga0500652_379590_149_499 115
8 3300053156 Ga0500622_0010886 Ga0500622_0010886_2068_2418 115
9 3300053100 Ga0500660_159836 Ga0500660_159836_493_846 116
10 3300005340 Ga0070689_100649470 Ga0070689_1006494702 120
11 3300009098 Ga0105245_10110367 Ga0105245_101103674 120
12 3300013296 Ga0157374_10134270 Ga0157374_101342703 120
13 3300025927 Ga0207687_10082232 Ga0207687_100822322 120
14 3300028794 Ga0307515_10380574 Ga0307515_103805743 120
15 3300005345 Ga0070692_10689454 Ga0070692_106894542 121
16 3300005719 Ga0068861_101338875 Ga0068861_1013388751 121
17 3300031507 Ga0307509_10307657 Ga0307509_103076572 121
18 3300053092 Ga0500583_0024167 Ga0500583_0024167_479_847 121
19 3300053092 Ga0500583_0027360 Ga0500583_0027360_1330_1698 121
20 3300053093 Ga0500651_0118090 Ga0500651_0118090_661_1029 121
21 3300053093 Ga0500651_0344381 Ga0500651_0344381_225_593 121
22 3300053096 Ga0500641_0187431 Ga0500641_0187431_361_729 121
23 3300053104 Ga0500556_0123245 Ga0500556_0123245_12_380 121
24 3300053124 Ga0500617_010740 Ga0500617_010740_146_514 121
25 3300053124 Ga0500617_025643 Ga0500617_025643_1853_2221 121
26 3300053126 Ga0500621_239699 Ga0500621_239699_172_540 121
27 3300053130 Ga0500642_0120645 Ga0500642_0120645_656_1024 121
28 3300053134 Ga0500658_0031564 Ga0500658_0031564_729_1097 121
29 3300053134 Ga0500658_0034406 Ga0500658_0034406_442_810 121
30 3300053142 Ga0500577_0165924 Ga0500577_0165924_272_640 121
31 3300053146 Ga0500588_0015516 Ga0500588_0015516_1308_1676 121
32 3300053146 Ga0500588_0037086 Ga0500588_0037086_189_557 121
33 3300053160 Ga0500633_0184977 Ga0500633_0184977_194_562 121
34 3300053732 Ga0500656_008399 Ga0500656_008399_379_747 121
35 3300003316 rootH1_10015903 rootH1_100159032 122
36 3300003316 rootH1_10067479 rootH1_100674792 122
37 3300003320 rootH2_10171781 rootH2_101717812 122
38 3300003322 rootL2_10032189 rootL2_100321895 122
39 3300003322 rootL2_10091734 rootL2_100917341 122
40 3300003323 rootH1_10140546 rootH1_101405462 122
41 3300003323 rootH1_10175959 rootH1_101759592 122
42 3300003323 rootH1_10271981 rootH1_102719812 122
43 3300004798 Ga0058859_11639446 Ga0058859_116394461 122
44 3300004798 Ga0058859_11681338 Ga0058859_116813381 122
45 3300004800 Ga0058861_10966217 Ga0058861_109662171 122
46 3300005327 Ga0070658_10095034 Ga0070658_100950341 122
47 3300005330 Ga0070690_100760288 Ga0070690_1007602881 122
48 3300005331 Ga0070670_100040891 Ga0070670_1000408915 122
49 3300005334 Ga0068869_100015010 Ga0068869_1000150102 122
50 3300005334 Ga0068869_100491865 Ga0068869_1004918652 122
51 3300005334 Ga0068869_100641251 Ga0068869_1006412511 122
52 3300005334 Ga0068869_100739433 Ga0068869_1007394332 122
53 3300005335 Ga0070666_10196017 Ga0070666_101960172 122
54 3300005337 Ga0070682_100011819 Ga0070682_1000118192 122
55 3300005338 Ga0068868_100376780 Ga0068868_1003767802 122
56 3300005340 Ga0070689_100546167 Ga0070689_1005461672 122
57 3300005340 Ga0070689_100838975 Ga0070689_1008389751 122
58 3300005343 Ga0070687_100492988 Ga0070687_1004929882 122
59 3300005343 Ga0070687_101311859 Ga0070687_1013118591 122
60 3300005355 Ga0070671_100000308 Ga0070671_10000030810 122
61 3300005365 Ga0070688_100317411 Ga0070688_1003174111 122
62 3300005367 Ga0070667_100012521 Ga0070667_1000125213 122
63 3300005367 Ga0070667_100490262 Ga0070667_1004902621 122
64 3300005438 Ga0070701_10087967 Ga0070701_100879672 122
65 3300005440 Ga0070705_101054063 Ga0070705_1010540631 122
66 3300005440 Ga0070705_101178004 Ga0070705_1011780041 122
67 3300005444 Ga0070694_101352697 Ga0070694_1013526971 122
68 3300005466 Ga0070685_10131222 Ga0070685_101312223 122
69 3300005466 Ga0070685_10617987 Ga0070685_106179871 122
70 3300005544 Ga0070686_101176157 Ga0070686_1011761571 122
71 3300005545 Ga0070695_100341623 Ga0070695_1003416232 122
72 3300005548 Ga0070665_100121688 Ga0070665_1001216883 122
73 3300005548 Ga0070665_101299635 Ga0070665_1012996352 122
74 3300005549 Ga0070704_100549423 Ga0070704_1005494232 122
75 3300005563 Ga0068855_100002055 Ga0068855_1000020559 122
76 3300005563 Ga0068855_100012162 Ga0068855_1000121622 122
77 3300005563 Ga0068855_100970719 Ga0068855_1009707192 122
78 3300005615 Ga0070702_101240543 Ga0070702_1012405431 122
79 3300005615 Ga0070702_101869186 Ga0070702_1018691861 122
80 3300005617 Ga0068859_100000316 Ga0068859_10000031618 122
81 3300005618 Ga0068864_100337533 Ga0068864_1003375332 122
82 3300005618 Ga0068864_101228741 Ga0068864_1012287412 122
83 3300005718 Ga0068866_10509018 Ga0068866_105090182 122
84 3300005719 Ga0068861_100057620 Ga0068861_1000576202 122
85 3300005719 Ga0068861_100658560 Ga0068861_1006585602 122
86 3300005841 Ga0068863_100195221 Ga0068863_1001952211 122
87 3300005842 Ga0068858_100001821 Ga0068858_1000018219 122
88 3300005843 Ga0068860_100010528 Ga0068860_10001052810 122
89 3300006028 Ga0070717_10027826 Ga0070717_100278266 122
90 3300006038 Ga0075365_10039127 Ga0075365_100391272 122
91 3300006042 Ga0075368_10029653 Ga0075368_100296533 122
92 3300006048 Ga0075363_100364749 Ga0075363_1003647492 122
93 3300006051 Ga0075364_10569897 Ga0075364_105698972 122
94 3300006177 Ga0075362_10303723 Ga0075362_103037232 122
95 3300006177 Ga0075362_10350088 Ga0075362_103500882 122
96 3300006178 Ga0075367_10052612 Ga0075367_100526122 122
97 3300006178 Ga0075367_10488708 Ga0075367_104887082 122
98 3300006178 Ga0075367_10546629 Ga0075367_105466291 122
99 3300006195 Ga0075366_10584898 Ga0075366_105848981 122
100 3300006195 Ga0075366_10630231 Ga0075366_106302312 122
101 3300006353 Ga0075370_10362141 Ga0075370_103621412 122
102 3300006358 Ga0068871_100359145 Ga0068871_1003591452 122
103 3300006846 Ga0075430_100552225 Ga0075430_1005522252 122
104 3300006846 Ga0075430_100701267 Ga0075430_1007012672 122
105 3300006846 Ga0075430_101085419 Ga0075430_1010854192 122
106 3300006847 Ga0075431_100045554 Ga0075431_1000455546 122
107 3300006881 Ga0068865_100037145 Ga0068865_1000371454 122
108 3300006931 Ga0097620_100000316 Ga0097620_10000031618 122
109 3300009092 Ga0105250_10101951 Ga0105250_101019512 122
110 3300009093 Ga0105240_10009786 Ga0105240_100097864 122
111 3300009094 Ga0111539_10019293 Ga0111539_100192932 122
112 3300009094 Ga0111539_10214059 Ga0111539_102140593 122
113 3300009094 Ga0111539_10551249 Ga0111539_105512492 122
114 3300009094 Ga0111539_11300642 Ga0111539_113006422 122
115 3300009098 Ga0105245_13015403 Ga0105245_130154031 122
116 3300009101 Ga0105247_10000119 Ga0105247_1000011918 122
117 3300009174 Ga0105241_10199057 Ga0105241_101990572 122
118 3300009174 Ga0105241_10420736 Ga0105241_104207362 122
119 3300009174 Ga0105241_10528680 Ga0105241_105286803 122
120 3300009176 Ga0105242_10177396 Ga0105242_101773962 122
121 3300009176 Ga0105242_11704780 Ga0105242_117047802 122
122 3300009177 Ga0105248_10053806 Ga0105248_100538065 122
123 3300009177 Ga0105248_12049681 Ga0105248_120496812 122
124 3300009177 Ga0105248_12331429 Ga0105248_123314292 122
125 3300009545 Ga0105237_11195548 Ga0105237_111955482 122
126 3300009545 Ga0105237_11207488 Ga0105237_112074882 122
127 3300009551 Ga0105238_10494447 Ga0105238_104944472 122
128 3300009551 Ga0105238_10967178 Ga0105238_109671782 122
129 3300009551 Ga0105238_11036979 Ga0105238_110369792 122
130 3300009553 Ga0105249_11109592 Ga0105249_111095922 122
131 3300009553 Ga0105249_11122736 Ga0105249_111227362 122
132 3300010375 Ga0105239_10159511 Ga0105239_101595114 122
133 3300010375 Ga0105239_10519026 Ga0105239_105190262 122
134 3300010375 Ga0105239_10561557 Ga0105239_105615573 122
135 3300013296 Ga0157374_11496173 Ga0157374_114961732 122
136 3300013296 Ga0157374_11721861 Ga0157374_117218611 122
137 3300013297 Ga0157378_10152705 Ga0157378_101527052 122
138 3300013297 Ga0157378_11445324 Ga0157378_114453242 122
139 3300013297 Ga0157378_11985051 Ga0157378_119850511 122
140 3300013308 Ga0157375_12065095 Ga0157375_120650952 122
141 3300014325 Ga0163163_10003650 Ga0163163_1000365010 122
142 3300014326 Ga0157380_10051702 Ga0157380_100517022 122
143 3300014497 Ga0182008_10267311 Ga0182008_102673112 122
144 3300014968 Ga0157379_10009373 Ga0157379_100093737 122
145 3300014969 Ga0157376_12220635 Ga0157376_122206352 122
146 3300020078 Ga0206352_10347464 Ga0206352_103474642 122
147 3300021384 Ga0213876_10022031 Ga0213876_100220314 122
148 3300021384 Ga0213876_10033645 Ga0213876_100336454 122
149 3300025899 Ga0207642_10347436 Ga0207642_103474362 122
150 3300025900 Ga0207710_10001054 Ga0207710_100010547 122
151 3300025903 Ga0207680_10269308 Ga0207680_102693082 122
152 3300025903 Ga0207680_10278427 Ga0207680_102784272 122
153 3300025911 Ga0207654_10123329 Ga0207654_101233292 122
154 3300025911 Ga0207654_10386375 Ga0207654_103863752 122
155 3300025911 Ga0207654_10867045 Ga0207654_108670452 122
156 3300025913 Ga0207695_10023143 Ga0207695_100231433 122
157 3300025913 Ga0207695_10378266 Ga0207695_103782661 122
158 3300025913 Ga0207695_10804009 Ga0207695_108040091 122
159 3300025914 Ga0207671_11105954 Ga0207671_111059541 122
160 3300025918 Ga0207662_10167571 Ga0207662_101675712 122
161 3300025924 Ga0207694_10673763 Ga0207694_106737632 122
162 3300025924 Ga0207694_10764076 Ga0207694_107640761 122
163 3300025925 Ga0207650_10296123 Ga0207650_102961231 122
164 3300025927 Ga0207687_10085715 Ga0207687_100857151 122
165 3300025931 Ga0207644_10034614 Ga0207644_100346142 122
166 3300025936 Ga0207670_10163926 Ga0207670_101639262 122
167 3300025938 Ga0207704_10311943 Ga0207704_103119432 122
168 3300025938 Ga0207704_10760958 Ga0207704_107609582 122
169 3300025941 Ga0207711_10735984 Ga0207711_107359842 122
170 3300025942 Ga0207689_10010672 Ga0207689_100106724 122
171 3300025942 Ga0207689_10044730 Ga0207689_100447305 122
172 3300025942 Ga0207689_11050651 Ga0207689_110506512 122
173 3300025942 Ga0207689_11131307 Ga0207689_111313071 122
174 3300025949 Ga0207667_10000476 Ga0207667_1000047617 122
175 3300025949 Ga0207667_10000977 Ga0207667_1000097725 122
176 3300025949 Ga0207667_10001652 Ga0207667_1000165222 122
177 3300025949 Ga0207667_10871477 Ga0207667_108714771 122
178 3300025961 Ga0207712_11639569 Ga0207712_116395691 122
179 3300025981 Ga0207640_10866711 Ga0207640_108667112 122
180 3300025986 Ga0207658_10003495 Ga0207658_100034958 122
181 3300025986 Ga0207658_10271334 Ga0207658_102713342 122
182 3300026023 Ga0207677_10296006 Ga0207677_102960062 122
183 3300026035 Ga0207703_10015005 Ga0207703_100150052 122
184 3300026088 Ga0207641_10004867 Ga0207641_100048677 122
185 3300026095 Ga0207676_10183401 Ga0207676_101834012 122
186 3300026118 Ga0207675_101311475 Ga0207675_1013114751 122
187 3300026121 Ga0207683_11342057 Ga0207683_113420572 122
188 3300027866 Ga0209813_10103630 Ga0209813_101036302 122
189 3300027907 Ga0207428_10073150 Ga0207428_100731503 122
190 3300028379 Ga0268266_11173061 Ga0268266_111730612 122
191 3300028380 Ga0268265_10425645 Ga0268265_104256452 122
192 3300028380 Ga0268265_10435140 Ga0268265_104351402 122
193 3300028381 Ga0268264_10021225 Ga0268264_100212253 122
194 3300028381 Ga0268264_11753493 Ga0268264_117534932 122
195 3300028786 Ga0307517_10029617 Ga0307517_100296176 122
196 3300028786 Ga0307517_10302681 Ga0307517_103026812 122
197 3300028794 Ga0307515_10014912 Ga0307515_100149129 122
198 3300028794 Ga0307515_10019765 Ga0307515_1001976512 122
199 3300028794 Ga0307515_10032255 Ga0307515_100322556 122
200 3300028794 Ga0307515_10273971 Ga0307515_102739713 122
201 3300028794 Ga0307515_10487150 Ga0307515_104871502 122
202 3300028794 Ga0307515_10642678 Ga0307515_106426782 122
203 3300030521 Ga0307511_10051466 Ga0307511_100514665 122
204 3300031238 Ga0265332_10015139 Ga0265332_100151394 122
205 3300031238 Ga0265332_10026276 Ga0265332_100262762 122
206 3300031249 Ga0265339_10000242 Ga0265339_1000024218 122
207 3300031344 Ga0265316_10001123 Ga0265316_1000112318 122
208 3300031456 Ga0307513_10016304 Ga0307513_100163045 122
209 3300031456 Ga0307513_10077817 Ga0307513_100778172 122
210 3300031507 Ga0307509_10000037 Ga0307509_1000003775 122
211 3300031507 Ga0307509_10150664 Ga0307509_101506643 122
212 3300031507 Ga0307509_10173228 Ga0307509_101732283 122
213 3300031507 Ga0307509_10187162 Ga0307509_101871623 122
214 3300031507 Ga0307509_10247497 Ga0307509_102474973 122
215 3300031616 Ga0307508_10224901 Ga0307508_102249012 122
216 3300031616 Ga0307508_10289002 Ga0307508_102890022 122
217 3300031711 Ga0265314_10000001 Ga0265314_100000013054 122
218 3300031730 Ga0307516_10082326 Ga0307516_100823264 122
219 3300031824 Ga0307413_10821978 Ga0307413_108219781 122
220 3300032126 Ga0307415_102364748 Ga0307415_1023647481 122
221 3300033180 Ga0307510_10000004 Ga0307510_10000004422 122
222 3300033527 Ga0316586_1048517 Ga0316586_10485171 122
223 3300034818 Ga0373950_0172516 Ga0373950_0172516_59_427 122
224 3300035112 Ga0373932_0142764 Ga0373932_0142764_396_764 122
225 3300035113 Ga0373936_0009805 Ga0373936_0009805_2646_3017 122
226 3300035115 Ga0373941_0021734 Ga0373941_0021734_957_1325 122
227 3300035695 Ga0373927_0412628 Ga0373927_0412628_151_522 122
228 3300035725 Ga0373947_0139146 Ga0373947_0139146_445_813 122
229 3300037471 Ga0395905_1285337 Ga0395905_1285337_160_531 122
230 3300039062 Ga0400483_212389 Ga0400483_212389_1701_2072 122
231 3300039437 Ga0436365_0784037 Ga0436365_0784037_335_703 122
232 3300039437 Ga0436365_1307404 Ga0436365_1307404_2089_2463 122
233 3300039437 Ga0436365_1917473 Ga0436365_1917473_59_427 122
234 3300041441 Ga0451787_070622 Ga0451787_070622_113_481 122
235 3300041441 Ga0451787_510280 Ga0451787_510280_357_725 122
236 3300041443 Ga0451789_0182757 Ga0451789_0182757_32_400 122
237 3300041443 Ga0451789_0519786 Ga0451789_0519786_248_616 122
238 3300041451 Ga0451791_0518569 Ga0451791_0518569_17_385 122
239 3300041451 Ga0451791_1169263 Ga0451791_1169263_71_439 122
240 3300041451 Ga0451791_1792014 Ga0451791_1792014_44_412 122
241 3300041452 Ga0451793_0350853 Ga0451793_0350853_82_450 122
242 3300041453 Ga0451797_0320699 Ga0451797_0320699_289_657 122
243 3300041453 Ga0451797_0389745 Ga0451797_0389745_142_510 122
244 3300041453 Ga0451797_0809132 Ga0451797_0809132_1114_1485 122
245 3300041458 Ga0451798_0003540 Ga0451798_0003540_226_597 122
246 3300041459 Ga0451800_0490019 Ga0451800_0490019_147_515 122
247 3300041459 Ga0451800_1174692 Ga0451800_1174692_324_692 122
248 3300041459 Ga0451800_1183314 Ga0451800_1183314_145_513 122
249 3300041460 Ga0451802_1222266 Ga0451802_1222266_80_448 122
250 3300041463 Ga0451804_0637333 Ga0451804_0637333_549_920 122
251 3300041486 Ga0451807_0029773 Ga0451807_0029773_210_578 122
252 3300041486 Ga0451807_0712427 Ga0451807_0712427_71_442 122
253 3300041486 Ga0451807_1020107 Ga0451807_1020107_300_671 122
254 3300041486 Ga0451807_1410082 Ga0451807_1410082_303_674 122
255 3300041486 Ga0451807_1573912 Ga0451807_1573912_1037_1405 122
256 3300041486 Ga0451807_2038635 Ga0451807_2038635_390_758 122
257 3300041486 Ga0451807_2070482 Ga0451807_2070482_230_598 122
258 3300041486 Ga0451807_2290264 Ga0451807_2290264_319_690 122
259 3300041486 Ga0451807_2590435 Ga0451807_2590435_1032_1400 122
260 3300041491 Ga0451833_0071948 Ga0451833_0071948_156_524 122
261 3300041492 Ga0451835_0784975 Ga0451835_0784975_616_984 122
262 3300041496 Ga0451839_0142514 Ga0451839_0142514_67_435 122
263 3300041498 Ga0451841_0403691 Ga0451841_0403691_266_634 122
264 3300041501 Ga0451845_0847431 Ga0451845_0847431_205_573 122
265 3300041505 Ga0451849_0475999 Ga0451849_0475999_954_1322 122
266 3300041509 Ga0451843_0204413 Ga0451843_0204413_145_513 122
267 3300041512 Ga0451853_0604344 Ga0451853_0604344_77_445 122
268 3300041512 Ga0451853_1473748 Ga0451853_1473748_691_1059 122
269 3300041512 Ga0451853_1678263 Ga0451853_1678263_520_888 122
270 3300041512 Ga0451853_1707796 Ga0451853_1707796_14979_15347 122
271 3300041512 Ga0451853_1829211 Ga0451853_1829211_25_393 122
272 3300041512 Ga0451853_2524784 Ga0451853_2524784_101_469 122
273 3300044656 Ga0466969_0030686 Ga0466969_0030686_175_546 122
274 3300046460 Ga0495638_0036631 Ga0495638_0036631_652_1020 122
275 3300046471 Ga0495650_0092975 Ga0495650_0092975_662_1033 122
276 3300046492 Ga0495585_0200945 Ga0495585_0200945_287_658 122
277 3300046515 Ga0495620_0296028 Ga0495620_0296028_174_545 122
278 3300046519 Ga0495632_0036495 Ga0495632_0036495_1000_1371 122
279 3300046519 Ga0495632_0046487 Ga0495632_0046487_1308_1682 122
280 3300046519 Ga0495632_0406754 Ga0495632_0406754_216_584 122
281 3300046616 Ga0495668_0139112 Ga0495668_0139112_148_519 122
282 3300046694 Ga0495649_0286310 Ga0495649_0286310_406_777 122
283 3300047319 Ga0495674_0496808 Ga0495674_0496808_594_965 122
284 3300047472 Ga0495686_0527901 Ga0495686_0527901_132_500 122
285 3300048911 Ga0496108_0094928 Ga0496108_0094928_79_450 122
286 3300048915 Ga0496112_0059427 Ga0496112_0059427_3300_3671 122
287 3300048917 Ga0496114_0000001 Ga0496114_0000001_463220_463588 122
288 3300048922 Ga0496119_0316927 Ga0496119_0316927_45_416 122
289 3300048922 Ga0496119_0337322 Ga0496119_0337322_166_537 122
290 3300048924 Ga0496121_0010774 Ga0496121_0010774_1008_1379 122
291 3300048927 Ga0496124_0696545 Ga0496124_0696545_216_587 122
292 3300048928 Ga0496125_0009668 Ga0496125_0009668_5502_5873 122
293 3300049127 Ga0501306_085381 Ga0501306_085381_123_494 122
294 3300049128 Ga0501308_019445 Ga0501308_019445_456_824 122
295 3300049128 Ga0501308_040032 Ga0501308_040032_255_626 122
296 3300049160 Ga0501304_005405 Ga0501304_005405_396_764 122
297 3300049161 Ga0501305_008154 Ga0501305_008154_540_908 122
298 3300049161 Ga0501305_030541 Ga0501305_030541_455_823 122
299 3300049162 Ga0501307_012251 Ga0501307_012251_537_905 122
300 3300049162 Ga0501307_034111 Ga0501307_034111_25_393 122
301 3300049162 Ga0501307_091046 Ga0501307_091046_77_448 122
302 3300049527 Ga0501311_009617 Ga0501311_009617_413_781 122
303 3300049527 Ga0501311_033140 Ga0501311_033140_120_488 122
304 3300049528 Ga0501312_022622 Ga0501312_022622_540_908 122
305 3300049530 Ga0501314_003732 Ga0501314_003732_418_786 122
306 3300049531 Ga0501315_017203 Ga0501315_017203_453_821 122
307 3300049531 Ga0501315_105726 Ga0501315_105726_63_434 122
308 3300049533 Ga0501317_042738 Ga0501317_042738_63_431 122
309 3300049539 Ga0501323_029420 Ga0501323_029420_369_737 122
310 3300049541 Ga0501325_027494 Ga0501325_027494_110_478 122
311 3300049585 Ga0501069_0718614 Ga0501069_0718614_11_379 122
312 3300049590 Ga0501074_0070302 Ga0501074_0070302_1306_1674 122
313 3300049705 Ga0501225_0032418 Ga0501225_0032418_1016_1384 122
314 3300049742 Ga0501080_0127725 Ga0501080_0127725_715_1083 122
315 3300049744 Ga0501083_0000862 Ga0501083_0000862_3764_4132 122
316 3300050489 nmdc:mga03683_265411_c1 nmdc:mga03683_265411_c1_249_617 122
317 3300050490 nmdc:mga03n38_18811_c1 nmdc:mga03n38_18811_c1_1617_1985 122
318 3300050491 nmdc:mga00v17_364938_c1 nmdc:mga00v17_364938_c1_523_891 122
319 3300050492 nmdc:mga0yw44_225206_c1 nmdc:mga0yw44_225206_c1_501_872 122
320 3300050493 nmdc:mga0k408_300981_c1 nmdc:mga0k408_300981_c1_149_517 122
321 3300050493 nmdc:mga0k408_666377_c1 nmdc:mga0k408_666377_c1_71_439 122
322 3300050494 nmdc:mga06z11_147651_c1 nmdc:mga06z11_147651_c1_55_426 122
323 3300050494 nmdc:mga06z11_21223_c1 nmdc:mga06z11_21223_c1_1310_1678 122
324 3300050494 nmdc:mga06z11_503248_c1 nmdc:mga06z11_503248_c1_103_474 122
325 3300050495 nmdc:mga04h51_118463_c1 nmdc:mga04h51_118463_c1_313_681 122
326 3300050508 nmdc:mga09592_7224_c1 nmdc:mga09592_7224_c1_2731_3099 122
327 3300050509 nmdc:mga0qj67_223040_c1 nmdc:mga0qj67_223040_c1_112_480 122
328 3300050509 nmdc:mga0qj67_741321_c1 nmdc:mga0qj67_741321_c1_389_757 122
329 3300050510 nmdc:mga06r32_780861_c1 nmdc:mga06r32_780861_c1_141_509 122
330 3300050511 nmdc:mga08y16_295922_c1 nmdc:mga08y16_295922_c1_860_1228 122
331 3300053079 Ga0500610_0249235 Ga0500610_0249235_224_595 122
332 3300053080 Ga0500635_0006824 Ga0500635_0006824_350_718 122
333 3300053080 Ga0500635_0453249 Ga0500635_0453249_124_492 122
334 3300053086 Ga0500578_0053026 Ga0500578_0053026_1224_1592 122
335 3300053090 Ga0500646_0006172 Ga0500646_0006172_1479_1847 122
336 3300053090 Ga0500646_0051743 Ga0500646_0051743_78_470 122
337 3300053091 Ga0500647_0044127 Ga0500647_0044127_762_1130 122
338 3300053092 Ga0500583_0018815 Ga0500583_0018815_917_1288 122
339 3300053092 Ga0500583_0021637 Ga0500583_0021637_761_1132 122
340 3300053092 Ga0500583_0023087 Ga0500583_0023087_703_1074 122
341 3300053092 Ga0500583_0023724 Ga0500583_0023724_1495_1866 122
342 3300053092 Ga0500583_0032400 Ga0500583_0032400_407_778 122
343 3300053092 Ga0500583_0088383 Ga0500583_0088383_902_1270 122
344 3300053092 Ga0500583_0099969 Ga0500583_0099969_308_676 122
345 3300053092 Ga0500583_0603868 Ga0500583_0603868_41_433 122
346 3300053093 Ga0500651_0432889 Ga0500651_0432889_274_642 122
347 3300053094 Ga0500566_0000309 Ga0500566_0000309_7456_7824 122
348 3300053094 Ga0500566_0006498 Ga0500566_0006498_2484_2852 122
349 3300053094 Ga0500566_0034113 Ga0500566_0034113_2191_2559 122
350 3300053094 Ga0500566_0156553 Ga0500566_0156553_292_660 122
351 3300053095 Ga0500640_003351 Ga0500640_003351_3822_4190 122
352 3300053096 Ga0500641_0068506 Ga0500641_0068506_1037_1408 122
353 3300053098 Ga0500650_0217338 Ga0500650_0217338_436_813 122
354 3300053099 Ga0500654_053020 Ga0500654_053020_845_1237 122
355 3300053099 Ga0500654_141786 Ga0500654_141786_317_685 122
356 3300053102 Ga0500554_005592 Ga0500554_005592_1994_2362 122
357 3300053104 Ga0500556_0348932 Ga0500556_0348932_54_422 122
358 3300053106 Ga0500558_235521 Ga0500558_235521_223_594 122
359 3300053106 Ga0500558_281346 Ga0500558_281346_95_469 122
360 3300053108 Ga0500562_026411 Ga0500562_026411_652_1020 122
361 3300053111 Ga0500572_007191 Ga0500572_007191_860_1228 122
362 3300053111 Ga0500572_134501 Ga0500572_134501_66_437 122
363 3300053115 Ga0500591_213708 Ga0500591_213708_220_588 122
364 3300053118 Ga0500594_0182956 Ga0500594_0182956_270_638 122
365 3300053118 Ga0500594_0211925 Ga0500594_0211925_23_415 122
366 3300053119 Ga0500595_000292 Ga0500595_000292_11646_12014 122
367 3300053120 Ga0500597_022302 Ga0500597_022302_659_1027 122
368 3300053120 Ga0500597_206348 Ga0500597_206348_40_408 122
369 3300053120 Ga0500597_230455 Ga0500597_230455_65_433 122
370 3300053121 Ga0500607_198114 Ga0500607_198114_255_623 122
371 3300053122 Ga0500608_160521 Ga0500608_160521_572_940 122
372 3300053123 Ga0500614_008513 Ga0500614_008513_1423_1791 122
373 3300053124 Ga0500617_164595 Ga0500617_164595_222_590 122
374 3300053124 Ga0500617_204574 Ga0500617_204574_155_526 122
375 3300053127 Ga0500623_208557 Ga0500623_208557_282_650 122
376 3300053130 Ga0500642_0202478 Ga0500642_0202478_30_398 122
377 3300053133 Ga0500655_046930 Ga0500655_046930_285_653 122
378 3300053134 Ga0500658_0022325 Ga0500658_0022325_2024_2395 122
379 3300053134 Ga0500658_0223254 Ga0500658_0223254_179_550 122
380 3300053136 Ga0500559_0144004 Ga0500559_0144004_164_532 122
381 3300053136 Ga0500559_0196482 Ga0500559_0196482_464_838 122
382 3300053136 Ga0500559_0293454 Ga0500559_0293454_20_388 122
383 3300053139 Ga0500568_0035521 Ga0500568_0035521_992_1360 122
384 3300053139 Ga0500568_0057989 Ga0500568_0057989_160_528 122
385 3300053139 Ga0500568_0094021 Ga0500568_0094021_520_891 122
386 3300053139 Ga0500568_0111486 Ga0500568_0111486_210_578 122
387 3300053144 Ga0500585_012323 Ga0500585_012323_78_446 122
388 3300053146 Ga0500588_0011882 Ga0500588_0011882_200_571 122
389 3300053146 Ga0500588_0209097 Ga0500588_0209097_239_607 122
390 3300053148 Ga0500590_325659 Ga0500590_325659_172_546 122
391 3300053150 Ga0500603_010673 Ga0500603_010673_348_716 122
392 3300053153 Ga0500616_0000018 Ga0500616_0000018_440444_440815 122
393 3300053153 Ga0500616_0000073 Ga0500616_0000073_145585_145956 122
394 3300053156 Ga0500622_0044193 Ga0500622_0044193_1417_1788 122
395 3300053156 Ga0500622_0131252 Ga0500622_0131252_784_1176 122
396 3300053156 Ga0500622_0202019 Ga0500622_0202019_382_750 122
397 3300053160 Ga0500633_0284943 Ga0500633_0284943_170_544 122
398 3300053163 Ga0500639_116398 Ga0500639_116398_504_875 122
399 3300053178 Ga0500637_0155554 Ga0500637_0155554_359_730 122
400 3300053178 Ga0500637_0552776 Ga0500637_0552776_75_443 122
401 3300053727 Ga0500611_050485 Ga0500611_050485_485_856 122
402 3300053735 Ga0500596_065901 Ga0500596_065901_181_549 122
403 3300053737 Ga0500601_011496 Ga0500601_011496_563_931 122
404 3300054114 Ga0501084_0029139 Ga0501084_0029139_3822_4190 122
405 3300059421 Ga0590071_131501 Ga0590071_131501_46_417 122
406 3300059426 Ga0590077_017830 Ga0590077_017830_1114_1482 122
407 3300059604 Ga0587098_013903 Ga0587098_013903_376_744 122
408 3300059641 Ga0587068_092791 Ga0587068_092791_174_542 122
409 3300059658 Ga0587119_023998 Ga0587119_023998_134_502 122
410 3300060346 Ga0587111_0036675 Ga0587111_0036675_550_918 122
411 3300060346 Ga0587111_0045210 Ga0587111_0045210_567_935 122
412 3300060353 Ga0501082_0019904 Ga0501082_0019904_3887_4255 122

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y3a-assembly2.cif.gz_G crystal structure of ragulator complex (p18 49-161) 0.9194 7 119
5x6u-assembly1.cif.gz_B crystal structure of human heteropentameric complex 0.9099 7 119
5y3a-assembly1.cif.gz_B crystal structure of ragulator complex (p18 49-161) 0.891 7 119
7uxh-assembly1.cif.gz_Y cryo-em structure of the mtorc1-tfeb-rag-ragulator complex 0.8866 1 119
6wj3-assembly1.cif.gz_B cryoem structure of the slc38a9-raga-ragc-ragulator complex in the post-gap state 0.8857 1 119
ID Description Score Start End Superfamily
6b9xB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8861 1 119 3.30.450.30
5y39B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8811 8 119 3.30.450.30
3t1rC00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8653 4 118 3.30.450.30
af_Q58736_1_114_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8499 16 118 3.30.450.30
af_O96824_1_90_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.849 4 101 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A355EXT8-F1-model_v4 Roadblock/LAMTOR2 domain-containing protein 0.9807 1 122
AF-A0A7Y5KTC7-F1-model_v4 Roadblock/LC7 domain-containing protein 0.976 5 120
AF-K6VKH1-F1-model_v4 Roadblock/LAMTOR2 domain-containing protein 0.9747 4 121
AF-A0A417Z2M4-F1-model_v4 Roadblock/LC7 domain-containing protein 0.972 7 119
AF-A0A532D836-F1-model_v4 Roadblock/LC7 domain-containing protein 0.9631 15 122

Feature Viewer

pLDDT pTM Quality
96.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map