F437526

General Info

Members Datasets Scaffolds Average Seq Length
411 264 378 154

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10624070|Ga0157379_106240701
Length 183
Sequence MLGWHARGRAATARVVMPTPSRPQPGPEDDHVTVEVGAAAPDFSLKDQNNEVVTLSQFKGKRNVVLIFYPLTFTGVCQGELCSVRDDLGSLQNDDVQVLAVSVDSAYSHKVWAADQGYEFPLLADFWPHGEVAKAYGVFDEAKGFAVRGTFVIDKEGVVRWKVVNAIPDARDQAEYLKALAAL

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2508501039 Frankia saprophytica CN3 Isolate Nodule
3 2517572101 Frankia sp. DC12 Isolate Nodule
4 2527291627 Frankia casuarinae Thr Isolate Nodule
5 2527291629 Frankia sp. BMG5.23 Isolate Nodule
6 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
7 2576861822 Frankia sp. CeD Isolate Nodule
8 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
9 2619618881 Frankia sp. ACN1ag Isolate Unclassified
10 2619619003 Frankia sp. CpI1-P Isolate Nodule
11 2626541554 Frankia sp. AvcI.1 Isolate Nodule
12 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
13 2671180195 Frankia sp. CcI49 Isolate Nodule
14 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
15 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
16 2684623036 Frankia sp. CgIM4 Isolate Nodule
17 2687453737 Frankia sp. BMG5.36 Isolate Nodule
18 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
19 2710264753 Frankia sp. KB5 Isolate Nodule
20 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
21 2773857922 Frankia sp. CcI49 Isolate Nodule
22 2773857924 Frankia sp. CgIS1 Isolate Nodule
23 2773857933 Frankia sp. BMG5.30 Isolate Nodule
24 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
25 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
184 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
185 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
249 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
252 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
253 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
254 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 637000116 Frankia casuarinae CcI3 Isolate Nodule
258 8002775197 Frankia nepalensis CN7 Isolate Nodule
259 8002784119 Frankia sp. AgB1.9 Isolate Nodule
260 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
261 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
262 8054920844 Frankia tisae Agncl-8 Isolate Nodule
263 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
264 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.48
Metatranscriptomes 0.49
Isolates 8.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.62
Nodule 5.84
Rhizoplane 12.17
Rhizosphere 65.69
Stem 0
Stem Tuber 0
Unclassified 11.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10054785 3300001990 Bacteria 1206
2 JGI24743J22301_10005526 3300001991 Bacteria 2114
3 JGI24738J21930_10006643 3300002075 Bacteria 2693
4 JGI24744J21845_10003700 3300002077 Bacteria 3152
5 Ga0070658_10018944 3300005327 Bacteria 5514
6 Ga0070683_100378567 3300005329 Bacteria 1349
7 Ga0070683_100884681 3300005329 Bacteria 857
8 Ga0070690_100015248 3300005330 Bacteria 4581
9 Ga0070690_100342653 3300005330 Bacteria 1083
10 Ga0070682_100016992 3300005337 Bacteria 4237
11 Ga0068868_100163195 3300005338 Bacteria 1841
12 Ga0070660_100313918 3300005339 Bacteria 1286
13 Ga0070689_100179831 3300005340 Bacteria 1717
14 Ga0070691_10523854 3300005341 Bacteria 689
15 Ga0070692_10295282 3300005345 Bacteria 987
16 Ga0070668_100046057 3300005347 Bacteria 3348
17 Ga0070668_100090604 3300005347 Bacteria 2409
18 Ga0070668_100196004 3300005347 Bacteria 1656
19 Ga0070668_101025039 3300005347 Bacteria 742
20 Ga0070675_100336841 3300005354 Bacteria 1336
21 Ga0070671_101460630 3300005355 Bacteria 605
22 Ga0070674_100368171 3300005356 Bacteria 1165
23 Ga0070673_100080812 3300005364 Bacteria 2635
24 Ga0070673_102104879 3300005364 Bacteria 536
25 Ga0070688_100127342 3300005365 Bacteria 1713
26 Ga0070659_100287577 3300005366 Bacteria 1368
27 Ga0070667_100104113 3300005367 Bacteria 2454
28 Ga0070667_100878888 3300005367 Bacteria 834
29 Ga0070709_10085708 3300005434 Bacteria 2066
30 Ga0070714_100493771 3300005435 Bacteria 1167
31 Ga0070714_100874633 3300005435 Bacteria 872
32 Ga0070710_10042068 3300005437 Bacteria 2525
33 Ga0070710_11033475 3300005437 Bacteria 600
34 Ga0070705_100378983 3300005440 Bacteria 1040
35 Ga0070700_100051574 3300005441 Bacteria 2561
36 Ga0070694_100160851 3300005444 Bacteria 1647
37 Ga0070708_100502245 3300005445 Bacteria 1144
38 Ga0070663_100005076 3300005455 Bacteria 7782
39 Ga0070663_100138495 3300005455 Bacteria 1855
40 Ga0070678_100260795 3300005456 Bacteria 1457
41 Ga0070678_100711810 3300005456 Bacteria 905
42 Ga0070662_100378649 3300005457 Bacteria 1164
43 Ga0068867_100295963 3300005459 Bacteria 1332
44 Ga0068867_101324110 3300005459 Bacteria 665
45 Ga0070685_10033601 3300005466 Bacteria 2883
46 Ga0070685_10054870 3300005466 Bacteria 2314
47 Ga0070706_100174280 3300005467 Bacteria 2008
48 Ga0070698_100050340 3300005471 Bacteria 4248
49 Ga0070679_100641781 3300005530 Bacteria 1005
50 Ga0068853_100150998 3300005539 Bacteria 2091
51 Ga0070696_100039611 3300005546 Bacteria 3253
52 Ga0070693_100076637 3300005547 Bacteria 1982
53 Ga0070665_100217407 3300005548 Bacteria 1911
54 Ga0070665_101402138 3300005548 Bacteria 708
55 Ga0070704_100463545 3300005549 Bacteria 1093
56 Ga0068855_100071425 3300005563 Bacteria 4037
57 Ga0068854_100087370 3300005578 Bacteria 2313
58 Ga0068854_100472427 3300005578 Bacteria 1051
59 Ga0068856_100973435 3300005614 Bacteria 867
60 Ga0070702_100277241 3300005615 Bacteria 1149
61 Ga0070702_100278944 3300005615 Bacteria 1146
62 Ga0068859_100002912 3300005617 Bacteria 17381
63 Ga0068859_100772017 3300005617 Bacteria 1049
64 Ga0068859_101385419 3300005617 Bacteria 775
65 Ga0068864_100149478 3300005618 Bacteria 2115
66 Ga0068864_101458909 3300005618 Bacteria 687
67 Ga0068866_10761793 3300005718 Bacteria 669
68 Ga0068861_100228890 3300005719 Bacteria 1575
69 Ga0068861_101183070 3300005719 Bacteria 738
70 Ga0068861_101346795 3300005719 Bacteria 695
71 Ga0068863_100001895 3300005841 Bacteria 20757
72 Ga0068858_100000004 3300005842 Bacteria 336234
73 Ga0068858_100000960 3300005842 Bacteria 29847
74 Ga0068858_100012120 3300005842 Bacteria 8127
75 Ga0068858_100943283 3300005842 Bacteria 844
76 Ga0068858_101334481 3300005842 Bacteria 706
77 Ga0068860_101168413 3300005843 Bacteria 790
78 Ga0068862_100000996 3300005844 Bacteria 27105
79 Ga0068862_100692214 3300005844 Bacteria 987
80 Ga0081455_10003503 3300005937 Bacteria 18031
81 Ga0081455_10158168 3300005937 Bacteria 1739
82 Ga0070717_10043187 3300006028 Bacteria 3678
83 Ga0075365_10006070 3300006038 Bacteria 6601
84 Ga0075363_100019084 3300006048 Bacteria 3424
85 Ga0075363_100413514 3300006048 Bacteria 793
86 Ga0075364_10304259 3300006051 Bacteria 1085
87 Ga0070712_100033754 3300006175 Bacteria 3464
88 Ga0075369_10008120 3300006186 Bacteria 4026
89 Ga0075428_100060436 3300006844 Bacteria 4150
90 Ga0075430_100092237 3300006846 Bacteria 2532
91 Ga0075430_100655283 3300006846 Bacteria 866
92 Ga0075431_100045623 3300006847 Bacteria 4519
93 Ga0075431_100246831 3300006847 Bacteria 1815
94 Ga0075434_100788465 3300006871 Bacteria 967
95 Ga0075429_101342500 3300006880 Bacteria 623
96 Ga0068865_100456531 3300006881 Bacteria 1057
97 Ga0097620_100002912 3300006931 Bacteria 17381
98 Ga0097620_100772011 3300006931 Bacteria 1049
99 Ga0097620_101385460 3300006931 Bacteria 775
100 Ga0105245_10225732 3300009098 Bacteria 1809
101 Ga0105245_10484098 3300009098 Bacteria 1251
102 Ga0105247_10000013 3300009101 Bacteria 287863
103 Ga0105247_10008275 3300009101 Bacteria 6346
104 Ga0105247_10277469 3300009101 Bacteria 1155
105 Ga0105247_10301921 3300009101 Bacteria 1111
106 Ga0114129_10534066 3300009147 Bacteria 1528
107 Ga0114129_11010406 3300009147 Bacteria 1047
108 Ga0105241_10048891 3300009174 Bacteria 3220
109 Ga0105242_10182379 3300009176 Bacteria 1853
110 Ga0105242_11617593 3300009176 Bacteria 682
111 Ga0105248_10000111 3300009177 Bacteria 91627
112 Ga0105248_10000150 3300009177 Bacteria 81189
113 Ga0105248_10000576 3300009177 Bacteria 41774
114 Ga0105248_10001693 3300009177 Bacteria 24537
115 Ga0105248_10119811 3300009177 Bacteria 2968
116 Ga0105248_10158249 3300009177 Bacteria 2556
117 Ga0105248_12843714 3300009177 Bacteria 552
118 Ga0105238_10552660 3300009551 Bacteria 1156
119 Ga0105249_10000008 3300009553 Bacteria 341271
120 Ga0105249_10003088 3300009553 Bacteria 14369
121 Ga0105239_10291401 3300010375 Bacteria 1838
122 Ga0105246_10044441 3300011119 Bacteria 3019
123 Ga0157371_10298134 3300013102 Bacteria 1167
124 Ga0157370_10487215 3300013104 Bacteria 1133
125 Ga0157369_10222014 3300013105 Bacteria 1978
126 Ga0157374_10008203 3300013296 Bacteria 8924
127 Ga0157378_10914832 3300013297 Bacteria 908
128 Ga0163162_10407631 3300013306 Bacteria 1492
129 Ga0163162_10892228 3300013306 Bacteria 1003
130 Ga0157372_10799829 3300013307 Bacteria 1096
131 Ga0157372_11046613 3300013307 Bacteria 945
132 Ga0157375_10252863 3300013308 Bacteria 1923
133 Ga0157375_10289188 3300013308 Bacteria 1802
134 Ga0157375_10472722 3300013308 Bacteria 1419
135 Ga0157375_11943437 3300013308 Bacteria 699
136 Ga0163163_10006866 3300014325 Bacteria 9992
137 Ga0163163_10026816 3300014325 Bacteria 5511
138 Ga0163163_10051965 3300014325 Bacteria 4041
139 Ga0163163_10058553 3300014325 Bacteria 3809
140 Ga0163163_10273092 3300014325 Bacteria 1741
141 Ga0163163_11890118 3300014325 Bacteria 657
142 Ga0163163_12132994 3300014325 Bacteria 620
143 Ga0157380_10464478 3300014326 Bacteria 1219
144 Ga0157377_10048275 3300014745 Bacteria 2388
145 Ga0157379_10000001 3300014968 Bacteria 180484
146 Ga0157379_10002948 3300014968 Bacteria 14354
147 Ga0157379_10133072 3300014968 Bacteria 2239
148 Ga0157379_10197627 3300014968 Bacteria 1818
149 Ga0157379_10448770 3300014968 Bacteria 1190
150 Ga0157379_10624070 3300014968 Bacteria 1008
151 Ga0163161_10018837 3300017792 Bacteria 4838
152 Ga0163161_10066884 3300017792 Bacteria 2625
153 Ga0206352_10120757 3300020078 Bacteria 1175
154 Ga0154015_1269596 3300020610 Bacteria 830
155 Ga0213876_10038540 3300021384 Bacteria 2523
156 Ga0213875_10066019 3300021388 Bacteria 1691
157 Ga0207642_10222129 3300025899 Bacteria 1056
158 Ga0207710_10000012 3300025900 Bacteria 409603
159 Ga0207710_10000030 3300025900 Bacteria 287870
160 Ga0207688_10001733 3300025901 Bacteria 11575
161 Ga0207680_10464768 3300025903 Bacteria 899
162 Ga0207680_10779986 3300025903 Bacteria 685
163 Ga0207647_10052964 3300025904 Bacteria 2503
164 Ga0207647_10399232 3300025904 Bacteria 775
165 Ga0207685_10108931 3300025905 Bacteria 1197
166 Ga0207699_10144375 3300025906 Bacteria 1567
167 Ga0207645_10425802 3300025907 Bacteria 894
168 Ga0207645_10735455 3300025907 Bacteria 671
169 Ga0207705_10052607 3300025909 Bacteria 2932
170 Ga0207684_10083218 3300025910 Bacteria 2725
171 Ga0207693_10041350 3300025915 Bacteria 3628
172 Ga0207663_10057149 3300025916 Bacteria 2457
173 Ga0207660_10062603 3300025917 Bacteria 2681
174 Ga0207657_10061244 3300025919 Bacteria 3228
175 Ga0207649_10878487 3300025920 Bacteria 702
176 Ga0207694_10375755 3300025924 Bacteria 1179
177 Ga0207687_10235386 3300025927 Bacteria 1449
178 Ga0207687_11066834 3300025927 Bacteria 693
179 Ga0207700_10535435 3300025928 Bacteria 1038
180 Ga0207664_10774648 3300025929 Bacteria 863
181 Ga0207706_10361961 3300025933 Bacteria 1260
182 Ga0207686_11167230 3300025934 Bacteria 629
183 Ga0207670_10339070 3300025936 Bacteria 1187
184 Ga0207669_10170744 3300025937 Bacteria 1547
185 Ga0207669_11575709 3300025937 Bacteria 560
186 Ga0207704_10808920 3300025938 Bacteria 783
187 Ga0207691_10043366 3300025940 Bacteria 4146
188 Ga0207711_10000449 3300025941 Bacteria 43005
189 Ga0207711_10001121 3300025941 Bacteria 25582
190 Ga0207711_10006284 3300025941 Bacteria 10022
191 Ga0207711_10143251 3300025941 Bacteria 2151
192 Ga0207689_10043768 3300025942 Bacteria 3701
193 Ga0207661_10152781 3300025944 Bacteria 1997
194 Ga0207661_10593025 3300025944 Bacteria 1017
195 Ga0207679_10413793 3300025945 Bacteria 1188
196 Ga0207712_10003017 3300025961 Bacteria 10751
197 Ga0207712_10391280 3300025961 Bacteria 1166
198 Ga0207668_10000225 3300025972 Bacteria 38175
199 Ga0207668_10248549 3300025972 Bacteria 1443
200 Ga0207658_11077922 3300025986 Bacteria 734
201 Ga0207677_10148402 3300026023 Bacteria 1805
202 Ga0207703_10000011 3300026035 Bacteria 336248
203 Ga0207703_10000856 3300026035 Bacteria 29865
204 Ga0207703_10722055 3300026035 Bacteria 948
205 Ga0207639_10141569 3300026041 Bacteria 2004
206 Ga0207678_10011639 3300026067 Bacteria 7725
207 Ga0207678_10044403 3300026067 Bacteria 3844
208 Ga0207708_10402852 3300026075 Bacteria 1132
209 Ga0207702_10968407 3300026078 Bacteria 844
210 Ga0207641_10004560 3300026088 Bacteria 11974
211 Ga0207648_10412199 3300026089 Bacteria 1226
212 Ga0207676_10769526 3300026095 Bacteria 937
213 Ga0207675_100529730 3300026118 Bacteria 1175
214 Ga0207675_100749830 3300026118 Bacteria 988
215 Ga0207683_10043059 3300026121 Bacteria 3944
216 Ga0207683_10278743 3300026121 Bacteria 1528
217 Ga0268266_10102847 3300028379 Bacteria 2520
218 Ga0268265_10000088 3300028380 Bacteria 117017
219 Ga0265340_10002403 3300031247 Bacteria 10648
220 Ga0265327_10002452 3300031251 Bacteria 19569
221 Ga0307408_101091060 3300031548 Bacteria 740
222 Ga0316576_10011232 3300031727 Bacteria 5857
223 Ga0307410_10153841 3300031852 Bacteria 1715
224 Ga0307409_100068765 3300031995 Bacteria 2802
225 Ga0307416_100082739 3300032002 Bacteria 2720
226 Ga0307416_100734279 3300032002 Bacteria 1079
227 Ga0307411_10471310 3300032005 Bacteria 1055
228 Ga0307415_100040458 3300032126 Bacteria 3088
229 Ga0316580_10042773 3300032139 Bacteria 1398
230 Ga0316574_0210130 3300035398 Bacteria 1249
231 Ga0373931_0056745 3300035691 Bacteria 2099
232 Ga0316584_0284263 3300036712 Unclassified 1201
233 Ga0395900_0319732 3300037418 Bacteria 1533
234 Ga0436364_0737533 3300037853 Bacteria 1044
235 Ga0436364_1372527 3300037853 Bacteria 17144
236 Ga0436365_0464343 3300039437 Bacteria 3092
237 Ga0436365_1076962 3300039437 Bacteria 6084
238 Ga0439466_0014161 3300041411 Bacteria 2908
239 Ga0439465_0010344 3300041413 Bacteria 2933
240 Ga0451789_0280959 3300041443 Bacteria 909
241 Ga0451791_0599645 3300041451 Bacteria 2024
242 Ga0451841_0078331 3300041498 Bacteria 896
243 Ga0451853_1958029 3300041512 Bacteria 1450
244 Ga0439431_0013273 3300041997 Bacteria 1899
245 Ga0439434_0181360 3300042435 Bacteria 705
246 Ga0439459_0003885 3300042438 Bacteria 2390
247 Ga0466969_0006677 3300044656 Bacteria 6132
248 Ga0466966_0026502 3300044684 Bacteria 3783
249 Ga0466961_0334345 3300044693 Bacteria 923
250 Ga0466963_0028433 3300044694 Bacteria 3589
251 Ga0466963_0306316 3300044694 Bacteria 1117
252 Ga0466964_0143796 3300044706 Bacteria 1099
253 Ga0466971_0033992 3300044719 Bacteria 2284
254 Ga0466957_0671888 3300044842 Bacteria 729
255 Ga0466959_0003708 3300045049 Bacteria 10084
256 Ga0466967_0001138 3300045976 Bacteria 14835
257 Ga0466967_0176523 3300045976 Bacteria 2012
258 Ga0466967_0869548 3300045976 Bacteria 896
259 Ga0495638_0026845 3300046460 Bacteria 3730
260 Ga0495584_0134534 3300046491 Bacteria 1255
261 Ga0495583_0092745 3300046506 Bacteria 1298
262 Ga0495648_0067746 3300046524 Bacteria 2086
263 Ga0495645_0187893 3300046543 Bacteria 1410
264 Ga0495668_0219368 3300046616 Bacteria 1041
265 Ga0495625_0161340 3300046660 Bacteria 1502
266 Ga0495671_0181655 3300046692 Bacteria 1022
267 Ga0495649_0176556 3300046694 Bacteria 1116
268 Ga0495672_0144590 3300047320 Bacteria 1239
269 Ga0495675_0029988 3300047444 Bacteria 3470
270 Ga0495679_071452 3300047446 Bacteria 999
271 Ga0495626_0038419 3300048091 Bacteria 2270
272 Ga0496100_0002008 3300048903 Bacteria 10177
273 Ga0496100_0020172 3300048903 Bacteria 3992
274 Ga0496100_0596826 3300048903 Bacteria 857
275 Ga0496101_0000056 3300048904 Bacteria 135446
276 Ga0496101_0078647 3300048904 Bacteria 2433
277 Ga0496101_0202364 3300048904 Bacteria 1535
278 Ga0496102_0000177 3300048905 Bacteria 86724
279 Ga0496102_0000277 3300048905 Bacteria 65492
280 Ga0496102_0041989 3300048905 Bacteria 4144
281 Ga0496102_0064506 3300048905 Bacteria 3354
282 Ga0496102_0078169 3300048905 Bacteria 3046
283 Ga0496102_0400347 3300048905 Bacteria 1291
284 Ga0496102_1046192 3300048905 Bacteria 736
285 Ga0496103_0000003 3300048906 Bacteria 603967
286 Ga0496103_0003601 3300048906 Bacteria 9453
287 Ga0496103_0492062 3300048906 Bacteria 785
288 Ga0496103_0730231 3300048906 Bacteria 627
289 Ga0496104_0206288 3300048907 Bacteria 1877
290 Ga0496104_0284494 3300048907 Bacteria 1566
291 Ga0496104_0453641 3300048907 Bacteria 1194
292 Ga0496105_0237639 3300048908 Bacteria 1479
293 Ga0496105_0549356 3300048908 Bacteria 902
294 Ga0496105_0580442 3300048908 Bacteria 872
295 Ga0496105_1116460 3300048908 Bacteria 584
296 Ga0496106_0267480 3300048909 Bacteria 1368
297 Ga0496106_0375524 3300048909 Bacteria 1142
298 Ga0496107_0134378 3300048910 Bacteria 1827
299 Ga0496107_0174835 3300048910 Bacteria 1594
300 Ga0496107_0530454 3300048910 Bacteria 873
301 Ga0496107_0660585 3300048910 Bacteria 770
302 Ga0496108_0002140 3300048911 Bacteria 15828
303 Ga0496108_0386336 3300048911 Bacteria 1222
304 Ga0496109_0002325 3300048912 Bacteria 15836
305 Ga0496110_0669290 3300048913 Bacteria 938
306 Ga0496110_0934067 3300048913 Bacteria 774
307 Ga0496111_0094740 3300048914 Bacteria 2190
308 Ga0496112_0072872 3300048915 Bacteria 3395
309 Ga0496113_0115619 3300048916 Bacteria 2093
310 Ga0496113_1233750 3300048916 Bacteria 583
311 Ga0496114_0006016 3300048917 Bacteria 9548
312 Ga0496114_0196010 3300048917 Bacteria 1768
313 Ga0496114_0433091 3300048917 Bacteria 1165
314 Ga0496114_0635115 3300048917 Bacteria 940
315 Ga0496114_1357515 3300048917 Bacteria 598
316 Ga0496115_0042715 3300048918 Bacteria 3613
317 Ga0496115_0063114 3300048918 Bacteria 2989
318 Ga0496115_0155664 3300048918 Bacteria 1888
319 Ga0496116_0000013 3300048919 Bacteria 603993
320 Ga0496116_0001239 3300048919 Bacteria 29627
321 Ga0496116_0017191 3300048919 Bacteria 5626
322 Ga0496117_0000013 3300048920 Bacteria 603995
323 Ga0496117_0000760 3300048920 Bacteria 50798
324 Ga0496117_0015227 3300048920 Bacteria 6575
325 Ga0496117_0024666 3300048920 Bacteria 4747
326 Ga0496118_0000011 3300048921 Bacteria 603995
327 Ga0496118_0000225 3300048921 Bacteria 98639
328 Ga0496118_0001008 3300048921 Bacteria 43814
329 Ga0496118_0008244 3300048921 Bacteria 10807
330 Ga0496118_0091042 3300048921 Bacteria 2099
331 Ga0496118_0233527 3300048921 Bacteria 1059
332 Ga0496119_0000290 3300048922 Bacteria 70278
333 Ga0496119_0006955 3300048922 Bacteria 10322
334 Ga0496119_0009102 3300048922 Bacteria 8599
335 Ga0496119_0058962 3300048922 Bacteria 2309
336 Ga0496119_0078419 3300048922 Bacteria 1910
337 Ga0496119_0302945 3300048922 Bacteria 787
338 Ga0496120_0000103 3300048923 Bacteria 141601
339 Ga0496120_0011523 3300048923 Bacteria 6073
340 Ga0496120_0356649 3300048923 Bacteria 655
341 Ga0496120_0374111 3300048923 Bacteria 635
342 Ga0496121_0000060 3300048924 Bacteria 276682
343 Ga0496121_0005980 3300048924 Bacteria 15373
344 Ga0496121_0017184 3300048924 Bacteria 7409
345 Ga0496121_0029472 3300048924 Bacteria 5074
346 Ga0496124_0125966 3300048927 Bacteria 2040
347 Ga0496126_0001508 3300048929 Bacteria 36027
348 Ga0496126_0016980 3300048929 Bacteria 7261
349 Ga0496126_0418921 3300048929 Bacteria 1083
350 Ga0496126_0542641 3300048929 Bacteria 924
351 Ga0496126_0568180 3300048929 Bacteria 897
352 Ga0496126_0830264 3300048929 Bacteria 707
353 Ga0501047_0035577 3300049581 Bacteria 4812
354 Ga0501069_0502162 3300049585 Bacteria 724
355 Ga0501070_0391894 3300049586 Bacteria 1124
356 Ga0501070_1407353 3300049586 Bacteria 530
357 Ga0501080_0099743 3300049742 Bacteria 2695
358 Ga0501035_1552463 3300049822 Bacteria 504
359 nmdc:mga07m45_15444_c1 3300050496 Bacteria 4077
360 nmdc:mga06r32_58193_c1 3300050510 Bacteria 3714
361 nmdc:mga06r32_59107_c1 3300050510 Bacteria 3686
362 nmdc:mga08y16_2078127_c1 3300050511 Bacteria 516
363 nmdc:mga0n895_1354191_c1 3300050512 Bacteria 681
364 nmdc:mga0sz30_100843_c1 3300050516 Bacteria 1261
365 Ga0500610_0028159 3300053079 Bacteria 2829
366 Ga0500643_004109 3300053087 Bacteria 6702
367 Ga0500583_0050129 3300053092 Bacteria 1935
368 Ga0500556_0003396 3300053104 Bacteria 4693
369 Ga0500556_0010763 3300053104 Bacteria 2692
370 Ga0500562_006384 3300053108 Bacteria 2973
371 Ga0500652_167046 3300053131 Bacteria 907
372 Ga0500577_0040299 3300053142 Bacteria 1698
373 Ga0500588_0131907 3300053146 Bacteria 890
374 Ga0500604_0247612 3300053151 Bacteria 616
375 Ga0500616_0032724 3300053153 Bacteria 2841
376 Ga0500616_0041434 3300053153 Bacteria 2471
377 Ga0466962_0011051 3300061719 Bacteria 4346
378 Ga0466962_0064988 3300061719 Bacteria 1742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0210130 Ga0316574_0210130_365_811 147
2 3300036712 Ga0316584_0284263 Ga0316584_0284263_650_1096 147
3 iso_pu_bacteria 2506783011 2506867073 148
4 iso_pu_bacteria 2508501039 2508678033 148
5 iso_pu_bacteria 2517572101 2517759541 148
6 iso_pu_bacteria 2527291627 2528204520 148
7 iso_pu_bacteria 2527291629 2528212258 148
8 iso_pu_bacteria 2546825537 2546949916 148
9 iso_pu_bacteria 2576861822 2579749047 148
10 iso_pu_bacteria 2579778521 2579857986 148
11 iso_pu_bacteria 2619618881 2619857340 148
12 iso_pu_bacteria 2619619003 2620352122 148
13 iso_pu_bacteria 2626541554 2626633949 148
14 iso_pu_bacteria 2671180195 2671833867 148
15 iso_pu_bacteria 2675902999 2676202172 148
16 iso_pu_bacteria 2684623035 2686536075 148
17 iso_pu_bacteria 2684623036 2686541098 148
18 iso_pu_bacteria 2687453737 2689958706 148
19 iso_pu_bacteria 2687453743 2689990315 148
20 iso_pu_bacteria 2710264753 2710602814 148
21 iso_pu_bacteria 2773857921 2774846748 148
22 iso_pu_bacteria 2773857922 2774852023 148
23 iso_pu_bacteria 2773857924 2774865843 148
24 iso_pu_bacteria 2773857933 2774903968 148
25 iso_pu_bacteria 2895880812 2895887863 148
26 iso_pu_bacteria 2902799365 2902799688 148
27 iso_pu_bacteria 637000116 637880374 148
28 iso_pu_bacteria 8002775197 8002778210 148
29 iso_pu_bacteria 8002784119 8002784258 148
30 iso_pu_bacteria 8053945823 8053950367 148
31 iso_pu_bacteria 8054913762 8054920653 148
32 iso_pu_bacteria 8054920844 8054922966 148
33 iso_pu_bacteria 8055157932 8055161856 148
34 iso_pu_bacteria 8055172936 8055176972 148
35 3300005437 Ga0070710_11033475 Ga0070710_110334751 150
36 3300013307 Ga0157372_11046613 Ga0157372_110466132 150
37 3300031727 Ga0316576_10011232 Ga0316576_100112325 150
38 3300032139 Ga0316580_10042773 Ga0316580_100427733 150
39 3300005327 Ga0070658_10018944 Ga0070658_100189444 151
40 3300005329 Ga0070683_100378567 Ga0070683_1003785674 151
41 3300005445 Ga0070708_100502245 Ga0070708_1005022452 151
42 3300005467 Ga0070706_100174280 Ga0070706_1001742803 151
43 3300005471 Ga0070698_100050340 Ga0070698_1000503404 151
44 3300005617 Ga0068859_100002912 Ga0068859_1000029126 151
45 3300005841 Ga0068863_100001895 Ga0068863_10000189515 151
46 3300005842 Ga0068858_100000960 Ga0068858_10000096023 151
47 3300005842 Ga0068858_100012120 Ga0068858_1000121207 151
48 3300005844 Ga0068862_100000996 Ga0068862_1000009969 151
49 3300006028 Ga0070717_10043187 Ga0070717_100431873 151
50 3300006038 Ga0075365_10006070 Ga0075365_100060708 151
51 3300006846 Ga0075430_100655283 Ga0075430_1006552832 151
52 3300006880 Ga0075429_101342500 Ga0075429_1013425001 151
53 3300006931 Ga0097620_100002912 Ga0097620_1000029126 151
54 3300009098 Ga0105245_10484098 Ga0105245_104840984 151
55 3300009101 Ga0105247_10000013 Ga0105247_10000013115 151
56 3300009101 Ga0105247_10008275 Ga0105247_100082754 151
57 3300009101 Ga0105247_10301921 Ga0105247_103019211 151
58 3300009147 Ga0114129_11010406 Ga0114129_110104062 151
59 3300009177 Ga0105248_10000111 Ga0105248_1000011159 151
60 3300009177 Ga0105248_10001693 Ga0105248_1000169317 151
61 3300009553 Ga0105249_10003088 Ga0105249_100030888 151
62 3300014325 Ga0163163_10026816 Ga0163163_100268164 151
63 3300014325 Ga0163163_10051965 Ga0163163_100519652 151
64 3300014968 Ga0157379_10002948 Ga0157379_100029487 151
65 3300014968 Ga0157379_10448770 Ga0157379_104487702 151
66 3300014968 Ga0157379_10624070 Ga0157379_106240701 151
67 3300025900 Ga0207710_10000012 Ga0207710_10000012169 151
68 3300025900 Ga0207710_10000030 Ga0207710_10000030115 151
69 3300025907 Ga0207645_10735455 Ga0207645_107354551 151
70 3300025909 Ga0207705_10052607 Ga0207705_100526071 151
71 3300025910 Ga0207684_10083218 Ga0207684_100832182 151
72 3300025941 Ga0207711_10000449 Ga0207711_1000044920 151
73 3300025941 Ga0207711_10143251 Ga0207711_101432512 151
74 3300025944 Ga0207661_10152781 Ga0207661_101527814 151
75 3300025961 Ga0207712_10003017 Ga0207712_100030178 151
76 3300026035 Ga0207703_10000856 Ga0207703_100008567 151
77 3300026088 Ga0207641_10004560 Ga0207641_1000456012 151
78 3300028380 Ga0268265_10000088 Ga0268265_100000889 151
79 3300031247 Ga0265340_10002403 Ga0265340_100024033 151
80 3300032002 Ga0307416_100734279 Ga0307416_1007342792 151
81 3300044656 Ga0466969_0006677 Ga0466969_0006677_4866_5324 151
82 3300044684 Ga0466966_0026502 Ga0466966_0026502_2389_2847 151
83 3300044693 Ga0466961_0334345 Ga0466961_0334345_224_682 151
84 3300044719 Ga0466971_0033992 Ga0466971_0033992_1138_1596 151
85 3300045049 Ga0466959_0003708 Ga0466959_0003708_3213_3671 151
86 3300046524 Ga0495648_0067746 Ga0495648_0067746_618_1076 151
87 3300046543 Ga0495645_0187893 Ga0495645_0187893_688_1146 151
88 3300047444 Ga0495675_0029988 Ga0495675_0029988_454_912 151
89 3300048905 Ga0496102_0041989 Ga0496102_0041989_534_992 151
90 3300048907 Ga0496104_0453641 Ga0496104_0453641_315_773 151
91 3300048908 Ga0496105_0549356 Ga0496105_0549356_35_493 151
92 3300048910 Ga0496107_0660585 Ga0496107_0660585_234_692 151
93 3300048917 Ga0496114_0433091 Ga0496114_0433091_544_1011 151
94 3300048919 Ga0496116_0001239 Ga0496116_0001239_9672_10130 151
95 3300048920 Ga0496117_0015227 Ga0496117_0015227_153_611 151
96 3300048920 Ga0496117_0024666 Ga0496117_0024666_3855_4313 151
97 3300048921 Ga0496118_0001008 Ga0496118_0001008_4209_4667 151
98 3300048921 Ga0496118_0008244 Ga0496118_0008244_8920_9378 151
99 3300048921 Ga0496118_0091042 Ga0496118_0091042_1186_1644 151
100 3300048922 Ga0496119_0000290 Ga0496119_0000290_2117_2575 151
101 3300048922 Ga0496119_0006955 Ga0496119_0006955_251_709 151
102 3300048922 Ga0496119_0078419 Ga0496119_0078419_702_1160 151
103 3300048923 Ga0496120_0000103 Ga0496120_0000103_2117_2575 151
104 3300048923 Ga0496120_0374111 Ga0496120_0374111_43_501 151
105 3300048924 Ga0496121_0017184 Ga0496121_0017184_6913_7371 151
106 3300048924 Ga0496121_0029472 Ga0496121_0029472_1029_1487 151
107 3300048929 Ga0496126_0418921 Ga0496126_0418921_204_707 151
108 3300048929 Ga0496126_0542641 Ga0496126_0542641_43_501 151
109 3300049581 Ga0501047_0035577 Ga0501047_0035577_2502_2960 151
110 3300050511 nmdc:mga08y16_2078127_c1 nmdc:mga08y16_2078127_c1_18_473 151
111 3300053092 Ga0500583_0050129 Ga0500583_0050129_339_797 151
112 3300061719 Ga0466962_0011051 Ga0466962_0011051_691_1149 151
113 3300005329 Ga0070683_100884681 Ga0070683_1008846812 152
114 3300005842 Ga0068858_100000004 Ga0068858_10000000462 152
115 3300005937 Ga0081455_10003503 Ga0081455_100035038 152
116 3300005937 Ga0081455_10158168 Ga0081455_101581682 152
117 3300006844 Ga0075428_100060436 Ga0075428_1000604364 152
118 3300006846 Ga0075430_100092237 Ga0075430_1000922374 152
119 3300006847 Ga0075431_100045623 Ga0075431_1000456234 152
120 3300006847 Ga0075431_100246831 Ga0075431_1002468313 152
121 3300009147 Ga0114129_10534066 Ga0114129_105340662 152
122 3300009177 Ga0105248_10000150 Ga0105248_1000015054 152
123 3300009177 Ga0105248_12843714 Ga0105248_128437141 152
124 3300013306 Ga0163162_10892228 Ga0163162_108922282 152
125 3300013307 Ga0157372_10799829 Ga0157372_107998292 152
126 3300013308 Ga0157375_10252863 Ga0157375_102528633 152
127 3300013308 Ga0157375_11943437 Ga0157375_119434371 152
128 3300014325 Ga0163163_10006866 Ga0163163_100068665 152
129 3300014325 Ga0163163_11890118 Ga0163163_118901182 152
130 3300014968 Ga0157379_10000001 Ga0157379_1000000127 152
131 3300025904 Ga0207647_10399232 Ga0207647_103992322 152
132 3300025941 Ga0207711_10001121 Ga0207711_1000112124 152
133 3300025944 Ga0207661_10593025 Ga0207661_105930251 152
134 3300026035 Ga0207703_10000011 Ga0207703_1000001162 152
135 3300041443 Ga0451789_0280959 Ga0451789_0280959_12_491 152
136 3300041451 Ga0451791_0599645 Ga0451791_0599645_1417_1896 152
137 3300041498 Ga0451841_0078331 Ga0451841_0078331_73_552 152
138 3300041512 Ga0451853_1958029 Ga0451853_1958029_227_706 152
139 3300044706 Ga0466964_0143796 Ga0466964_0143796_46_507 152
140 3300048903 Ga0496100_0596826 Ga0496100_0596826_142_603 152
141 3300048905 Ga0496102_0400347 Ga0496102_0400347_351_812 152
142 3300048908 Ga0496105_0580442 Ga0496105_0580442_169_630 152
143 3300048913 Ga0496110_0934067 Ga0496110_0934067_185_652 152
144 3300048918 Ga0496115_0042715 Ga0496115_0042715_1507_1968 152
145 3300049585 Ga0501069_0502162 Ga0501069_0502162_196_657 152
146 3300049586 Ga0501070_0391894 Ga0501070_0391894_114_575 152
147 3300049586 Ga0501070_1407353 Ga0501070_1407353_56_517 152
148 3300049822 Ga0501035_1552463 Ga0501035_1552463_13_474 152
149 3300050510 nmdc:mga06r32_58193_c1 nmdc:mga06r32_58193_c1_1424_1885 152
150 3300050510 nmdc:mga06r32_59107_c1 nmdc:mga06r32_59107_c1_1227_1688 152
151 3300053153 Ga0500616_0041434 Ga0500616_0041434_990_1451 152
152 iso_pu_bacteria 2643221690 2644503510 152
153 3300005337 Ga0070682_100016992 Ga0070682_1000169922 153
154 3300005435 Ga0070714_100493771 Ga0070714_1004937711 153
155 3300005455 Ga0070663_100005076 Ga0070663_10000507611 153
156 3300005530 Ga0070679_100641781 Ga0070679_1006417812 153
157 3300005563 Ga0068855_100071425 Ga0068855_1000714253 153
158 3300005578 Ga0068854_100087370 Ga0068854_1000873704 153
159 3300006048 Ga0075363_100019084 Ga0075363_1000190841 153
160 3300009551 Ga0105238_10552660 Ga0105238_105526602 153
161 3300013104 Ga0157370_10487215 Ga0157370_104872153 153
162 3300021384 Ga0213876_10038540 Ga0213876_100385404 153
163 3300025920 Ga0207649_10878487 Ga0207649_108784871 153
164 3300025924 Ga0207694_10375755 Ga0207694_103757552 153
165 3300025928 Ga0207700_10535435 Ga0207700_105354352 153
166 3300025938 Ga0207704_10808920 Ga0207704_108089202 153
167 3300026067 Ga0207678_10011639 Ga0207678_100116395 153
168 3300031251 Ga0265327_10002452 Ga0265327_1000245217 153
169 3300037853 Ga0436364_0737533 Ga0436364_0737533_536_997 153
170 3300039437 Ga0436365_0464343 Ga0436365_0464343_1553_2014 153
171 3300042438 Ga0439459_0003885 Ga0439459_0003885_1073_1555 153
172 3300044694 Ga0466963_0028433 Ga0466963_0028433_1354_1815 153
173 3300044694 Ga0466963_0306316 Ga0466963_0306316_312_773 153
174 3300044842 Ga0466957_0671888 Ga0466957_0671888_57_518 153
175 3300045976 Ga0466967_0001138 Ga0466967_0001138_25_486 153
176 3300045976 Ga0466967_0176523 Ga0466967_0176523_120_581 153
177 3300045976 Ga0466967_0869548 Ga0466967_0869548_263_724 153
178 3300046506 Ga0495583_0092745 Ga0495583_0092745_23_484 153
179 3300048903 Ga0496100_0002008 Ga0496100_0002008_1678_2160 153
180 3300048904 Ga0496101_0000056 Ga0496101_0000056_69932_70414 153
181 3300048904 Ga0496101_0078647 Ga0496101_0078647_1258_1719 153
182 3300048905 Ga0496102_0000177 Ga0496102_0000177_71557_72039 153
183 3300048905 Ga0496102_0000277 Ga0496102_0000277_21826_22287 153
184 3300048906 Ga0496103_0000003 Ga0496103_0000003_14686_15168 153
185 3300048906 Ga0496103_0003601 Ga0496103_0003601_5515_5976 153
186 3300048908 Ga0496105_1116460 Ga0496105_1116460_29_511 153
187 3300048909 Ga0496106_0267480 Ga0496106_0267480_606_1088 153
188 3300048910 Ga0496107_0174835 Ga0496107_0174835_684_1145 153
189 3300048910 Ga0496107_0530454 Ga0496107_0530454_151_633 153
190 3300048917 Ga0496114_1357515 Ga0496114_1357515_61_522 153
191 3300048919 Ga0496116_0000013 Ga0496116_0000013_588826_589308 153
192 3300048919 Ga0496116_0017191 Ga0496116_0017191_5045_5506 153
193 3300048920 Ga0496117_0000013 Ga0496117_0000013_14686_15168 153
194 3300048920 Ga0496117_0000760 Ga0496117_0000760_24398_24859 153
195 3300048921 Ga0496118_0000011 Ga0496118_0000011_588828_589310 153
196 3300048921 Ga0496118_0000225 Ga0496118_0000225_32246_32707 153
197 3300048922 Ga0496119_0009102 Ga0496119_0009102_6815_7276 153
198 3300048922 Ga0496119_0058962 Ga0496119_0058962_87_569 153
199 3300048922 Ga0496119_0302945 Ga0496119_0302945_225_686 153
200 3300048923 Ga0496120_0011523 Ga0496120_0011523_522_983 153
201 3300048923 Ga0496120_0356649 Ga0496120_0356649_87_569 153
202 3300048924 Ga0496121_0000060 Ga0496121_0000060_211034_211516 153
203 3300048924 Ga0496121_0005980 Ga0496121_0005980_9074_9535 153
204 3300048927 Ga0496124_0125966 Ga0496124_0125966_17_478 153
205 3300048929 Ga0496126_0001508 Ga0496126_0001508_11043_11525 153
206 3300048929 Ga0496126_0016980 Ga0496126_0016980_6739_7200 153
207 3300048929 Ga0496126_0568180 Ga0496126_0568180_62_523 153
208 3300048929 Ga0496126_0830264 Ga0496126_0830264_20_481 153
209 3300053087 Ga0500643_004109 Ga0500643_004109_3877_4338 153
210 3300061719 Ga0466962_0064988 Ga0466962_0064988_914_1375 153
211 3300001990 JGI24737J22298_10054785 JGI24737J22298_100547853 154
212 3300001991 JGI24743J22301_10005526 JGI24743J22301_100055264 154
213 3300002075 JGI24738J21930_10006643 JGI24738J21930_100066434 154
214 3300002077 JGI24744J21845_10003700 JGI24744J21845_100037004 154
215 3300005330 Ga0070690_100015248 Ga0070690_1000152484 154
216 3300005330 Ga0070690_100342653 Ga0070690_1003426532 154
217 3300005338 Ga0068868_100163195 Ga0068868_1001631953 154
218 3300005339 Ga0070660_100313918 Ga0070660_1003139182 154
219 3300005340 Ga0070689_100179831 Ga0070689_1001798313 154
220 3300005341 Ga0070691_10523854 Ga0070691_105238542 154
221 3300005345 Ga0070692_10295282 Ga0070692_102952821 154
222 3300005347 Ga0070668_100046057 Ga0070668_1000460574 154
223 3300005347 Ga0070668_100090604 Ga0070668_1000906044 154
224 3300005347 Ga0070668_100196004 Ga0070668_1001960042 154
225 3300005347 Ga0070668_101025039 Ga0070668_1010250392 154
226 3300005354 Ga0070675_100336841 Ga0070675_1003368412 154
227 3300005355 Ga0070671_101460630 Ga0070671_1014606301 154
228 3300005356 Ga0070674_100368171 Ga0070674_1003681712 154
229 3300005364 Ga0070673_100080812 Ga0070673_1000808122 154
230 3300005364 Ga0070673_102104879 Ga0070673_1021048791 154
231 3300005365 Ga0070688_100127342 Ga0070688_1001273423 154
232 3300005366 Ga0070659_100287577 Ga0070659_1002875772 154
233 3300005367 Ga0070667_100104113 Ga0070667_1001041133 154
234 3300005367 Ga0070667_100878888 Ga0070667_1008788881 154
235 3300005434 Ga0070709_10085708 Ga0070709_100857084 154
236 3300005435 Ga0070714_100874633 Ga0070714_1008746331 154
237 3300005437 Ga0070710_10042068 Ga0070710_100420683 154
238 3300005440 Ga0070705_100378983 Ga0070705_1003789832 154
239 3300005441 Ga0070700_100051574 Ga0070700_1000515743 154
240 3300005444 Ga0070694_100160851 Ga0070694_1001608513 154
241 3300005455 Ga0070663_100138495 Ga0070663_1001384953 154
242 3300005456 Ga0070678_100260795 Ga0070678_1002607952 154
243 3300005456 Ga0070678_100711810 Ga0070678_1007118102 154
244 3300005457 Ga0070662_100378649 Ga0070662_1003786492 154
245 3300005459 Ga0068867_100295963 Ga0068867_1002959632 154
246 3300005459 Ga0068867_101324110 Ga0068867_1013241101 154
247 3300005466 Ga0070685_10033601 Ga0070685_100336012 154
248 3300005466 Ga0070685_10054870 Ga0070685_100548703 154
249 3300005539 Ga0068853_100150998 Ga0068853_1001509982 154
250 3300005546 Ga0070696_100039611 Ga0070696_1000396114 154
251 3300005547 Ga0070693_100076637 Ga0070693_1000766374 154
252 3300005548 Ga0070665_100217407 Ga0070665_1002174074 154
253 3300005548 Ga0070665_101402138 Ga0070665_1014021382 154
254 3300005549 Ga0070704_100463545 Ga0070704_1004635452 154
255 3300005578 Ga0068854_100472427 Ga0068854_1004724272 154
256 3300005614 Ga0068856_100973435 Ga0068856_1009734352 154
257 3300005615 Ga0070702_100277241 Ga0070702_1002772413 154
258 3300005615 Ga0070702_100278944 Ga0070702_1002789442 154
259 3300005617 Ga0068859_100772017 Ga0068859_1007720172 154
260 3300005617 Ga0068859_101385419 Ga0068859_1013854192 154
261 3300005618 Ga0068864_100149478 Ga0068864_1001494784 154
262 3300005618 Ga0068864_101458909 Ga0068864_1014589091 154
263 3300005718 Ga0068866_10761793 Ga0068866_107617932 154
264 3300005719 Ga0068861_100228890 Ga0068861_1002288903 154
265 3300005719 Ga0068861_101183070 Ga0068861_1011830702 154
266 3300005719 Ga0068861_101346795 Ga0068861_1013467951 154
267 3300005842 Ga0068858_100943283 Ga0068858_1009432831 154
268 3300005842 Ga0068858_101334481 Ga0068858_1013344812 154
269 3300005843 Ga0068860_101168413 Ga0068860_1011684132 154
270 3300005844 Ga0068862_100692214 Ga0068862_1006922142 154
271 3300006048 Ga0075363_100413514 Ga0075363_1004135142 154
272 3300006051 Ga0075364_10304259 Ga0075364_103042593 154
273 3300006175 Ga0070712_100033754 Ga0070712_1000337545 154
274 3300006186 Ga0075369_10008120 Ga0075369_100081203 154
275 3300006871 Ga0075434_100788465 Ga0075434_1007884653 154
276 3300006881 Ga0068865_100456531 Ga0068865_1004565312 154
277 3300006931 Ga0097620_100772011 Ga0097620_1007720112 154
278 3300006931 Ga0097620_101385460 Ga0097620_1013854602 154
279 3300009098 Ga0105245_10225732 Ga0105245_102257323 154
280 3300009101 Ga0105247_10277469 Ga0105247_102774693 154
281 3300009174 Ga0105241_10048891 Ga0105241_100488913 154
282 3300009176 Ga0105242_10182379 Ga0105242_101823792 154
283 3300009176 Ga0105242_11617593 Ga0105242_116175932 154
284 3300009177 Ga0105248_10000576 Ga0105248_1000057629 154
285 3300009177 Ga0105248_10119811 Ga0105248_101198113 154
286 3300009177 Ga0105248_10158249 Ga0105248_101582493 154
287 3300009553 Ga0105249_10000008 Ga0105249_1000000829 154
288 3300010375 Ga0105239_10291401 Ga0105239_102914012 154
289 3300011119 Ga0105246_10044441 Ga0105246_100444413 154
290 3300013102 Ga0157371_10298134 Ga0157371_102981343 154
291 3300013105 Ga0157369_10222014 Ga0157369_102220142 154
292 3300013296 Ga0157374_10008203 Ga0157374_100082036 154
293 3300013297 Ga0157378_10914832 Ga0157378_109148321 154
294 3300013306 Ga0163162_10407631 Ga0163162_104076313 154
295 3300013308 Ga0157375_10289188 Ga0157375_102891882 154
296 3300013308 Ga0157375_10472722 Ga0157375_104727221 154
297 3300014325 Ga0163163_10058553 Ga0163163_100585534 154
298 3300014325 Ga0163163_10273092 Ga0163163_102730923 154
299 3300014325 Ga0163163_12132994 Ga0163163_121329941 154
300 3300014326 Ga0157380_10464478 Ga0157380_104644782 154
301 3300014745 Ga0157377_10048275 Ga0157377_100482753 154
302 3300014968 Ga0157379_10133072 Ga0157379_101330724 154
303 3300014968 Ga0157379_10197627 Ga0157379_101976273 154
304 3300017792 Ga0163161_10018837 Ga0163161_100188374 154
305 3300017792 Ga0163161_10066884 Ga0163161_100668843 154
306 3300020078 Ga0206352_10120757 Ga0206352_101207572 154
307 3300020610 Ga0154015_1269596 Ga0154015_12695962 154
308 3300021388 Ga0213875_10066019 Ga0213875_100660193 154
309 3300025899 Ga0207642_10222129 Ga0207642_102221292 154
310 3300025901 Ga0207688_10001733 Ga0207688_100017333 154
311 3300025903 Ga0207680_10464768 Ga0207680_104647682 154
312 3300025903 Ga0207680_10779986 Ga0207680_107799861 154
313 3300025904 Ga0207647_10052964 Ga0207647_100529642 154
314 3300025905 Ga0207685_10108931 Ga0207685_101089312 154
315 3300025906 Ga0207699_10144375 Ga0207699_101443753 154
316 3300025907 Ga0207645_10425802 Ga0207645_104258022 154
317 3300025915 Ga0207693_10041350 Ga0207693_100413504 154
318 3300025916 Ga0207663_10057149 Ga0207663_100571494 154
319 3300025917 Ga0207660_10062603 Ga0207660_100626032 154
320 3300025919 Ga0207657_10061244 Ga0207657_100612442 154
321 3300025927 Ga0207687_10235386 Ga0207687_102353862 154
322 3300025927 Ga0207687_11066834 Ga0207687_110668341 154
323 3300025929 Ga0207664_10774648 Ga0207664_107746482 154
324 3300025933 Ga0207706_10361961 Ga0207706_103619613 154
325 3300025934 Ga0207686_11167230 Ga0207686_111672302 154
326 3300025936 Ga0207670_10339070 Ga0207670_103390702 154
327 3300025937 Ga0207669_10170744 Ga0207669_101707442 154
328 3300025937 Ga0207669_11575709 Ga0207669_115757091 154
329 3300025940 Ga0207691_10043366 Ga0207691_100433664 154
330 3300025941 Ga0207711_10006284 Ga0207711_1000628412 154
331 3300025942 Ga0207689_10043768 Ga0207689_100437684 154
332 3300025945 Ga0207679_10413793 Ga0207679_104137932 154
333 3300025961 Ga0207712_10391280 Ga0207712_103912802 154
334 3300025972 Ga0207668_10000225 Ga0207668_1000022535 154
335 3300025972 Ga0207668_10248549 Ga0207668_102485492 154
336 3300025986 Ga0207658_11077922 Ga0207658_110779222 154
337 3300026023 Ga0207677_10148402 Ga0207677_101484023 154
338 3300026035 Ga0207703_10722055 Ga0207703_107220552 154
339 3300026041 Ga0207639_10141569 Ga0207639_101415694 154
340 3300026067 Ga0207678_10044403 Ga0207678_100444034 154
341 3300026075 Ga0207708_10402852 Ga0207708_104028522 154
342 3300026078 Ga0207702_10968407 Ga0207702_109684072 154
343 3300026089 Ga0207648_10412199 Ga0207648_104121992 154
344 3300026095 Ga0207676_10769526 Ga0207676_107695262 154
345 3300026118 Ga0207675_100529730 Ga0207675_1005297302 154
346 3300026118 Ga0207675_100749830 Ga0207675_1007498302 154
347 3300026121 Ga0207683_10043059 Ga0207683_100430593 154
348 3300026121 Ga0207683_10278743 Ga0207683_102787432 154
349 3300028379 Ga0268266_10102847 Ga0268266_101028473 154
350 3300031548 Ga0307408_101091060 Ga0307408_1010910602 154
351 3300031852 Ga0307410_10153841 Ga0307410_101538412 154
352 3300031995 Ga0307409_100068765 Ga0307409_1000687653 154
353 3300032002 Ga0307416_100082739 Ga0307416_1000827394 154
354 3300032005 Ga0307411_10471310 Ga0307411_104713102 154
355 3300032126 Ga0307415_100040458 Ga0307415_1000404583 154
356 3300035691 Ga0373931_0056745 Ga0373931_0056745_1365_1829 154
357 3300037418 Ga0395900_0319732 Ga0395900_0319732_113_577 154
358 3300037853 Ga0436364_1372527 Ga0436364_1372527_15088_15561 154
359 3300039437 Ga0436365_1076962 Ga0436365_1076962_3901_4374 154
360 3300041411 Ga0439466_0014161 Ga0439466_0014161_376_840 154
361 3300041413 Ga0439465_0010344 Ga0439465_0010344_792_1256 154
362 3300041997 Ga0439431_0013273 Ga0439431_0013273_1027_1491 154
363 3300042435 Ga0439434_0181360 Ga0439434_0181360_93_557 154
364 3300046460 Ga0495638_0026845 Ga0495638_0026845_3112_3630 154
365 3300046491 Ga0495584_0134534 Ga0495584_0134534_576_1040 154
366 3300046616 Ga0495668_0219368 Ga0495668_0219368_534_998 154
367 3300046660 Ga0495625_0161340 Ga0495625_0161340_749_1267 154
368 3300046692 Ga0495671_0181655 Ga0495671_0181655_113_577 154
369 3300046694 Ga0495649_0176556 Ga0495649_0176556_337_801 154
370 3300047320 Ga0495672_0144590 Ga0495672_0144590_85_549 154
371 3300047446 Ga0495679_071452 Ga0495679_071452_451_915 154
372 3300048091 Ga0495626_0038419 Ga0495626_0038419_214_678 154
373 3300048903 Ga0496100_0020172 Ga0496100_0020172_93_557 154
374 3300048904 Ga0496101_0202364 Ga0496101_0202364_1021_1485 154
375 3300048905 Ga0496102_0064506 Ga0496102_0064506_2218_2682 154
376 3300048905 Ga0496102_0078169 Ga0496102_0078169_88_552 154
377 3300048905 Ga0496102_1046192 Ga0496102_1046192_111_575 154
378 3300048906 Ga0496103_0492062 Ga0496103_0492062_212_676 154
379 3300048906 Ga0496103_0730231 Ga0496103_0730231_98_562 154
380 3300048907 Ga0496104_0206288 Ga0496104_0206288_409_873 154
381 3300048907 Ga0496104_0284494 Ga0496104_0284494_107_571 154
382 3300048908 Ga0496105_0237639 Ga0496105_0237639_146_610 154
383 3300048909 Ga0496106_0375524 Ga0496106_0375524_540_1004 154
384 3300048910 Ga0496107_0134378 Ga0496107_0134378_1295_1759 154
385 3300048911 Ga0496108_0002140 Ga0496108_0002140_13043_13507 154
386 3300048911 Ga0496108_0386336 Ga0496108_0386336_692_1156 154
387 3300048912 Ga0496109_0002325 Ga0496109_0002325_13396_13860 154
388 3300048913 Ga0496110_0669290 Ga0496110_0669290_134_598 154
389 3300048914 Ga0496111_0094740 Ga0496111_0094740_490_954 154
390 3300048915 Ga0496112_0072872 Ga0496112_0072872_1279_1743 154
391 3300048916 Ga0496113_0115619 Ga0496113_0115619_1342_1806 154
392 3300048916 Ga0496113_1233750 Ga0496113_1233750_19_501 154
393 3300048917 Ga0496114_0006016 Ga0496114_0006016_9035_9499 154
394 3300048917 Ga0496114_0196010 Ga0496114_0196010_137_601 154
395 3300048917 Ga0496114_0635115 Ga0496114_0635115_110_574 154
396 3300048918 Ga0496115_0063114 Ga0496115_0063114_945_1409 154
397 3300048918 Ga0496115_0155664 Ga0496115_0155664_454_918 154
398 3300048921 Ga0496118_0233527 Ga0496118_0233527_72_536 154
399 3300049742 Ga0501080_0099743 Ga0501080_0099743_1104_1568 154
400 3300050496 nmdc:mga07m45_15444_c1 nmdc:mga07m45_15444_c1_3601_4065 154
401 3300050512 nmdc:mga0n895_1354191_c1 nmdc:mga0n895_1354191_c1_139_603 154
402 3300050516 nmdc:mga0sz30_100843_c1 nmdc:mga0sz30_100843_c1_281_745 154
403 3300053079 Ga0500610_0028159 Ga0500610_0028159_1008_1526 154
404 3300053104 Ga0500556_0003396 Ga0500556_0003396_851_1369 154
405 3300053104 Ga0500556_0010763 Ga0500556_0010763_1761_2225 154
406 3300053108 Ga0500562_006384 Ga0500562_006384_502_966 154
407 3300053131 Ga0500652_167046 Ga0500652_167046_87_551 154
408 3300053142 Ga0500577_0040299 Ga0500577_0040299_647_1111 154
409 3300053146 Ga0500588_0131907 Ga0500588_0131907_102_566 154
410 3300053151 Ga0500604_0247612 Ga0500604_0247612_117_581 154
411 3300053153 Ga0500616_0032724 Ga0500616_0032724_450_914 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

36

162

0.98

PF08534

Redoxin

Redoxin

35

180

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9998 1 151
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9989 1 151
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.982 1 151
1xvw-assembly1.cif.gz_B crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin 0.9813 1 152
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9803 1 151
ID Description Score Start End Superfamily
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9989 1 151 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9731 1 151 3.40.30.10
1psqB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9233 2 151 3.40.30.10
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9219 1 133 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9173 2 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1X2EIV2-F1-model_v4 Peroxiredoxin 1.003 1 152 GO:0016209
GO:0016491
AF-A0A0G3IT38-F1-model_v4 Peroxiredoxin 1.003 3 152 GO:0016209
GO:0016491
AF-A0A255DAB7-F1-model_v4 Peroxiredoxin 1.003 1 151 GO:0016209
GO:0016491
AF-A0A0B2YIS2-F1-model_v4 deleted 1.003 1 153
AF-A0A1A2PSM3-F1-model_v4 Peroxiredoxin 1.003 1 152 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
96.69 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map