F437185

General Info

Members Datasets Scaffolds Average Seq Length
410 249 407 201

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100051033|Ga0070698_1000510334
Length 236
Sequence LNLYLGSGERQVKVAGVAVEKTDRFVFNPDKRGLMGTLMTFSERYLQEVHKIINLIDVDPIERMATILARLRGTDGRLFFLGVGGGAGNCGHAVNDFRKIAGIEAYAPTDNVSELTARTNDEGWETVFVEWLKVSRLTPNDALFIFSVGGGSLEKNVSPNLVRALQYAKEVGASVLGVVGRDGGYTSKVGDAIVIVPTVNPEAVTPHTEAFQAVIWHLLVTHPLLKARQTKWEATP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
3 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
245 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
246 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.24
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0.24
Rhizoplane 2.93
Rhizosphere 92.2
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3150975 2162886012 Bacteria 3062
2 JGI24746J21847_1007673 3300001977 Bacteria 1643
3 JGI24743J22301_10005397 3300001991 Bacteria 2132
4 JGI25159J45721_1000167 3300002987 Bacteria 30455
5 JGI25160J50197_1000288 3300003354 Bacteria 36505
6 JGI25161J50226_1000215 3300003374 Bacteria 36505
7 Ga0055543_1000006 3300004625 Bacteria 214206
8 Ga0065165_1000215 3300005262 Bacteria 100238
9 Ga0065712_10079435 3300005290 Bacteria 3218
10 Ga0065712_10136696 3300005290 Bacteria 1490
11 Ga0065715_10142656 3300005293 Bacteria 1831
12 Ga0065715_10228239 3300005293 Bacteria 1244
13 Ga0070676_10036088 3300005328 Bacteria 2846
14 Ga0070676_10305592 3300005328 Bacteria 1080
15 Ga0070683_100007518 3300005329 Bacteria 9210
16 Ga0070690_100006139 3300005330 Bacteria 6802
17 Ga0070670_100010889 3300005331 Bacteria 7769
18 Ga0070670_100013239 3300005331 Bacteria 7067
19 Ga0070670_100238749 3300005331 Bacteria 1582
20 Ga0070677_10005763 3300005333 Bacteria 4096
21 Ga0070677_10010892 3300005333 Bacteria 3121
22 Ga0070666_10015255 3300005335 Bacteria 4900
23 Ga0070666_10021867 3300005335 Bacteria 4148
24 Ga0070666_10057181 3300005335 Bacteria 2635
25 Ga0070680_100358048 3300005336 Unclassified 1241
26 Ga0070682_100150951 3300005337 Bacteria 1594
27 Ga0070682_100531214 3300005337 Unclassified 917
28 Ga0068868_100003793 3300005338 Bacteria 10547
29 Ga0068868_100075866 3300005338 Bacteria 2687
30 Ga0068868_100129315 3300005338 Bacteria 2065
31 Ga0070660_100126376 3300005339 Bacteria 2043
32 Ga0070689_100000455 3300005340 Bacteria 24194
33 Ga0070689_100035029 3300005340 Bacteria 3833
34 Ga0070689_100646812 3300005340 Unclassified 919
35 Ga0070687_100021009 3300005343 Bacteria 3061
36 Ga0070687_100081645 3300005343 Bacteria 1766
37 Ga0070687_100361702 3300005343 Bacteria 940
38 Ga0070661_100009861 3300005344 Bacteria 6626
39 Ga0070661_100032261 3300005344 Bacteria 3791
40 Ga0070661_100100511 3300005344 Bacteria 2150
41 Ga0070692_10285935 3300005345 Bacteria 1001
42 Ga0070692_10516177 3300005345 Unclassified 777
43 Ga0070668_100249021 3300005347 Bacteria 1474
44 Ga0070668_100580326 3300005347 Bacteria 979
45 Ga0070669_100006869 3300005353 Bacteria 8181
46 Ga0070669_100827394 3300005353 Bacteria 788
47 Ga0070675_100448494 3300005354 Bacteria 1157
48 Ga0070671_100022544 3300005355 Bacteria 5143
49 Ga0070671_100037938 3300005355 Bacteria 3998
50 Ga0070671_100052321 3300005355 Bacteria 3395
51 Ga0070671_100293287 3300005355 Unclassified 1384
52 Ga0070673_100007703 3300005364 Bacteria 7127
53 Ga0070673_100527808 3300005364 Bacteria 1070
54 Ga0070688_100013282 3300005365 Bacteria 4639
55 Ga0070667_100141363 3300005367 Bacteria 2108
56 Ga0070667_100228515 3300005367 Unclassified 1658
57 Ga0070703_10000274 3300005406 Bacteria 24474
58 Ga0070709_10263141 3300005434 Bacteria 1247
59 Ga0070714_100000912 3300005435 Bacteria 20923
60 Ga0070701_10004148 3300005438 Bacteria 5824
61 Ga0070701_10286502 3300005438 Unclassified 1008
62 Ga0070700_100008331 3300005441 Bacteria 5644
63 Ga0070700_100026964 3300005441 Unclassified 3401
64 Ga0070700_100656379 3300005441 Unclassified 829
65 Ga0070694_100719141 3300005444 Bacteria 813
66 Ga0070663_100006399 3300005455 Bacteria 7081
67 Ga0070663_100616597 3300005455 Unclassified 914
68 Ga0070678_100063454 3300005456 Bacteria 2734
69 Ga0070678_100113039 3300005456 Bacteria 2128
70 Ga0070678_100574997 3300005456 Bacteria 1003
71 Ga0070678_100748144 3300005456 Unclassified 884
72 Ga0070662_100021163 3300005457 Bacteria 4438
73 Ga0070681_10050282 3300005458 Bacteria 4159
74 Ga0070681_10231759 3300005458 Bacteria 1761
75 Ga0068867_100013241 3300005459 Bacteria 5842
76 Ga0068867_100142545 3300005459 Bacteria 1875
77 Ga0068867_100393457 3300005459 Bacteria 1167
78 Ga0070706_100089894 3300005467 Bacteria 2848
79 Ga0070707_100368774 3300005468 Bacteria 1395
80 Ga0070698_100051033 3300005471 Bacteria 4214
81 Ga0070698_100069387 3300005471 Bacteria 3539
82 Ga0070698_100180874 3300005471 Bacteria 2047
83 Ga0070699_100193761 3300005518 Bacteria 1806
84 Ga0070684_100001324 3300005535 Bacteria 17753
85 Ga0068853_100076897 3300005539 Bacteria 2915
86 Ga0068853_100200646 3300005539 Bacteria 1815
87 Ga0070672_100068120 3300005543 Bacteria 2822
88 Ga0070686_100191071 3300005544 Bacteria 1461
89 Ga0070686_100586849 3300005544 Bacteria 876
90 Ga0070696_100081615 3300005546 Bacteria 2291
91 Ga0070693_100013862 3300005547 Bacteria 4117
92 Ga0070693_100525429 3300005547 Unclassified 843
93 Ga0070665_100218901 3300005548 Bacteria 1904
94 Ga0070704_101109695 3300005549 Unclassified 719
95 Ga0068855_100345152 3300005563 Bacteria 1641
96 Ga0070664_100000841 3300005564 Bacteria 23674
97 Ga0070664_100001423 3300005564 Bacteria 19088
98 Ga0070664_100580695 3300005564 Unclassified 1038
99 Ga0068857_100001955 3300005577 Bacteria 16644
100 Ga0068857_100028809 3300005577 Bacteria 4900
101 Ga0068854_100011953 3300005578 Bacteria 5673
102 Ga0068854_100025076 3300005578 Bacteria 4090
103 Ga0068854_100938782 3300005578 Bacteria 762
104 Ga0068856_100155178 3300005614 Bacteria 2299
105 Ga0068856_100211652 3300005614 Bacteria 1954
106 Ga0070702_100052390 3300005615 Bacteria 2340
107 Ga0070702_100090211 3300005615 Bacteria 1857
108 Ga0068852_100024229 3300005616 Bacteria 4901
109 Ga0068852_100025890 3300005616 Bacteria 4760
110 Ga0068859_100003129 3300005617 Bacteria 16814
111 Ga0068859_100011695 3300005617 Bacteria 8817
112 Ga0068859_100282818 3300005617 Bacteria 1751
113 Ga0068864_100023166 3300005618 Bacteria 5214
114 Ga0068866_10013907 3300005718 Bacteria 3541
115 Ga0068861_100061602 3300005719 Bacteria 2880
116 Ga0068870_10012503 3300005840 Bacteria 3969
117 Ga0068870_10214974 3300005840 Bacteria 1173
118 Ga0068863_100030581 3300005841 Bacteria 5141
119 Ga0068858_100002579 3300005842 Bacteria 18247
120 Ga0068858_100114049 3300005842 Bacteria 2524
121 Ga0068858_100129273 3300005842 Bacteria 2367
122 Ga0068858_100144785 3300005842 Bacteria 2231
123 Ga0068858_100216304 3300005842 Bacteria 1814
124 Ga0068858_100225391 3300005842 Bacteria 1776
125 Ga0068860_100025812 3300005843 Bacteria 5667
126 Ga0068860_100040445 3300005843 Bacteria 4455
127 Ga0068862_100025500 3300005844 Bacteria 4963
128 Ga0068862_100082649 3300005844 Bacteria 2788
129 Ga0068862_100133740 3300005844 Bacteria 2196
130 Ga0070717_10026903 3300006028 Bacteria 4594
131 Ga0070717_10130843 3300006028 Bacteria 2158
132 Ga0075432_10105500 3300006058 Unclassified 1045
133 Ga0070712_100006531 3300006175 Bacteria 7239
134 Ga0097621_100028451 3300006237 Bacteria 4404
135 Ga0097621_100260972 3300006237 Unclassified 1520
136 Ga0068871_100109527 3300006358 Bacteria 2322
137 Ga0075428_100004174 3300006844 Bacteria 15901
138 Ga0075428_100249197 3300006844 Bacteria 1915
139 Ga0075430_100075061 3300006846 Bacteria 2835
140 Ga0075431_100000173 3300006847 Bacteria 45790
141 Ga0075433_10046552 3300006852 Bacteria 3772
142 Ga0075433_10201881 3300006852 Bacteria 1768
143 Ga0075434_100670857 3300006871 Bacteria 1055
144 Ga0075429_100057416 3300006880 Bacteria 3389
145 Ga0075429_100060299 3300006880 Bacteria 3305
146 Ga0068865_100099730 3300006881 Bacteria 2124
147 Ga0068865_100556975 3300006881 Unclassified 963
148 Ga0097620_100003129 3300006931 Bacteria 16814
149 Ga0097620_100011695 3300006931 Bacteria 8817
150 Ga0097620_100282841 3300006931 Bacteria 1751
151 Ga0075435_100460135 3300007076 Bacteria 1097
152 Ga0099795_10121632 3300007788 Unclassified 1044
153 Ga0105240_10055902 3300009093 Bacteria 4940
154 Ga0105240_10215286 3300009093 Bacteria 2242
155 Ga0105240_11813178 3300009093 Bacteria 636
156 Ga0111539_10008939 3300009094 Bacteria 12682
157 Ga0111539_10316853 3300009094 Bacteria 1815
158 Ga0111539_10627567 3300009094 Bacteria 1251
159 Ga0105245_10112071 3300009098 Bacteria 2538
160 Ga0105245_10254971 3300009098 Bacteria 1706
161 Ga0114129_10303057 3300009147 Unclassified 2129
162 Ga0105241_10066757 3300009174 Bacteria 2783
163 Ga0105241_10181428 3300009174 Bacteria 1747
164 Ga0105242_10232273 3300009176 Bacteria 1653
165 Ga0105242_10704477 3300009176 Bacteria 988
166 Ga0105248_10041089 3300009177 Bacteria 5184
167 Ga0105248_10200541 3300009177 Bacteria 2248
168 Ga0105248_10702973 3300009177 Bacteria 1141
169 Ga0105249_10007432 3300009553 Bacteria 9558
170 Ga0105249_10586733 3300009553 Bacteria 1168
171 Ga0099796_10099037 3300010159 Bacteria 1094
172 Ga0099796_10195155 3300010159 Bacteria 819
173 Ga0105239_10381334 3300010375 Bacteria 1594
174 Ga0157371_10056301 3300013102 Bacteria 2789
175 Ga0157370_10131265 3300013104 Bacteria 2337
176 Ga0157369_10027692 3300013105 Bacteria 6279
177 Ga0157374_10002418 3300013296 Bacteria 15756
178 Ga0157378_10000261 3300013297 Bacteria 51739
179 Ga0157378_10000621 3300013297 Bacteria 33432
180 Ga0157378_10000648 3300013297 Bacteria 32733
181 Ga0157378_10156735 3300013297 Bacteria 2126
182 Ga0157378_11345554 3300013297 Bacteria 756
183 Ga0163162_10079039 3300013306 Bacteria 3355
184 Ga0157372_10002757 3300013307 Bacteria 18992
185 Ga0157372_10005695 3300013307 Bacteria 13258
186 Ga0157375_10000010 3300013308 Bacteria 361011
187 Ga0157375_10025824 3300013308 Bacteria 5465
188 Ga0157375_10376554 3300013308 Bacteria 1586
189 Ga0163163_10153027 3300014325 Bacteria 2350
190 Ga0157380_10012453 3300014326 Bacteria 6171
191 Ga0157380_10026131 3300014326 Bacteria 4432
192 Ga0157380_10037471 3300014326 Bacteria 3757
193 Ga0157380_10292408 3300014326 Bacteria 1496
194 Ga0157377_10036008 3300014745 Bacteria 2719
195 Ga0157377_10304597 3300014745 Bacteria 1053
196 Ga0157377_10594542 3300014745 Bacteria 788
197 Ga0157379_10081794 3300014968 Bacteria 2893
198 Ga0157376_10256439 3300014969 Bacteria 1636
199 Ga0163161_10067755 3300017792 Bacteria 2607
200 Ga0163161_10547207 3300017792 Bacteria 948
201 Ga0213873_10051776 3300021358 Unclassified 1089
202 Ga0213872_10011469 3300021361 Unclassified 4190
203 Ga0213872_10044143 3300021361 Bacteria 2030
204 Ga0213871_10002238 3300021441 Bacteria 3521
205 Ga0213871_10016351 3300021441 Bacteria 1787
206 Ga0213871_10039214 3300021441 Unclassified 1267
207 Ga0209130_1000053 3300025284 Bacteria 214421
208 Ga0209256_1010723 3300025299 Bacteria 3786
209 Ga0207426_1000054 3300025302 Bacteria 384435
210 Ga0207697_10001639 3300025315 Bacteria 12114
211 Ga0207653_10000023 3300025885 Bacteria 118612
212 Ga0207682_10008990 3300025893 Bacteria 3947
213 Ga0207682_10019213 3300025893 Bacteria 2675
214 Ga0207642_10031738 3300025899 Bacteria 2216
215 Ga0207642_10675705 3300025899 Unclassified 649
216 Ga0207688_10004795 3300025901 Bacteria 7368
217 Ga0207688_10005805 3300025901 Bacteria 6717
218 Ga0207688_10014735 3300025901 Bacteria 4243
219 Ga0207680_10027351 3300025903 Bacteria 3174
220 Ga0207680_10066938 3300025903 Bacteria 2211
221 Ga0207699_10106830 3300025906 Bacteria 1787
222 Ga0207645_10037618 3300025907 Bacteria 3105
223 Ga0207645_10108991 3300025907 Bacteria 1791
224 Ga0207643_10001683 3300025908 Bacteria 12404
225 Ga0207643_10062752 3300025908 Bacteria 2123
226 Ga0207684_10068471 3300025910 Bacteria 3017
227 Ga0207654_10042260 3300025911 Bacteria 2578
228 Ga0207707_10030792 3300025912 Bacteria 4694
229 Ga0207707_10190148 3300025912 Bacteria 1791
230 Ga0207695_10000153 3300025913 Bacteria 206288
231 Ga0207695_10135387 3300025913 Bacteria 2417
232 Ga0207693_10012249 3300025915 Bacteria 6931
233 Ga0207663_10056825 3300025916 Bacteria 2463
234 Ga0207662_10003446 3300025918 Bacteria 8142
235 Ga0207662_10103340 3300025918 Bacteria 1768
236 Ga0207649_10014544 3300025920 Bacteria 4407
237 Ga0207649_10036209 3300025920 Bacteria 2971
238 Ga0207649_10246453 3300025920 Bacteria 1285
239 Ga0207646_10320038 3300025922 Bacteria 1402
240 Ga0207646_10332313 3300025922 Bacteria 1373
241 Ga0207681_10019413 3300025923 Bacteria 4294
242 Ga0207681_10167583 3300025923 Unclassified 1662
243 Ga0207650_10008131 3300025925 Bacteria 7149
244 Ga0207650_10085746 3300025925 Bacteria 2396
245 Ga0207650_10388583 3300025925 Bacteria 1153
246 Ga0207659_10006063 3300025926 Bacteria 7378
247 Ga0207700_10088312 3300025928 Bacteria 2441
248 Ga0207664_10002101 3300025929 Bacteria 13100
249 Ga0207644_10107687 3300025931 Bacteria 2103
250 Ga0207644_10259818 3300025931 Unclassified 1388
251 Ga0207690_10347282 3300025932 Bacteria 1172
252 Ga0207706_10009687 3300025933 Bacteria 8843
253 Ga0207706_10095014 3300025933 Bacteria 2622
254 Ga0207706_10153532 3300025933 Bacteria 2025
255 Ga0207704_10047139 3300025938 Bacteria 2574
256 Ga0207704_10428768 3300025938 Unclassified 1050
257 Ga0207691_10039070 3300025940 Bacteria 4392
258 Ga0207691_10910178 3300025940 Unclassified 736
259 Ga0207711_10626491 3300025941 Bacteria 1004
260 Ga0207711_10818656 3300025941 Bacteria 867
261 Ga0207689_10042422 3300025942 Bacteria 3764
262 Ga0207689_10059166 3300025942 Bacteria 3152
263 Ga0207689_10077279 3300025942 Bacteria 2737
264 Ga0207661_10009912 3300025944 Bacteria 6841
265 Ga0207679_10097760 3300025945 Bacteria 2287
266 Ga0207667_10027664 3300025949 Bacteria 6168
267 Ga0207667_10186258 3300025949 Bacteria 2131
268 Ga0207667_11026987 3300025949 Bacteria 811
269 Ga0207651_10291606 3300025960 Bacteria 1353
270 Ga0207651_10745940 3300025960 Bacteria 865
271 Ga0207712_10305108 3300025961 Unclassified 1308
272 Ga0207712_10465479 3300025961 Bacteria 1075
273 Ga0207712_10543335 3300025961 Unclassified 998
274 Ga0207640_10006837 3300025981 Bacteria 6270
275 Ga0207640_10050156 3300025981 Bacteria 2706
276 Ga0207658_10124806 3300025986 Bacteria 2058
277 Ga0207658_10130409 3300025986 Bacteria 2019
278 Ga0207677_10107798 3300026023 Bacteria 2067
279 Ga0207677_10330166 3300026023 Bacteria 1271
280 Ga0207677_10912867 3300026023 Unclassified 792
281 Ga0207703_10007939 3300026035 Bacteria 8388
282 Ga0207703_10055079 3300026035 Bacteria 3235
283 Ga0207703_10103630 3300026035 Bacteria 2416
284 Ga0207703_10134741 3300026035 Bacteria 2137
285 Ga0207703_10620937 3300026035 Bacteria 1023
286 Ga0207639_10000006 3300026041 Bacteria 544415
287 Ga0207639_10163341 3300026041 Bacteria 1879
288 Ga0207678_10041390 3300026067 Bacteria 3995
289 Ga0207678_10582888 3300026067 Bacteria 980
290 Ga0207708_10002308 3300026075 Bacteria 14027
291 Ga0207708_10043165 3300026075 Unclassified 3436
292 Ga0207708_10056066 3300026075 Bacteria 3005
293 Ga0207708_10331051 3300026075 Bacteria 1245
294 Ga0207702_10004232 3300026078 Bacteria 12821
295 Ga0207641_10003668 3300026088 Bacteria 13525
296 Ga0207648_10012064 3300026089 Bacteria 8104
297 Ga0207648_10151559 3300026089 Bacteria 2046
298 Ga0207676_10042974 3300026095 Bacteria 3477
299 Ga0207674_10004111 3300026116 Bacteria 17624
300 Ga0207675_100019782 3300026118 Bacteria 6284
301 Ga0207675_100142983 3300026118 Bacteria 2273
302 Ga0207683_10087059 3300026121 Bacteria 2778
303 Ga0207683_10106266 3300026121 Bacteria 2510
304 Ga0207683_10145905 3300026121 Bacteria 2134
305 Ga0207683_10732204 3300026121 Bacteria 917
306 Ga0207698_10073719 3300026142 Bacteria 2719
307 Ga0210002_1026392 3300027617 Bacteria 953
308 Ga0207428_10011427 3300027907 Bacteria 7848
309 Ga0268266_10116401 3300028379 Bacteria 2374
310 Ga0268265_10114812 3300028380 Bacteria 2206
311 Ga0268265_10187479 3300028380 Bacteria 1783
312 Ga0268264_10046622 3300028381 Bacteria 3600
313 Ga0268264_10156575 3300028381 Bacteria 2048
314 Ga0268264_10309708 3300028381 Bacteria 1489
315 Ga0265336_10003255 3300028666 Bacteria 6422
316 Ga0265338_10003361 3300028800 Bacteria 22584
317 Ga0265760_10066543 3300031090 Bacteria 1101
318 Ga0265320_10070803 3300031240 Bacteria 1644
319 Ga0265325_10145092 3300031241 Bacteria 1126
320 Ga0265329_10026789 3300031242 Bacteria 1897
321 Ga0265331_10005346 3300031250 Bacteria 7762
322 Ga0265316_10005766 3300031344 Bacteria 11959
323 Ga0265316_10017587 3300031344 Bacteria 6171
324 Ga0307513_10337123 3300031456 Bacteria 1260
325 Ga0265314_10111161 3300031711 Bacteria 1741
326 Ga0265342_10232486 3300031712 Bacteria 990
327 Ga0373939_0221890 3300035114 Bacteria 724
328 Ga0373931_0207712 3300035691 Unclassified 1173
329 Ga0373931_0229585 3300035691 Bacteria 1121
330 Ga0436360_0059810 3300039438 Bacteria 5665
331 Ga0436360_0331514 3300039438 Bacteria 4714
332 Ga0436360_1001917 3300039438 Unclassified 4892
333 Ga0436360_1017485 3300039438 Bacteria 6846
334 Ga0436361_0014707 3300039447 Bacteria 5365
335 Ga0436361_0278206 3300039447 Bacteria 7847
336 Ga0436362_0047029 3300039453 Bacteria 5581
337 Ga0436362_0914181 3300039453 Bacteria 1507
338 Ga0436362_0940395 3300039453 Bacteria 1506
339 Ga0439435_0097237 3300042436 Bacteria 901
340 Ga0466963_0663756 3300044694 Bacteria 736
341 Ga0453684_0059673 3300044712 Bacteria 4915
342 Ga0451576_0015319 3300045051 Bacteria 8497
343 Ga0451576_0033174 3300045051 Bacteria 5489
344 Ga0466967_0624245 3300045976 Bacteria 1065
345 Ga0495603_0042072 3300046455 Bacteria 2732
346 Ga0495629_0002437 3300046459 Bacteria 14277
347 Ga0495641_0249466 3300046461 Bacteria 798
348 Ga0495594_0142996 3300046499 Bacteria 1357
349 Ga0495583_0004658 3300046506 Bacteria 9674
350 Ga0495628_0396464 3300046516 Bacteria 1009
351 Ga0495645_0393936 3300046543 Bacteria 884
352 Ga0495622_0088661 3300046557 Bacteria 1422
353 Ga0495634_0090683 3300046642 Bacteria 1985
354 Ga0495625_0019551 3300046660 Bacteria 5249
355 Ga0495647_0158952 3300046681 Bacteria 973
356 Ga0495658_0113690 3300046683 Bacteria 1630
357 Ga0495600_0088126 3300046809 Bacteria 2025
358 Ga0495676_0123658 3300047321 Bacteria 1878
359 Ga0495679_012794 3300047446 Bacteria 3177
360 Ga0495614_0330718 3300048089 Bacteria 708
361 Ga0496101_0106904 3300048904 Bacteria 2102
362 Ga0496104_0085572 3300048907 Bacteria 3009
363 Ga0496104_0337212 3300048907 Bacteria 1421
364 Ga0496105_0022381 3300048908 Bacteria 5119
365 Ga0496108_0131925 3300048911 Bacteria 2147
366 Ga0496108_0284054 3300048911 Bacteria 1440
367 Ga0496109_0002574 3300048912 Bacteria 15193
368 Ga0496110_0026021 3300048913 Bacteria 5003
369 Ga0496110_0375946 3300048913 Unclassified 1295
370 Ga0496111_0005431 3300048914 Bacteria 8167
371 Ga0496112_0567900 3300048915 Bacteria 1068
372 Ga0496114_0255762 3300048917 Bacteria 1541
373 Ga0496121_0340411 3300048924 Bacteria 1003
374 Ga0501033_0000008 3300049570 Bacteria 274368
375 Ga0501038_0014160 3300049574 Bacteria 7267
376 Ga0501068_0350740 3300049584 Unclassified 948
377 Ga0501069_0063056 3300049585 Bacteria 2070
378 Ga0501070_0018902 3300049586 Bacteria 5780
379 Ga0501071_0306054 3300049587 Bacteria 1205
380 Ga0501072_0143286 3300049588 Bacteria 1906
381 Ga0501076_0295391 3300049592 Bacteria 1328
382 Ga0501080_0157507 3300049742 Bacteria 2098
383 Ga0501080_0365605 3300049742 Unclassified 1301
384 Ga0501081_0149767 3300049743 Bacteria 1676
385 Ga0501081_0235475 3300049743 Bacteria 1334
386 Ga0501083_0139456 3300049744 Bacteria 1588
387 Ga0501045_0342398 3300049824 Bacteria 1113
388 nmdc:mga05p37_265794_c1 3300050507 Unclassified 2051
389 nmdc:mga05p37_579996_c1 3300050507 Bacteria 1270
390 nmdc:mga09592_199378_c1 3300050508 Bacteria 1733
391 nmdc:mga0qj67_26336_c1 3300050509 Bacteria 4501
392 nmdc:mga06r32_224_c1 3300050510 Bacteria 45758
393 nmdc:mga08y16_423807_c1 3300050511 Bacteria 1360
394 nmdc:mga08y16_521228_c1 3300050511 Bacteria 1205
395 nmdc:mga08y16_66238_c1 3300050511 Bacteria 3770
396 nmdc:mga0n895_17292_c1 3300050512 Bacteria 6645
397 nmdc:mga0a205_9911_c1 3300050515 Bacteria 8738
398 Ga0495655_0000438 3300053083 Bacteria 7016
399 Ga0500566_0266549 3300053094 Bacteria 824
400 Ga0500556_0106869 3300053104 Bacteria 1082
401 Ga0500572_093629 3300053111 Unclassified 954
402 Ga0500608_062124 3300053122 Unclassified 1784
403 Ga0500618_000735 3300053125 Bacteria 18723
404 Ga0500590_000679 3300053148 Bacteria 12256
405 Ga0500639_176681 3300053163 Bacteria 950
406 Ga0500636_0222237 3300053177 Bacteria 983
407 Ga0501082_0057343 3300060353 Bacteria 3356

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2582581867 2585403181 194
2 iso_pu_bacteria 2852387548 2852393923 194
3 iso_pu_bacteria 8024486573 8024487078 194
4 3300006880 Ga0075429_100060299 Ga0075429_1000602995 197
5 3300014326 Ga0157380_10292408 Ga0157380_102924082 197
6 3300025940 Ga0207691_10910178 Ga0207691_109101781 197
7 3300026067 Ga0207678_10582888 Ga0207678_105828882 197
8 3300026075 Ga0207708_10056066 Ga0207708_100560664 197
9 3300050507 nmdc:mga05p37_579996_c1 nmdc:mga05p37_579996_c1_529_1122 197
10 2162886012 MBSR1b_contig_3150975 MBSR1b_0640.00005580 198
11 3300001977 JGI24746J21847_1007673 JGI24746J21847_10076732 198
12 3300001991 JGI24743J22301_10005397 JGI24743J22301_100053972 198
13 3300002987 JGI25159J45721_1000167 JGI25159J45721_10001678 198
14 3300003354 JGI25160J50197_1000288 JGI25160J50197_100028823 198
15 3300003374 JGI25161J50226_1000215 JGI25161J50226_100021516 198
16 3300004625 Ga0055543_1000006 Ga0055543_1000006192 198
17 3300005262 Ga0065165_1000215 Ga0065165_100021517 198
18 3300005290 Ga0065712_10079435 Ga0065712_100794352 198
19 3300005290 Ga0065712_10136696 Ga0065712_101366963 198
20 3300005293 Ga0065715_10142656 Ga0065715_101426561 198
21 3300005293 Ga0065715_10228239 Ga0065715_102282392 198
22 3300005328 Ga0070676_10036088 Ga0070676_100360882 198
23 3300005328 Ga0070676_10305592 Ga0070676_103055922 198
24 3300005329 Ga0070683_100007518 Ga0070683_1000075188 198
25 3300005330 Ga0070690_100006139 Ga0070690_1000061395 198
26 3300005331 Ga0070670_100010889 Ga0070670_1000108895 198
27 3300005331 Ga0070670_100013239 Ga0070670_1000132396 198
28 3300005331 Ga0070670_100238749 Ga0070670_1002387492 198
29 3300005333 Ga0070677_10005763 Ga0070677_100057633 198
30 3300005333 Ga0070677_10010892 Ga0070677_100108924 198
31 3300005335 Ga0070666_10015255 Ga0070666_100152555 198
32 3300005335 Ga0070666_10021867 Ga0070666_100218674 198
33 3300005335 Ga0070666_10057181 Ga0070666_100571813 198
34 3300005336 Ga0070680_100358048 Ga0070680_1003580481 198
35 3300005337 Ga0070682_100150951 Ga0070682_1001509512 198
36 3300005337 Ga0070682_100531214 Ga0070682_1005312142 198
37 3300005338 Ga0068868_100003793 Ga0068868_1000037932 198
38 3300005338 Ga0068868_100075866 Ga0068868_1000758662 198
39 3300005338 Ga0068868_100129315 Ga0068868_1001293152 198
40 3300005339 Ga0070660_100126376 Ga0070660_1001263762 198
41 3300005340 Ga0070689_100000455 Ga0070689_10000045518 198
42 3300005340 Ga0070689_100035029 Ga0070689_1000350294 198
43 3300005340 Ga0070689_100646812 Ga0070689_1006468122 198
44 3300005343 Ga0070687_100021009 Ga0070687_1000210092 198
45 3300005343 Ga0070687_100081645 Ga0070687_1000816452 198
46 3300005343 Ga0070687_100361702 Ga0070687_1003617022 198
47 3300005344 Ga0070661_100009861 Ga0070661_1000098612 198
48 3300005344 Ga0070661_100032261 Ga0070661_1000322613 198
49 3300005344 Ga0070661_100100511 Ga0070661_1001005113 198
50 3300005345 Ga0070692_10285935 Ga0070692_102859352 198
51 3300005345 Ga0070692_10516177 Ga0070692_105161771 198
52 3300005347 Ga0070668_100249021 Ga0070668_1002490212 198
53 3300005347 Ga0070668_100580326 Ga0070668_1005803261 198
54 3300005353 Ga0070669_100006869 Ga0070669_1000068692 198
55 3300005353 Ga0070669_100827394 Ga0070669_1008273941 198
56 3300005354 Ga0070675_100448494 Ga0070675_1004484941 198
57 3300005355 Ga0070671_100022544 Ga0070671_1000225445 198
58 3300005355 Ga0070671_100037938 Ga0070671_1000379382 198
59 3300005355 Ga0070671_100052321 Ga0070671_1000523214 198
60 3300005355 Ga0070671_100293287 Ga0070671_1002932872 198
61 3300005364 Ga0070673_100007703 Ga0070673_1000077036 198
62 3300005364 Ga0070673_100527808 Ga0070673_1005278081 198
63 3300005365 Ga0070688_100013282 Ga0070688_1000132824 198
64 3300005367 Ga0070667_100141363 Ga0070667_1001413633 198
65 3300005367 Ga0070667_100228515 Ga0070667_1002285152 198
66 3300005406 Ga0070703_10000274 Ga0070703_1000027416 198
67 3300005434 Ga0070709_10263141 Ga0070709_102631412 198
68 3300005435 Ga0070714_100000912 Ga0070714_1000009128 198
69 3300005438 Ga0070701_10004148 Ga0070701_100041484 198
70 3300005438 Ga0070701_10286502 Ga0070701_102865021 198
71 3300005441 Ga0070700_100008331 Ga0070700_1000083313 198
72 3300005441 Ga0070700_100026964 Ga0070700_1000269642 198
73 3300005441 Ga0070700_100656379 Ga0070700_1006563791 198
74 3300005444 Ga0070694_100719141 Ga0070694_1007191412 198
75 3300005455 Ga0070663_100006399 Ga0070663_1000063996 198
76 3300005455 Ga0070663_100616597 Ga0070663_1006165971 198
77 3300005456 Ga0070678_100063454 Ga0070678_1000634543 198
78 3300005456 Ga0070678_100113039 Ga0070678_1001130393 198
79 3300005456 Ga0070678_100574997 Ga0070678_1005749972 198
80 3300005456 Ga0070678_100748144 Ga0070678_1007481442 198
81 3300005457 Ga0070662_100021163 Ga0070662_1000211634 198
82 3300005458 Ga0070681_10050282 Ga0070681_100502823 198
83 3300005458 Ga0070681_10231759 Ga0070681_102317592 198
84 3300005459 Ga0068867_100013241 Ga0068867_1000132413 198
85 3300005459 Ga0068867_100142545 Ga0068867_1001425453 198
86 3300005459 Ga0068867_100393457 Ga0068867_1003934572 198
87 3300005467 Ga0070706_100089894 Ga0070706_1000898943 198
88 3300005468 Ga0070707_100368774 Ga0070707_1003687742 198
89 3300005471 Ga0070698_100051033 Ga0070698_1000510334 198
90 3300005471 Ga0070698_100069387 Ga0070698_1000693874 198
91 3300005471 Ga0070698_100180874 Ga0070698_1001808742 198
92 3300005518 Ga0070699_100193761 Ga0070699_1001937613 198
93 3300005535 Ga0070684_100001324 Ga0070684_10000132412 198
94 3300005539 Ga0068853_100076897 Ga0068853_1000768971 198
95 3300005539 Ga0068853_100200646 Ga0068853_1002006462 198
96 3300005543 Ga0070672_100068120 Ga0070672_1000681202 198
97 3300005544 Ga0070686_100191071 Ga0070686_1001910712 198
98 3300005544 Ga0070686_100586849 Ga0070686_1005868492 198
99 3300005546 Ga0070696_100081615 Ga0070696_1000816152 198
100 3300005547 Ga0070693_100013862 Ga0070693_1000138622 198
101 3300005547 Ga0070693_100525429 Ga0070693_1005254292 198
102 3300005548 Ga0070665_100218901 Ga0070665_1002189013 198
103 3300005549 Ga0070704_101109695 Ga0070704_1011096951 198
104 3300005563 Ga0068855_100345152 Ga0068855_1003451522 198
105 3300005564 Ga0070664_100000841 Ga0070664_10000084111 198
106 3300005564 Ga0070664_100001423 Ga0070664_10000142312 198
107 3300005564 Ga0070664_100580695 Ga0070664_1005806952 198
108 3300005577 Ga0068857_100001955 Ga0068857_1000019557 198
109 3300005577 Ga0068857_100028809 Ga0068857_1000288094 198
110 3300005578 Ga0068854_100011953 Ga0068854_1000119536 198
111 3300005578 Ga0068854_100025076 Ga0068854_1000250763 198
112 3300005578 Ga0068854_100938782 Ga0068854_1009387821 198
113 3300005614 Ga0068856_100155178 Ga0068856_1001551783 198
114 3300005614 Ga0068856_100211652 Ga0068856_1002116522 198
115 3300005615 Ga0070702_100052390 Ga0070702_1000523903 198
116 3300005615 Ga0070702_100090211 Ga0070702_1000902111 198
117 3300005616 Ga0068852_100024229 Ga0068852_1000242293 198
118 3300005616 Ga0068852_100025890 Ga0068852_1000258903 198
119 3300005617 Ga0068859_100003129 Ga0068859_10000312912 198
120 3300005617 Ga0068859_100011695 Ga0068859_1000116955 198
121 3300005617 Ga0068859_100282818 Ga0068859_1002828183 198
122 3300005618 Ga0068864_100023166 Ga0068864_1000231664 198
123 3300005718 Ga0068866_10013907 Ga0068866_100139073 198
124 3300005719 Ga0068861_100061602 Ga0068861_1000616023 198
125 3300005840 Ga0068870_10012503 Ga0068870_100125034 198
126 3300005840 Ga0068870_10214974 Ga0068870_102149741 198
127 3300005841 Ga0068863_100030581 Ga0068863_1000305813 198
128 3300005842 Ga0068858_100002579 Ga0068858_1000025797 198
129 3300005842 Ga0068858_100114049 Ga0068858_1001140492 198
130 3300005842 Ga0068858_100129273 Ga0068858_1001292733 198
131 3300005842 Ga0068858_100144785 Ga0068858_1001447852 198
132 3300005842 Ga0068858_100216304 Ga0068858_1002163042 198
133 3300005842 Ga0068858_100225391 Ga0068858_1002253913 198
134 3300005843 Ga0068860_100025812 Ga0068860_1000258123 198
135 3300005843 Ga0068860_100040445 Ga0068860_1000404455 198
136 3300005844 Ga0068862_100025500 Ga0068862_1000255004 198
137 3300005844 Ga0068862_100082649 Ga0068862_1000826492 198
138 3300005844 Ga0068862_100133740 Ga0068862_1001337403 198
139 3300006028 Ga0070717_10026903 Ga0070717_100269033 198
140 3300006028 Ga0070717_10130843 Ga0070717_101308432 198
141 3300006058 Ga0075432_10105500 Ga0075432_101055001 198
142 3300006175 Ga0070712_100006531 Ga0070712_10000653110 198
143 3300006237 Ga0097621_100028451 Ga0097621_1000284514 198
144 3300006237 Ga0097621_100260972 Ga0097621_1002609722 198
145 3300006358 Ga0068871_100109527 Ga0068871_1001095273 198
146 3300006844 Ga0075428_100004174 Ga0075428_1000041749 198
147 3300006844 Ga0075428_100249197 Ga0075428_1002491972 198
148 3300006846 Ga0075430_100075061 Ga0075430_1000750615 198
149 3300006847 Ga0075431_100000173 Ga0075431_10000017324 198
150 3300006852 Ga0075433_10046552 Ga0075433_100465523 198
151 3300006852 Ga0075433_10201881 Ga0075433_102018812 198
152 3300006871 Ga0075434_100670857 Ga0075434_1006708572 198
153 3300006880 Ga0075429_100057416 Ga0075429_1000574162 198
154 3300006881 Ga0068865_100099730 Ga0068865_1000997303 198
155 3300006881 Ga0068865_100556975 Ga0068865_1005569751 198
156 3300006931 Ga0097620_100003129 Ga0097620_10000312912 198
157 3300006931 Ga0097620_100011695 Ga0097620_1000116955 198
158 3300006931 Ga0097620_100282841 Ga0097620_1002828413 198
159 3300007076 Ga0075435_100460135 Ga0075435_1004601352 198
160 3300007788 Ga0099795_10121632 Ga0099795_101216322 198
161 3300009093 Ga0105240_10055902 Ga0105240_100559023 198
162 3300009093 Ga0105240_10215286 Ga0105240_102152861 198
163 3300009093 Ga0105240_11813178 Ga0105240_118131781 198
164 3300009094 Ga0111539_10008939 Ga0111539_100089396 198
165 3300009094 Ga0111539_10316853 Ga0111539_103168532 198
166 3300009094 Ga0111539_10627567 Ga0111539_106275672 198
167 3300009098 Ga0105245_10112071 Ga0105245_101120712 198
168 3300009098 Ga0105245_10254971 Ga0105245_102549712 198
169 3300009147 Ga0114129_10303057 Ga0114129_103030572 198
170 3300009174 Ga0105241_10066757 Ga0105241_100667573 198
171 3300009174 Ga0105241_10181428 Ga0105241_101814282 198
172 3300009176 Ga0105242_10232273 Ga0105242_102322732 198
173 3300009176 Ga0105242_10704477 Ga0105242_107044771 198
174 3300009177 Ga0105248_10041089 Ga0105248_100410892 198
175 3300009177 Ga0105248_10200541 Ga0105248_102005413 198
176 3300009177 Ga0105248_10702973 Ga0105248_107029732 198
177 3300009553 Ga0105249_10007432 Ga0105249_100074328 198
178 3300009553 Ga0105249_10586733 Ga0105249_105867332 198
179 3300010159 Ga0099796_10099037 Ga0099796_100990372 198
180 3300010159 Ga0099796_10195155 Ga0099796_101951551 198
181 3300010375 Ga0105239_10381334 Ga0105239_103813341 198
182 3300013102 Ga0157371_10056301 Ga0157371_100563013 198
183 3300013104 Ga0157370_10131265 Ga0157370_101312653 198
184 3300013105 Ga0157369_10027692 Ga0157369_100276927 198
185 3300013296 Ga0157374_10002418 Ga0157374_100024187 198
186 3300013297 Ga0157378_10000261 Ga0157378_1000026147 198
187 3300013297 Ga0157378_10000621 Ga0157378_1000062119 198
188 3300013297 Ga0157378_10000648 Ga0157378_1000064830 198
189 3300013297 Ga0157378_10156735 Ga0157378_101567352 198
190 3300013297 Ga0157378_11345554 Ga0157378_113455541 198
191 3300013306 Ga0163162_10079039 Ga0163162_100790393 198
192 3300013307 Ga0157372_10002757 Ga0157372_1000275710 198
193 3300013307 Ga0157372_10005695 Ga0157372_1000569512 198
194 3300013308 Ga0157375_10000010 Ga0157375_10000010275 198
195 3300013308 Ga0157375_10025824 Ga0157375_100258242 198
196 3300013308 Ga0157375_10376554 Ga0157375_103765543 198
197 3300014325 Ga0163163_10153027 Ga0163163_101530272 198
198 3300014326 Ga0157380_10012453 Ga0157380_100124534 198
199 3300014326 Ga0157380_10026131 Ga0157380_100261313 198
200 3300014326 Ga0157380_10037471 Ga0157380_100374714 198
201 3300014745 Ga0157377_10036008 Ga0157377_100360083 198
202 3300014745 Ga0157377_10304597 Ga0157377_103045971 198
203 3300014745 Ga0157377_10594542 Ga0157377_105945422 198
204 3300014968 Ga0157379_10081794 Ga0157379_100817942 198
205 3300014969 Ga0157376_10256439 Ga0157376_102564392 198
206 3300017792 Ga0163161_10067755 Ga0163161_100677553 198
207 3300017792 Ga0163161_10547207 Ga0163161_105472072 198
208 3300021358 Ga0213873_10051776 Ga0213873_100517761 198
209 3300021361 Ga0213872_10011469 Ga0213872_100114695 198
210 3300021361 Ga0213872_10044143 Ga0213872_100441434 198
211 3300021441 Ga0213871_10002238 Ga0213871_100022384 198
212 3300021441 Ga0213871_10016351 Ga0213871_100163512 198
213 3300021441 Ga0213871_10039214 Ga0213871_100392142 198
214 3300025284 Ga0209130_1000053 Ga0209130_1000053180 198
215 3300025299 Ga0209256_1010723 Ga0209256_10107234 198
216 3300025302 Ga0207426_1000054 Ga0207426_1000054348 198
217 3300025315 Ga0207697_10001639 Ga0207697_100016395 198
218 3300025885 Ga0207653_10000023 Ga0207653_1000002319 198
219 3300025893 Ga0207682_10008990 Ga0207682_100089903 198
220 3300025893 Ga0207682_10019213 Ga0207682_100192134 198
221 3300025899 Ga0207642_10031738 Ga0207642_100317381 198
222 3300025899 Ga0207642_10675705 Ga0207642_106757051 198
223 3300025901 Ga0207688_10004795 Ga0207688_100047954 198
224 3300025901 Ga0207688_10005805 Ga0207688_100058055 198
225 3300025901 Ga0207688_10014735 Ga0207688_100147353 198
226 3300025903 Ga0207680_10027351 Ga0207680_100273512 198
227 3300025903 Ga0207680_10066938 Ga0207680_100669382 198
228 3300025906 Ga0207699_10106830 Ga0207699_101068302 198
229 3300025907 Ga0207645_10037618 Ga0207645_100376183 198
230 3300025907 Ga0207645_10108991 Ga0207645_101089913 198
231 3300025908 Ga0207643_10001683 Ga0207643_1000168314 198
232 3300025908 Ga0207643_10062752 Ga0207643_100627523 198
233 3300025910 Ga0207684_10068471 Ga0207684_100684713 198
234 3300025911 Ga0207654_10042260 Ga0207654_100422602 198
235 3300025912 Ga0207707_10030792 Ga0207707_100307923 198
236 3300025912 Ga0207707_10190148 Ga0207707_101901482 198
237 3300025913 Ga0207695_10000153 Ga0207695_10000153192 198
238 3300025913 Ga0207695_10135387 Ga0207695_101353872 198
239 3300025915 Ga0207693_10012249 Ga0207693_100122498 198
240 3300025916 Ga0207663_10056825 Ga0207663_100568253 198
241 3300025918 Ga0207662_10003446 Ga0207662_100034464 198
242 3300025918 Ga0207662_10103340 Ga0207662_101033402 198
243 3300025920 Ga0207649_10014544 Ga0207649_100145443 198
244 3300025920 Ga0207649_10036209 Ga0207649_100362093 198
245 3300025920 Ga0207649_10246453 Ga0207649_102464532 198
246 3300025922 Ga0207646_10320038 Ga0207646_103200382 198
247 3300025922 Ga0207646_10332313 Ga0207646_103323132 198
248 3300025923 Ga0207681_10019413 Ga0207681_100194132 198
249 3300025923 Ga0207681_10167583 Ga0207681_101675832 198
250 3300025925 Ga0207650_10008131 Ga0207650_100081312 198
251 3300025925 Ga0207650_10085746 Ga0207650_100857463 198
252 3300025925 Ga0207650_10388583 Ga0207650_103885832 198
253 3300025926 Ga0207659_10006063 Ga0207659_100060636 198
254 3300025928 Ga0207700_10088312 Ga0207700_100883121 198
255 3300025929 Ga0207664_10002101 Ga0207664_100021014 198
256 3300025931 Ga0207644_10107687 Ga0207644_101076873 198
257 3300025931 Ga0207644_10259818 Ga0207644_102598182 198
258 3300025932 Ga0207690_10347282 Ga0207690_103472822 198
259 3300025933 Ga0207706_10009687 Ga0207706_100096873 198
260 3300025933 Ga0207706_10095014 Ga0207706_100950143 198
261 3300025933 Ga0207706_10153532 Ga0207706_101535322 198
262 3300025938 Ga0207704_10047139 Ga0207704_100471393 198
263 3300025938 Ga0207704_10428768 Ga0207704_104287682 198
264 3300025940 Ga0207691_10039070 Ga0207691_100390703 198
265 3300025941 Ga0207711_10626491 Ga0207711_106264911 198
266 3300025941 Ga0207711_10818656 Ga0207711_108186561 198
267 3300025942 Ga0207689_10042422 Ga0207689_100424222 198
268 3300025942 Ga0207689_10059166 Ga0207689_100591663 198
269 3300025942 Ga0207689_10077279 Ga0207689_100772792 198
270 3300025944 Ga0207661_10009912 Ga0207661_100099128 198
271 3300025945 Ga0207679_10097760 Ga0207679_100977603 198
272 3300025949 Ga0207667_10027664 Ga0207667_100276643 198
273 3300025949 Ga0207667_10186258 Ga0207667_101862582 198
274 3300025949 Ga0207667_11026987 Ga0207667_110269872 198
275 3300025960 Ga0207651_10291606 Ga0207651_102916062 198
276 3300025960 Ga0207651_10745940 Ga0207651_107459402 198
277 3300025961 Ga0207712_10305108 Ga0207712_103051082 198
278 3300025961 Ga0207712_10465479 Ga0207712_104654792 198
279 3300025961 Ga0207712_10543335 Ga0207712_105433351 198
280 3300025981 Ga0207640_10006837 Ga0207640_100068373 198
281 3300025981 Ga0207640_10050156 Ga0207640_100501563 198
282 3300025986 Ga0207658_10124806 Ga0207658_101248062 198
283 3300025986 Ga0207658_10130409 Ga0207658_101304092 198
284 3300026023 Ga0207677_10107798 Ga0207677_101077982 198
285 3300026023 Ga0207677_10330166 Ga0207677_103301662 198
286 3300026023 Ga0207677_10912867 Ga0207677_109128671 198
287 3300026035 Ga0207703_10007939 Ga0207703_100079393 198
288 3300026035 Ga0207703_10055079 Ga0207703_100550793 198
289 3300026035 Ga0207703_10103630 Ga0207703_101036302 198
290 3300026035 Ga0207703_10134741 Ga0207703_101347413 198
291 3300026035 Ga0207703_10620937 Ga0207703_106209372 198
292 3300026041 Ga0207639_10000006 Ga0207639_10000006330 198
293 3300026041 Ga0207639_10163341 Ga0207639_101633412 198
294 3300026067 Ga0207678_10041390 Ga0207678_100413905 198
295 3300026075 Ga0207708_10002308 Ga0207708_100023089 198
296 3300026075 Ga0207708_10043165 Ga0207708_100431652 198
297 3300026075 Ga0207708_10331051 Ga0207708_103310512 198
298 3300026078 Ga0207702_10004232 Ga0207702_100042326 198
299 3300026088 Ga0207641_10003668 Ga0207641_100036685 198
300 3300026089 Ga0207648_10012064 Ga0207648_100120643 198
301 3300026089 Ga0207648_10151559 Ga0207648_101515593 198
302 3300026095 Ga0207676_10042974 Ga0207676_100429744 198
303 3300026116 Ga0207674_10004111 Ga0207674_100041116 198
304 3300026118 Ga0207675_100019782 Ga0207675_1000197825 198
305 3300026118 Ga0207675_100142983 Ga0207675_1001429832 198
306 3300026121 Ga0207683_10087059 Ga0207683_100870593 198
307 3300026121 Ga0207683_10106266 Ga0207683_101062663 198
308 3300026121 Ga0207683_10145905 Ga0207683_101459053 198
309 3300026121 Ga0207683_10732204 Ga0207683_107322042 198
310 3300026142 Ga0207698_10073719 Ga0207698_100737193 198
311 3300027617 Ga0210002_1026392 Ga0210002_10263922 198
312 3300027907 Ga0207428_10011427 Ga0207428_100114278 198
313 3300028379 Ga0268266_10116401 Ga0268266_101164012 198
314 3300028380 Ga0268265_10114812 Ga0268265_101148122 198
315 3300028380 Ga0268265_10187479 Ga0268265_101874792 198
316 3300028381 Ga0268264_10046622 Ga0268264_100466224 198
317 3300028381 Ga0268264_10156575 Ga0268264_101565753 198
318 3300028381 Ga0268264_10309708 Ga0268264_103097083 198
319 3300028666 Ga0265336_10003255 Ga0265336_100032552 198
320 3300028800 Ga0265338_10003361 Ga0265338_1000336118 198
321 3300031090 Ga0265760_10066543 Ga0265760_100665431 198
322 3300031240 Ga0265320_10070803 Ga0265320_100708033 198
323 3300031241 Ga0265325_10145092 Ga0265325_101450922 198
324 3300031242 Ga0265329_10026789 Ga0265329_100267892 198
325 3300031250 Ga0265331_10005346 Ga0265331_100053465 198
326 3300031344 Ga0265316_10005766 Ga0265316_1000576611 198
327 3300031344 Ga0265316_10017587 Ga0265316_100175874 198
328 3300031456 Ga0307513_10337123 Ga0307513_103371232 198
329 3300031711 Ga0265314_10111161 Ga0265314_101111612 198
330 3300031712 Ga0265342_10232486 Ga0265342_102324862 198
331 3300035114 Ga0373939_0221890 Ga0373939_0221890_50_646 198
332 3300035691 Ga0373931_0207712 Ga0373931_0207712_527_1147 198
333 3300035691 Ga0373931_0229585 Ga0373931_0229585_253_849 198
334 3300039438 Ga0436360_0059810 Ga0436360_0059810_1584_2180 198
335 3300039438 Ga0436360_0331514 Ga0436360_0331514_1530_2132 198
336 3300039438 Ga0436360_1001917 Ga0436360_1001917_1754_2398 198
337 3300039438 Ga0436360_1017485 Ga0436360_1017485_2417_3016 198
338 3300039447 Ga0436361_0014707 Ga0436361_0014707_3161_3760 198
339 3300039447 Ga0436361_0278206 Ga0436361_0278206_5218_5862 198
340 3300039453 Ga0436362_0047029 Ga0436362_0047029_4524_5120 198
341 3300039453 Ga0436362_0914181 Ga0436362_0914181_641_1297 198
342 3300039453 Ga0436362_0940395 Ga0436362_0940395_684_1328 198
343 3300042436 Ga0439435_0097237 Ga0439435_0097237_98_694 198
344 3300044694 Ga0466963_0663756 Ga0466963_0663756_46_642 198
345 3300044712 Ga0453684_0059673 Ga0453684_0059673_4083_4682 198
346 3300045051 Ga0451576_0015319 Ga0451576_0015319_6160_6756 198
347 3300045051 Ga0451576_0033174 Ga0451576_0033174_4630_5226 198
348 3300045976 Ga0466967_0624245 Ga0466967_0624245_378_986 198
349 3300046455 Ga0495603_0042072 Ga0495603_0042072_246_845 198
350 3300046459 Ga0495629_0002437 Ga0495629_0002437_9376_9975 198
351 3300046461 Ga0495641_0249466 Ga0495641_0249466_117_713 198
352 3300046499 Ga0495594_0142996 Ga0495594_0142996_26_625 198
353 3300046506 Ga0495583_0004658 Ga0495583_0004658_7504_8103 198
354 3300046516 Ga0495628_0396464 Ga0495628_0396464_104_703 198
355 3300046543 Ga0495645_0393936 Ga0495645_0393936_11_610 198
356 3300046557 Ga0495622_0088661 Ga0495622_0088661_665_1264 198
357 3300046642 Ga0495634_0090683 Ga0495634_0090683_1233_1829 198
358 3300046660 Ga0495625_0019551 Ga0495625_0019551_328_927 198
359 3300046681 Ga0495647_0158952 Ga0495647_0158952_197_796 198
360 3300046683 Ga0495658_0113690 Ga0495658_0113690_23_619 198
361 3300046809 Ga0495600_0088126 Ga0495600_0088126_426_1025 198
362 3300047321 Ga0495676_0123658 Ga0495676_0123658_694_1293 198
363 3300047446 Ga0495679_012794 Ga0495679_012794_645_1253 198
364 3300048089 Ga0495614_0330718 Ga0495614_0330718_67_663 198
365 3300048904 Ga0496101_0106904 Ga0496101_0106904_1154_1750 198
366 3300048907 Ga0496104_0085572 Ga0496104_0085572_241_837 198
367 3300048907 Ga0496104_0337212 Ga0496104_0337212_95_691 198
368 3300048908 Ga0496105_0022381 Ga0496105_0022381_1736_2332 198
369 3300048911 Ga0496108_0131925 Ga0496108_0131925_1226_1822 198
370 3300048911 Ga0496108_0284054 Ga0496108_0284054_181_777 198
371 3300048912 Ga0496109_0002574 Ga0496109_0002574_5929_6525 198
372 3300048913 Ga0496110_0026021 Ga0496110_0026021_2184_2780 198
373 3300048913 Ga0496110_0375946 Ga0496110_0375946_156_752 198
374 3300048914 Ga0496111_0005431 Ga0496111_0005431_4778_5374 198
375 3300048915 Ga0496112_0567900 Ga0496112_0567900_127_723 198
376 3300048917 Ga0496114_0255762 Ga0496114_0255762_743_1339 198
377 3300048924 Ga0496121_0340411 Ga0496121_0340411_373_972 198
378 3300049570 Ga0501033_0000008 Ga0501033_0000008_252514_253110 198
379 3300049574 Ga0501038_0014160 Ga0501038_0014160_5840_6436 198
380 3300049584 Ga0501068_0350740 Ga0501068_0350740_96_692 198
381 3300049585 Ga0501069_0063056 Ga0501069_0063056_1257_1856 198
382 3300049586 Ga0501070_0018902 Ga0501070_0018902_3746_4345 198
383 3300049587 Ga0501071_0306054 Ga0501071_0306054_84_683 198
384 3300049588 Ga0501072_0143286 Ga0501072_0143286_186_785 198
385 3300049592 Ga0501076_0295391 Ga0501076_0295391_101_697 198
386 3300049742 Ga0501080_0157507 Ga0501080_0157507_353_952 198
387 3300049742 Ga0501080_0365605 Ga0501080_0365605_32_628 198
388 3300049743 Ga0501081_0149767 Ga0501081_0149767_582_1181 198
389 3300049743 Ga0501081_0235475 Ga0501081_0235475_609_1205 198
390 3300049744 Ga0501083_0139456 Ga0501083_0139456_348_962 198
391 3300049824 Ga0501045_0342398 Ga0501045_0342398_111_707 198
392 3300050507 nmdc:mga05p37_265794_c1 nmdc:mga05p37_265794_c1_259_855 198
393 3300050508 nmdc:mga09592_199378_c1 nmdc:mga09592_199378_c1_729_1325 198
394 3300050509 nmdc:mga0qj67_26336_c1 nmdc:mga0qj67_26336_c1_308_928 198
395 3300050510 nmdc:mga06r32_224_c1 nmdc:mga06r32_224_c1_18005_18625 198
396 3300050511 nmdc:mga08y16_423807_c1 nmdc:mga08y16_423807_c1_409_1005 198
397 3300050511 nmdc:mga08y16_521228_c1 nmdc:mga08y16_521228_c1_376_972 198
398 3300050511 nmdc:mga08y16_66238_c1 nmdc:mga08y16_66238_c1_1595_2191 198
399 3300050512 nmdc:mga0n895_17292_c1 nmdc:mga0n895_17292_c1_4328_4924 198
400 3300050515 nmdc:mga0a205_9911_c1 nmdc:mga0a205_9911_c1_14_610 198
401 3300053083 Ga0495655_0000438 Ga0495655_0000438_1056_1655 198
402 3300053094 Ga0500566_0266549 Ga0500566_0266549_215_814 198
403 3300053104 Ga0500556_0106869 Ga0500556_0106869_437_1033 198
404 3300053111 Ga0500572_093629 Ga0500572_093629_74_673 198
405 3300053122 Ga0500608_062124 Ga0500608_062124_885_1484 198
406 3300053125 Ga0500618_000735 Ga0500618_000735_1790_2389 198
407 3300053148 Ga0500590_000679 Ga0500590_000679_6290_6889 198
408 3300053163 Ga0500639_176681 Ga0500639_176681_149_748 198
409 3300053177 Ga0500636_0222237 Ga0500636_0222237_52_651 198
410 3300060353 Ga0501082_0057343 Ga0501082_0057343_1330_1929 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13580

SIS_2

SIS domain

44

180

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x94-assembly1.cif.gz_A crystal structure of a hypothetical protein 0.851 4 183
3bjz-assembly1.cif.gz_D crystal structure of pseudomonas aeruginosa phosphoheptose isomerase 0.8465 4 183
3bjz-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa phosphoheptose isomerase 0.8438 4 183
5i01-assembly1.cif.gz_C structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae 0.8414 4 183
2i2w-assembly3.cif.gz_B crystal structure of escherichia coli phosphoheptose isomerase 0.8382 4 183
ID Description Score Start End Superfamily
5i01C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8414 4 183 3.40.50.10490
2i2wB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8382 4 183 3.40.50.10490
af_P0ACS7_105_289_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8302 8 183 3.40.50.10490
5vhuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8221 4 183 3.40.50.10490
3trjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8099 3 183 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A212KGQ9-F1-model_v4 Sugar isomerase family protein 0.9825 87 196 GO:0016853
GO:0097367
GO:1901135
AF-A0A7V8T0J9-F1-model_v4 Sugar isomerase 0.9692 88 194 GO:0016853
GO:0097367
GO:1901135
AF-A0A2V5XBY7-F1-model_v4 Sugar isomerase 0.9662 98 196 GO:0016853
GO:0097367
GO:1901135
AF-A0A2V6RC29-F1-model_v4 Sugar isomerase 0.9609 104 196 GO:0016853
GO:0097367
GO:1901135
AF-A0A7V8T0J9-F1-model_v4 Sugar isomerase 0.9604 88 194 GO:0016853
GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
90.88 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map