F437185
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 410 | 249 | 407 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100051033|Ga0070698_1000510334 |
| Length | 236 |
| Sequence | LNLYLGSGERQVKVAGVAVEKTDRFVFNPDKRGLMGTLMTFSERYLQEVHKIINLIDVDPIERMATILARLRGTDGRLFFLGVGGGAGNCGHAVNDFRKIAGIEAYAPTDNVSELTARTNDEGWETVFVEWLKVSRLTPNDALFIFSVGGGSLEKNVSPNLVRALQYAKEVGASVLGVVGRDGGYTSKVGDAIVIVPTVNPEAVTPHTEAFQAVIWHLLVTHPLLKARQTKWEATP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 3 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 113 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 114 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 115 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 187 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 212 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 241 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 242 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 243 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 244 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 246 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 247 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 248 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.02 |
| Metatranscriptomes | 0.24 |
| Isolates | 0.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.9 |
| Nodule | 0.24 |
| Rhizoplane | 2.93 |
| Rhizosphere | 92.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_3150975 | 2162886012 | Bacteria | 3062 |
| 2 | JGI24746J21847_1007673 | 3300001977 | Bacteria | 1643 |
| 3 | JGI24743J22301_10005397 | 3300001991 | Bacteria | 2132 |
| 4 | JGI25159J45721_1000167 | 3300002987 | Bacteria | 30455 |
| 5 | JGI25160J50197_1000288 | 3300003354 | Bacteria | 36505 |
| 6 | JGI25161J50226_1000215 | 3300003374 | Bacteria | 36505 |
| 7 | Ga0055543_1000006 | 3300004625 | Bacteria | 214206 |
| 8 | Ga0065165_1000215 | 3300005262 | Bacteria | 100238 |
| 9 | Ga0065712_10079435 | 3300005290 | Bacteria | 3218 |
| 10 | Ga0065712_10136696 | 3300005290 | Bacteria | 1490 |
| 11 | Ga0065715_10142656 | 3300005293 | Bacteria | 1831 |
| 12 | Ga0065715_10228239 | 3300005293 | Bacteria | 1244 |
| 13 | Ga0070676_10036088 | 3300005328 | Bacteria | 2846 |
| 14 | Ga0070676_10305592 | 3300005328 | Bacteria | 1080 |
| 15 | Ga0070683_100007518 | 3300005329 | Bacteria | 9210 |
| 16 | Ga0070690_100006139 | 3300005330 | Bacteria | 6802 |
| 17 | Ga0070670_100010889 | 3300005331 | Bacteria | 7769 |
| 18 | Ga0070670_100013239 | 3300005331 | Bacteria | 7067 |
| 19 | Ga0070670_100238749 | 3300005331 | Bacteria | 1582 |
| 20 | Ga0070677_10005763 | 3300005333 | Bacteria | 4096 |
| 21 | Ga0070677_10010892 | 3300005333 | Bacteria | 3121 |
| 22 | Ga0070666_10015255 | 3300005335 | Bacteria | 4900 |
| 23 | Ga0070666_10021867 | 3300005335 | Bacteria | 4148 |
| 24 | Ga0070666_10057181 | 3300005335 | Bacteria | 2635 |
| 25 | Ga0070680_100358048 | 3300005336 | Unclassified | 1241 |
| 26 | Ga0070682_100150951 | 3300005337 | Bacteria | 1594 |
| 27 | Ga0070682_100531214 | 3300005337 | Unclassified | 917 |
| 28 | Ga0068868_100003793 | 3300005338 | Bacteria | 10547 |
| 29 | Ga0068868_100075866 | 3300005338 | Bacteria | 2687 |
| 30 | Ga0068868_100129315 | 3300005338 | Bacteria | 2065 |
| 31 | Ga0070660_100126376 | 3300005339 | Bacteria | 2043 |
| 32 | Ga0070689_100000455 | 3300005340 | Bacteria | 24194 |
| 33 | Ga0070689_100035029 | 3300005340 | Bacteria | 3833 |
| 34 | Ga0070689_100646812 | 3300005340 | Unclassified | 919 |
| 35 | Ga0070687_100021009 | 3300005343 | Bacteria | 3061 |
| 36 | Ga0070687_100081645 | 3300005343 | Bacteria | 1766 |
| 37 | Ga0070687_100361702 | 3300005343 | Bacteria | 940 |
| 38 | Ga0070661_100009861 | 3300005344 | Bacteria | 6626 |
| 39 | Ga0070661_100032261 | 3300005344 | Bacteria | 3791 |
| 40 | Ga0070661_100100511 | 3300005344 | Bacteria | 2150 |
| 41 | Ga0070692_10285935 | 3300005345 | Bacteria | 1001 |
| 42 | Ga0070692_10516177 | 3300005345 | Unclassified | 777 |
| 43 | Ga0070668_100249021 | 3300005347 | Bacteria | 1474 |
| 44 | Ga0070668_100580326 | 3300005347 | Bacteria | 979 |
| 45 | Ga0070669_100006869 | 3300005353 | Bacteria | 8181 |
| 46 | Ga0070669_100827394 | 3300005353 | Bacteria | 788 |
| 47 | Ga0070675_100448494 | 3300005354 | Bacteria | 1157 |
| 48 | Ga0070671_100022544 | 3300005355 | Bacteria | 5143 |
| 49 | Ga0070671_100037938 | 3300005355 | Bacteria | 3998 |
| 50 | Ga0070671_100052321 | 3300005355 | Bacteria | 3395 |
| 51 | Ga0070671_100293287 | 3300005355 | Unclassified | 1384 |
| 52 | Ga0070673_100007703 | 3300005364 | Bacteria | 7127 |
| 53 | Ga0070673_100527808 | 3300005364 | Bacteria | 1070 |
| 54 | Ga0070688_100013282 | 3300005365 | Bacteria | 4639 |
| 55 | Ga0070667_100141363 | 3300005367 | Bacteria | 2108 |
| 56 | Ga0070667_100228515 | 3300005367 | Unclassified | 1658 |
| 57 | Ga0070703_10000274 | 3300005406 | Bacteria | 24474 |
| 58 | Ga0070709_10263141 | 3300005434 | Bacteria | 1247 |
| 59 | Ga0070714_100000912 | 3300005435 | Bacteria | 20923 |
| 60 | Ga0070701_10004148 | 3300005438 | Bacteria | 5824 |
| 61 | Ga0070701_10286502 | 3300005438 | Unclassified | 1008 |
| 62 | Ga0070700_100008331 | 3300005441 | Bacteria | 5644 |
| 63 | Ga0070700_100026964 | 3300005441 | Unclassified | 3401 |
| 64 | Ga0070700_100656379 | 3300005441 | Unclassified | 829 |
| 65 | Ga0070694_100719141 | 3300005444 | Bacteria | 813 |
| 66 | Ga0070663_100006399 | 3300005455 | Bacteria | 7081 |
| 67 | Ga0070663_100616597 | 3300005455 | Unclassified | 914 |
| 68 | Ga0070678_100063454 | 3300005456 | Bacteria | 2734 |
| 69 | Ga0070678_100113039 | 3300005456 | Bacteria | 2128 |
| 70 | Ga0070678_100574997 | 3300005456 | Bacteria | 1003 |
| 71 | Ga0070678_100748144 | 3300005456 | Unclassified | 884 |
| 72 | Ga0070662_100021163 | 3300005457 | Bacteria | 4438 |
| 73 | Ga0070681_10050282 | 3300005458 | Bacteria | 4159 |
| 74 | Ga0070681_10231759 | 3300005458 | Bacteria | 1761 |
| 75 | Ga0068867_100013241 | 3300005459 | Bacteria | 5842 |
| 76 | Ga0068867_100142545 | 3300005459 | Bacteria | 1875 |
| 77 | Ga0068867_100393457 | 3300005459 | Bacteria | 1167 |
| 78 | Ga0070706_100089894 | 3300005467 | Bacteria | 2848 |
| 79 | Ga0070707_100368774 | 3300005468 | Bacteria | 1395 |
| 80 | Ga0070698_100051033 | 3300005471 | Bacteria | 4214 |
| 81 | Ga0070698_100069387 | 3300005471 | Bacteria | 3539 |
| 82 | Ga0070698_100180874 | 3300005471 | Bacteria | 2047 |
| 83 | Ga0070699_100193761 | 3300005518 | Bacteria | 1806 |
| 84 | Ga0070684_100001324 | 3300005535 | Bacteria | 17753 |
| 85 | Ga0068853_100076897 | 3300005539 | Bacteria | 2915 |
| 86 | Ga0068853_100200646 | 3300005539 | Bacteria | 1815 |
| 87 | Ga0070672_100068120 | 3300005543 | Bacteria | 2822 |
| 88 | Ga0070686_100191071 | 3300005544 | Bacteria | 1461 |
| 89 | Ga0070686_100586849 | 3300005544 | Bacteria | 876 |
| 90 | Ga0070696_100081615 | 3300005546 | Bacteria | 2291 |
| 91 | Ga0070693_100013862 | 3300005547 | Bacteria | 4117 |
| 92 | Ga0070693_100525429 | 3300005547 | Unclassified | 843 |
| 93 | Ga0070665_100218901 | 3300005548 | Bacteria | 1904 |
| 94 | Ga0070704_101109695 | 3300005549 | Unclassified | 719 |
| 95 | Ga0068855_100345152 | 3300005563 | Bacteria | 1641 |
| 96 | Ga0070664_100000841 | 3300005564 | Bacteria | 23674 |
| 97 | Ga0070664_100001423 | 3300005564 | Bacteria | 19088 |
| 98 | Ga0070664_100580695 | 3300005564 | Unclassified | 1038 |
| 99 | Ga0068857_100001955 | 3300005577 | Bacteria | 16644 |
| 100 | Ga0068857_100028809 | 3300005577 | Bacteria | 4900 |
| 101 | Ga0068854_100011953 | 3300005578 | Bacteria | 5673 |
| 102 | Ga0068854_100025076 | 3300005578 | Bacteria | 4090 |
| 103 | Ga0068854_100938782 | 3300005578 | Bacteria | 762 |
| 104 | Ga0068856_100155178 | 3300005614 | Bacteria | 2299 |
| 105 | Ga0068856_100211652 | 3300005614 | Bacteria | 1954 |
| 106 | Ga0070702_100052390 | 3300005615 | Bacteria | 2340 |
| 107 | Ga0070702_100090211 | 3300005615 | Bacteria | 1857 |
| 108 | Ga0068852_100024229 | 3300005616 | Bacteria | 4901 |
| 109 | Ga0068852_100025890 | 3300005616 | Bacteria | 4760 |
| 110 | Ga0068859_100003129 | 3300005617 | Bacteria | 16814 |
| 111 | Ga0068859_100011695 | 3300005617 | Bacteria | 8817 |
| 112 | Ga0068859_100282818 | 3300005617 | Bacteria | 1751 |
| 113 | Ga0068864_100023166 | 3300005618 | Bacteria | 5214 |
| 114 | Ga0068866_10013907 | 3300005718 | Bacteria | 3541 |
| 115 | Ga0068861_100061602 | 3300005719 | Bacteria | 2880 |
| 116 | Ga0068870_10012503 | 3300005840 | Bacteria | 3969 |
| 117 | Ga0068870_10214974 | 3300005840 | Bacteria | 1173 |
| 118 | Ga0068863_100030581 | 3300005841 | Bacteria | 5141 |
| 119 | Ga0068858_100002579 | 3300005842 | Bacteria | 18247 |
| 120 | Ga0068858_100114049 | 3300005842 | Bacteria | 2524 |
| 121 | Ga0068858_100129273 | 3300005842 | Bacteria | 2367 |
| 122 | Ga0068858_100144785 | 3300005842 | Bacteria | 2231 |
| 123 | Ga0068858_100216304 | 3300005842 | Bacteria | 1814 |
| 124 | Ga0068858_100225391 | 3300005842 | Bacteria | 1776 |
| 125 | Ga0068860_100025812 | 3300005843 | Bacteria | 5667 |
| 126 | Ga0068860_100040445 | 3300005843 | Bacteria | 4455 |
| 127 | Ga0068862_100025500 | 3300005844 | Bacteria | 4963 |
| 128 | Ga0068862_100082649 | 3300005844 | Bacteria | 2788 |
| 129 | Ga0068862_100133740 | 3300005844 | Bacteria | 2196 |
| 130 | Ga0070717_10026903 | 3300006028 | Bacteria | 4594 |
| 131 | Ga0070717_10130843 | 3300006028 | Bacteria | 2158 |
| 132 | Ga0075432_10105500 | 3300006058 | Unclassified | 1045 |
| 133 | Ga0070712_100006531 | 3300006175 | Bacteria | 7239 |
| 134 | Ga0097621_100028451 | 3300006237 | Bacteria | 4404 |
| 135 | Ga0097621_100260972 | 3300006237 | Unclassified | 1520 |
| 136 | Ga0068871_100109527 | 3300006358 | Bacteria | 2322 |
| 137 | Ga0075428_100004174 | 3300006844 | Bacteria | 15901 |
| 138 | Ga0075428_100249197 | 3300006844 | Bacteria | 1915 |
| 139 | Ga0075430_100075061 | 3300006846 | Bacteria | 2835 |
| 140 | Ga0075431_100000173 | 3300006847 | Bacteria | 45790 |
| 141 | Ga0075433_10046552 | 3300006852 | Bacteria | 3772 |
| 142 | Ga0075433_10201881 | 3300006852 | Bacteria | 1768 |
| 143 | Ga0075434_100670857 | 3300006871 | Bacteria | 1055 |
| 144 | Ga0075429_100057416 | 3300006880 | Bacteria | 3389 |
| 145 | Ga0075429_100060299 | 3300006880 | Bacteria | 3305 |
| 146 | Ga0068865_100099730 | 3300006881 | Bacteria | 2124 |
| 147 | Ga0068865_100556975 | 3300006881 | Unclassified | 963 |
| 148 | Ga0097620_100003129 | 3300006931 | Bacteria | 16814 |
| 149 | Ga0097620_100011695 | 3300006931 | Bacteria | 8817 |
| 150 | Ga0097620_100282841 | 3300006931 | Bacteria | 1751 |
| 151 | Ga0075435_100460135 | 3300007076 | Bacteria | 1097 |
| 152 | Ga0099795_10121632 | 3300007788 | Unclassified | 1044 |
| 153 | Ga0105240_10055902 | 3300009093 | Bacteria | 4940 |
| 154 | Ga0105240_10215286 | 3300009093 | Bacteria | 2242 |
| 155 | Ga0105240_11813178 | 3300009093 | Bacteria | 636 |
| 156 | Ga0111539_10008939 | 3300009094 | Bacteria | 12682 |
| 157 | Ga0111539_10316853 | 3300009094 | Bacteria | 1815 |
| 158 | Ga0111539_10627567 | 3300009094 | Bacteria | 1251 |
| 159 | Ga0105245_10112071 | 3300009098 | Bacteria | 2538 |
| 160 | Ga0105245_10254971 | 3300009098 | Bacteria | 1706 |
| 161 | Ga0114129_10303057 | 3300009147 | Unclassified | 2129 |
| 162 | Ga0105241_10066757 | 3300009174 | Bacteria | 2783 |
| 163 | Ga0105241_10181428 | 3300009174 | Bacteria | 1747 |
| 164 | Ga0105242_10232273 | 3300009176 | Bacteria | 1653 |
| 165 | Ga0105242_10704477 | 3300009176 | Bacteria | 988 |
| 166 | Ga0105248_10041089 | 3300009177 | Bacteria | 5184 |
| 167 | Ga0105248_10200541 | 3300009177 | Bacteria | 2248 |
| 168 | Ga0105248_10702973 | 3300009177 | Bacteria | 1141 |
| 169 | Ga0105249_10007432 | 3300009553 | Bacteria | 9558 |
| 170 | Ga0105249_10586733 | 3300009553 | Bacteria | 1168 |
| 171 | Ga0099796_10099037 | 3300010159 | Bacteria | 1094 |
| 172 | Ga0099796_10195155 | 3300010159 | Bacteria | 819 |
| 173 | Ga0105239_10381334 | 3300010375 | Bacteria | 1594 |
| 174 | Ga0157371_10056301 | 3300013102 | Bacteria | 2789 |
| 175 | Ga0157370_10131265 | 3300013104 | Bacteria | 2337 |
| 176 | Ga0157369_10027692 | 3300013105 | Bacteria | 6279 |
| 177 | Ga0157374_10002418 | 3300013296 | Bacteria | 15756 |
| 178 | Ga0157378_10000261 | 3300013297 | Bacteria | 51739 |
| 179 | Ga0157378_10000621 | 3300013297 | Bacteria | 33432 |
| 180 | Ga0157378_10000648 | 3300013297 | Bacteria | 32733 |
| 181 | Ga0157378_10156735 | 3300013297 | Bacteria | 2126 |
| 182 | Ga0157378_11345554 | 3300013297 | Bacteria | 756 |
| 183 | Ga0163162_10079039 | 3300013306 | Bacteria | 3355 |
| 184 | Ga0157372_10002757 | 3300013307 | Bacteria | 18992 |
| 185 | Ga0157372_10005695 | 3300013307 | Bacteria | 13258 |
| 186 | Ga0157375_10000010 | 3300013308 | Bacteria | 361011 |
| 187 | Ga0157375_10025824 | 3300013308 | Bacteria | 5465 |
| 188 | Ga0157375_10376554 | 3300013308 | Bacteria | 1586 |
| 189 | Ga0163163_10153027 | 3300014325 | Bacteria | 2350 |
| 190 | Ga0157380_10012453 | 3300014326 | Bacteria | 6171 |
| 191 | Ga0157380_10026131 | 3300014326 | Bacteria | 4432 |
| 192 | Ga0157380_10037471 | 3300014326 | Bacteria | 3757 |
| 193 | Ga0157380_10292408 | 3300014326 | Bacteria | 1496 |
| 194 | Ga0157377_10036008 | 3300014745 | Bacteria | 2719 |
| 195 | Ga0157377_10304597 | 3300014745 | Bacteria | 1053 |
| 196 | Ga0157377_10594542 | 3300014745 | Bacteria | 788 |
| 197 | Ga0157379_10081794 | 3300014968 | Bacteria | 2893 |
| 198 | Ga0157376_10256439 | 3300014969 | Bacteria | 1636 |
| 199 | Ga0163161_10067755 | 3300017792 | Bacteria | 2607 |
| 200 | Ga0163161_10547207 | 3300017792 | Bacteria | 948 |
| 201 | Ga0213873_10051776 | 3300021358 | Unclassified | 1089 |
| 202 | Ga0213872_10011469 | 3300021361 | Unclassified | 4190 |
| 203 | Ga0213872_10044143 | 3300021361 | Bacteria | 2030 |
| 204 | Ga0213871_10002238 | 3300021441 | Bacteria | 3521 |
| 205 | Ga0213871_10016351 | 3300021441 | Bacteria | 1787 |
| 206 | Ga0213871_10039214 | 3300021441 | Unclassified | 1267 |
| 207 | Ga0209130_1000053 | 3300025284 | Bacteria | 214421 |
| 208 | Ga0209256_1010723 | 3300025299 | Bacteria | 3786 |
| 209 | Ga0207426_1000054 | 3300025302 | Bacteria | 384435 |
| 210 | Ga0207697_10001639 | 3300025315 | Bacteria | 12114 |
| 211 | Ga0207653_10000023 | 3300025885 | Bacteria | 118612 |
| 212 | Ga0207682_10008990 | 3300025893 | Bacteria | 3947 |
| 213 | Ga0207682_10019213 | 3300025893 | Bacteria | 2675 |
| 214 | Ga0207642_10031738 | 3300025899 | Bacteria | 2216 |
| 215 | Ga0207642_10675705 | 3300025899 | Unclassified | 649 |
| 216 | Ga0207688_10004795 | 3300025901 | Bacteria | 7368 |
| 217 | Ga0207688_10005805 | 3300025901 | Bacteria | 6717 |
| 218 | Ga0207688_10014735 | 3300025901 | Bacteria | 4243 |
| 219 | Ga0207680_10027351 | 3300025903 | Bacteria | 3174 |
| 220 | Ga0207680_10066938 | 3300025903 | Bacteria | 2211 |
| 221 | Ga0207699_10106830 | 3300025906 | Bacteria | 1787 |
| 222 | Ga0207645_10037618 | 3300025907 | Bacteria | 3105 |
| 223 | Ga0207645_10108991 | 3300025907 | Bacteria | 1791 |
| 224 | Ga0207643_10001683 | 3300025908 | Bacteria | 12404 |
| 225 | Ga0207643_10062752 | 3300025908 | Bacteria | 2123 |
| 226 | Ga0207684_10068471 | 3300025910 | Bacteria | 3017 |
| 227 | Ga0207654_10042260 | 3300025911 | Bacteria | 2578 |
| 228 | Ga0207707_10030792 | 3300025912 | Bacteria | 4694 |
| 229 | Ga0207707_10190148 | 3300025912 | Bacteria | 1791 |
| 230 | Ga0207695_10000153 | 3300025913 | Bacteria | 206288 |
| 231 | Ga0207695_10135387 | 3300025913 | Bacteria | 2417 |
| 232 | Ga0207693_10012249 | 3300025915 | Bacteria | 6931 |
| 233 | Ga0207663_10056825 | 3300025916 | Bacteria | 2463 |
| 234 | Ga0207662_10003446 | 3300025918 | Bacteria | 8142 |
| 235 | Ga0207662_10103340 | 3300025918 | Bacteria | 1768 |
| 236 | Ga0207649_10014544 | 3300025920 | Bacteria | 4407 |
| 237 | Ga0207649_10036209 | 3300025920 | Bacteria | 2971 |
| 238 | Ga0207649_10246453 | 3300025920 | Bacteria | 1285 |
| 239 | Ga0207646_10320038 | 3300025922 | Bacteria | 1402 |
| 240 | Ga0207646_10332313 | 3300025922 | Bacteria | 1373 |
| 241 | Ga0207681_10019413 | 3300025923 | Bacteria | 4294 |
| 242 | Ga0207681_10167583 | 3300025923 | Unclassified | 1662 |
| 243 | Ga0207650_10008131 | 3300025925 | Bacteria | 7149 |
| 244 | Ga0207650_10085746 | 3300025925 | Bacteria | 2396 |
| 245 | Ga0207650_10388583 | 3300025925 | Bacteria | 1153 |
| 246 | Ga0207659_10006063 | 3300025926 | Bacteria | 7378 |
| 247 | Ga0207700_10088312 | 3300025928 | Bacteria | 2441 |
| 248 | Ga0207664_10002101 | 3300025929 | Bacteria | 13100 |
| 249 | Ga0207644_10107687 | 3300025931 | Bacteria | 2103 |
| 250 | Ga0207644_10259818 | 3300025931 | Unclassified | 1388 |
| 251 | Ga0207690_10347282 | 3300025932 | Bacteria | 1172 |
| 252 | Ga0207706_10009687 | 3300025933 | Bacteria | 8843 |
| 253 | Ga0207706_10095014 | 3300025933 | Bacteria | 2622 |
| 254 | Ga0207706_10153532 | 3300025933 | Bacteria | 2025 |
| 255 | Ga0207704_10047139 | 3300025938 | Bacteria | 2574 |
| 256 | Ga0207704_10428768 | 3300025938 | Unclassified | 1050 |
| 257 | Ga0207691_10039070 | 3300025940 | Bacteria | 4392 |
| 258 | Ga0207691_10910178 | 3300025940 | Unclassified | 736 |
| 259 | Ga0207711_10626491 | 3300025941 | Bacteria | 1004 |
| 260 | Ga0207711_10818656 | 3300025941 | Bacteria | 867 |
| 261 | Ga0207689_10042422 | 3300025942 | Bacteria | 3764 |
| 262 | Ga0207689_10059166 | 3300025942 | Bacteria | 3152 |
| 263 | Ga0207689_10077279 | 3300025942 | Bacteria | 2737 |
| 264 | Ga0207661_10009912 | 3300025944 | Bacteria | 6841 |
| 265 | Ga0207679_10097760 | 3300025945 | Bacteria | 2287 |
| 266 | Ga0207667_10027664 | 3300025949 | Bacteria | 6168 |
| 267 | Ga0207667_10186258 | 3300025949 | Bacteria | 2131 |
| 268 | Ga0207667_11026987 | 3300025949 | Bacteria | 811 |
| 269 | Ga0207651_10291606 | 3300025960 | Bacteria | 1353 |
| 270 | Ga0207651_10745940 | 3300025960 | Bacteria | 865 |
| 271 | Ga0207712_10305108 | 3300025961 | Unclassified | 1308 |
| 272 | Ga0207712_10465479 | 3300025961 | Bacteria | 1075 |
| 273 | Ga0207712_10543335 | 3300025961 | Unclassified | 998 |
| 274 | Ga0207640_10006837 | 3300025981 | Bacteria | 6270 |
| 275 | Ga0207640_10050156 | 3300025981 | Bacteria | 2706 |
| 276 | Ga0207658_10124806 | 3300025986 | Bacteria | 2058 |
| 277 | Ga0207658_10130409 | 3300025986 | Bacteria | 2019 |
| 278 | Ga0207677_10107798 | 3300026023 | Bacteria | 2067 |
| 279 | Ga0207677_10330166 | 3300026023 | Bacteria | 1271 |
| 280 | Ga0207677_10912867 | 3300026023 | Unclassified | 792 |
| 281 | Ga0207703_10007939 | 3300026035 | Bacteria | 8388 |
| 282 | Ga0207703_10055079 | 3300026035 | Bacteria | 3235 |
| 283 | Ga0207703_10103630 | 3300026035 | Bacteria | 2416 |
| 284 | Ga0207703_10134741 | 3300026035 | Bacteria | 2137 |
| 285 | Ga0207703_10620937 | 3300026035 | Bacteria | 1023 |
| 286 | Ga0207639_10000006 | 3300026041 | Bacteria | 544415 |
| 287 | Ga0207639_10163341 | 3300026041 | Bacteria | 1879 |
| 288 | Ga0207678_10041390 | 3300026067 | Bacteria | 3995 |
| 289 | Ga0207678_10582888 | 3300026067 | Bacteria | 980 |
| 290 | Ga0207708_10002308 | 3300026075 | Bacteria | 14027 |
| 291 | Ga0207708_10043165 | 3300026075 | Unclassified | 3436 |
| 292 | Ga0207708_10056066 | 3300026075 | Bacteria | 3005 |
| 293 | Ga0207708_10331051 | 3300026075 | Bacteria | 1245 |
| 294 | Ga0207702_10004232 | 3300026078 | Bacteria | 12821 |
| 295 | Ga0207641_10003668 | 3300026088 | Bacteria | 13525 |
| 296 | Ga0207648_10012064 | 3300026089 | Bacteria | 8104 |
| 297 | Ga0207648_10151559 | 3300026089 | Bacteria | 2046 |
| 298 | Ga0207676_10042974 | 3300026095 | Bacteria | 3477 |
| 299 | Ga0207674_10004111 | 3300026116 | Bacteria | 17624 |
| 300 | Ga0207675_100019782 | 3300026118 | Bacteria | 6284 |
| 301 | Ga0207675_100142983 | 3300026118 | Bacteria | 2273 |
| 302 | Ga0207683_10087059 | 3300026121 | Bacteria | 2778 |
| 303 | Ga0207683_10106266 | 3300026121 | Bacteria | 2510 |
| 304 | Ga0207683_10145905 | 3300026121 | Bacteria | 2134 |
| 305 | Ga0207683_10732204 | 3300026121 | Bacteria | 917 |
| 306 | Ga0207698_10073719 | 3300026142 | Bacteria | 2719 |
| 307 | Ga0210002_1026392 | 3300027617 | Bacteria | 953 |
| 308 | Ga0207428_10011427 | 3300027907 | Bacteria | 7848 |
| 309 | Ga0268266_10116401 | 3300028379 | Bacteria | 2374 |
| 310 | Ga0268265_10114812 | 3300028380 | Bacteria | 2206 |
| 311 | Ga0268265_10187479 | 3300028380 | Bacteria | 1783 |
| 312 | Ga0268264_10046622 | 3300028381 | Bacteria | 3600 |
| 313 | Ga0268264_10156575 | 3300028381 | Bacteria | 2048 |
| 314 | Ga0268264_10309708 | 3300028381 | Bacteria | 1489 |
| 315 | Ga0265336_10003255 | 3300028666 | Bacteria | 6422 |
| 316 | Ga0265338_10003361 | 3300028800 | Bacteria | 22584 |
| 317 | Ga0265760_10066543 | 3300031090 | Bacteria | 1101 |
| 318 | Ga0265320_10070803 | 3300031240 | Bacteria | 1644 |
| 319 | Ga0265325_10145092 | 3300031241 | Bacteria | 1126 |
| 320 | Ga0265329_10026789 | 3300031242 | Bacteria | 1897 |
| 321 | Ga0265331_10005346 | 3300031250 | Bacteria | 7762 |
| 322 | Ga0265316_10005766 | 3300031344 | Bacteria | 11959 |
| 323 | Ga0265316_10017587 | 3300031344 | Bacteria | 6171 |
| 324 | Ga0307513_10337123 | 3300031456 | Bacteria | 1260 |
| 325 | Ga0265314_10111161 | 3300031711 | Bacteria | 1741 |
| 326 | Ga0265342_10232486 | 3300031712 | Bacteria | 990 |
| 327 | Ga0373939_0221890 | 3300035114 | Bacteria | 724 |
| 328 | Ga0373931_0207712 | 3300035691 | Unclassified | 1173 |
| 329 | Ga0373931_0229585 | 3300035691 | Bacteria | 1121 |
| 330 | Ga0436360_0059810 | 3300039438 | Bacteria | 5665 |
| 331 | Ga0436360_0331514 | 3300039438 | Bacteria | 4714 |
| 332 | Ga0436360_1001917 | 3300039438 | Unclassified | 4892 |
| 333 | Ga0436360_1017485 | 3300039438 | Bacteria | 6846 |
| 334 | Ga0436361_0014707 | 3300039447 | Bacteria | 5365 |
| 335 | Ga0436361_0278206 | 3300039447 | Bacteria | 7847 |
| 336 | Ga0436362_0047029 | 3300039453 | Bacteria | 5581 |
| 337 | Ga0436362_0914181 | 3300039453 | Bacteria | 1507 |
| 338 | Ga0436362_0940395 | 3300039453 | Bacteria | 1506 |
| 339 | Ga0439435_0097237 | 3300042436 | Bacteria | 901 |
| 340 | Ga0466963_0663756 | 3300044694 | Bacteria | 736 |
| 341 | Ga0453684_0059673 | 3300044712 | Bacteria | 4915 |
| 342 | Ga0451576_0015319 | 3300045051 | Bacteria | 8497 |
| 343 | Ga0451576_0033174 | 3300045051 | Bacteria | 5489 |
| 344 | Ga0466967_0624245 | 3300045976 | Bacteria | 1065 |
| 345 | Ga0495603_0042072 | 3300046455 | Bacteria | 2732 |
| 346 | Ga0495629_0002437 | 3300046459 | Bacteria | 14277 |
| 347 | Ga0495641_0249466 | 3300046461 | Bacteria | 798 |
| 348 | Ga0495594_0142996 | 3300046499 | Bacteria | 1357 |
| 349 | Ga0495583_0004658 | 3300046506 | Bacteria | 9674 |
| 350 | Ga0495628_0396464 | 3300046516 | Bacteria | 1009 |
| 351 | Ga0495645_0393936 | 3300046543 | Bacteria | 884 |
| 352 | Ga0495622_0088661 | 3300046557 | Bacteria | 1422 |
| 353 | Ga0495634_0090683 | 3300046642 | Bacteria | 1985 |
| 354 | Ga0495625_0019551 | 3300046660 | Bacteria | 5249 |
| 355 | Ga0495647_0158952 | 3300046681 | Bacteria | 973 |
| 356 | Ga0495658_0113690 | 3300046683 | Bacteria | 1630 |
| 357 | Ga0495600_0088126 | 3300046809 | Bacteria | 2025 |
| 358 | Ga0495676_0123658 | 3300047321 | Bacteria | 1878 |
| 359 | Ga0495679_012794 | 3300047446 | Bacteria | 3177 |
| 360 | Ga0495614_0330718 | 3300048089 | Bacteria | 708 |
| 361 | Ga0496101_0106904 | 3300048904 | Bacteria | 2102 |
| 362 | Ga0496104_0085572 | 3300048907 | Bacteria | 3009 |
| 363 | Ga0496104_0337212 | 3300048907 | Bacteria | 1421 |
| 364 | Ga0496105_0022381 | 3300048908 | Bacteria | 5119 |
| 365 | Ga0496108_0131925 | 3300048911 | Bacteria | 2147 |
| 366 | Ga0496108_0284054 | 3300048911 | Bacteria | 1440 |
| 367 | Ga0496109_0002574 | 3300048912 | Bacteria | 15193 |
| 368 | Ga0496110_0026021 | 3300048913 | Bacteria | 5003 |
| 369 | Ga0496110_0375946 | 3300048913 | Unclassified | 1295 |
| 370 | Ga0496111_0005431 | 3300048914 | Bacteria | 8167 |
| 371 | Ga0496112_0567900 | 3300048915 | Bacteria | 1068 |
| 372 | Ga0496114_0255762 | 3300048917 | Bacteria | 1541 |
| 373 | Ga0496121_0340411 | 3300048924 | Bacteria | 1003 |
| 374 | Ga0501033_0000008 | 3300049570 | Bacteria | 274368 |
| 375 | Ga0501038_0014160 | 3300049574 | Bacteria | 7267 |
| 376 | Ga0501068_0350740 | 3300049584 | Unclassified | 948 |
| 377 | Ga0501069_0063056 | 3300049585 | Bacteria | 2070 |
| 378 | Ga0501070_0018902 | 3300049586 | Bacteria | 5780 |
| 379 | Ga0501071_0306054 | 3300049587 | Bacteria | 1205 |
| 380 | Ga0501072_0143286 | 3300049588 | Bacteria | 1906 |
| 381 | Ga0501076_0295391 | 3300049592 | Bacteria | 1328 |
| 382 | Ga0501080_0157507 | 3300049742 | Bacteria | 2098 |
| 383 | Ga0501080_0365605 | 3300049742 | Unclassified | 1301 |
| 384 | Ga0501081_0149767 | 3300049743 | Bacteria | 1676 |
| 385 | Ga0501081_0235475 | 3300049743 | Bacteria | 1334 |
| 386 | Ga0501083_0139456 | 3300049744 | Bacteria | 1588 |
| 387 | Ga0501045_0342398 | 3300049824 | Bacteria | 1113 |
| 388 | nmdc:mga05p37_265794_c1 | 3300050507 | Unclassified | 2051 |
| 389 | nmdc:mga05p37_579996_c1 | 3300050507 | Bacteria | 1270 |
| 390 | nmdc:mga09592_199378_c1 | 3300050508 | Bacteria | 1733 |
| 391 | nmdc:mga0qj67_26336_c1 | 3300050509 | Bacteria | 4501 |
| 392 | nmdc:mga06r32_224_c1 | 3300050510 | Bacteria | 45758 |
| 393 | nmdc:mga08y16_423807_c1 | 3300050511 | Bacteria | 1360 |
| 394 | nmdc:mga08y16_521228_c1 | 3300050511 | Bacteria | 1205 |
| 395 | nmdc:mga08y16_66238_c1 | 3300050511 | Bacteria | 3770 |
| 396 | nmdc:mga0n895_17292_c1 | 3300050512 | Bacteria | 6645 |
| 397 | nmdc:mga0a205_9911_c1 | 3300050515 | Bacteria | 8738 |
| 398 | Ga0495655_0000438 | 3300053083 | Bacteria | 7016 |
| 399 | Ga0500566_0266549 | 3300053094 | Bacteria | 824 |
| 400 | Ga0500556_0106869 | 3300053104 | Bacteria | 1082 |
| 401 | Ga0500572_093629 | 3300053111 | Unclassified | 954 |
| 402 | Ga0500608_062124 | 3300053122 | Unclassified | 1784 |
| 403 | Ga0500618_000735 | 3300053125 | Bacteria | 18723 |
| 404 | Ga0500590_000679 | 3300053148 | Bacteria | 12256 |
| 405 | Ga0500639_176681 | 3300053163 | Bacteria | 950 |
| 406 | Ga0500636_0222237 | 3300053177 | Bacteria | 983 |
| 407 | Ga0501082_0057343 | 3300060353 | Bacteria | 3356 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2582581867 | 2585403181 | 194 |
| 2 | iso_pu_bacteria | 2852387548 | 2852393923 | 194 |
| 3 | iso_pu_bacteria | 8024486573 | 8024487078 | 194 |
| 4 | 3300006880 | Ga0075429_100060299 | Ga0075429_1000602995 | 197 |
| 5 | 3300014326 | Ga0157380_10292408 | Ga0157380_102924082 | 197 |
| 6 | 3300025940 | Ga0207691_10910178 | Ga0207691_109101781 | 197 |
| 7 | 3300026067 | Ga0207678_10582888 | Ga0207678_105828882 | 197 |
| 8 | 3300026075 | Ga0207708_10056066 | Ga0207708_100560664 | 197 |
| 9 | 3300050507 | nmdc:mga05p37_579996_c1 | nmdc:mga05p37_579996_c1_529_1122 | 197 |
| 10 | 2162886012 | MBSR1b_contig_3150975 | MBSR1b_0640.00005580 | 198 |
| 11 | 3300001977 | JGI24746J21847_1007673 | JGI24746J21847_10076732 | 198 |
| 12 | 3300001991 | JGI24743J22301_10005397 | JGI24743J22301_100053972 | 198 |
| 13 | 3300002987 | JGI25159J45721_1000167 | JGI25159J45721_10001678 | 198 |
| 14 | 3300003354 | JGI25160J50197_1000288 | JGI25160J50197_100028823 | 198 |
| 15 | 3300003374 | JGI25161J50226_1000215 | JGI25161J50226_100021516 | 198 |
| 16 | 3300004625 | Ga0055543_1000006 | Ga0055543_1000006192 | 198 |
| 17 | 3300005262 | Ga0065165_1000215 | Ga0065165_100021517 | 198 |
| 18 | 3300005290 | Ga0065712_10079435 | Ga0065712_100794352 | 198 |
| 19 | 3300005290 | Ga0065712_10136696 | Ga0065712_101366963 | 198 |
| 20 | 3300005293 | Ga0065715_10142656 | Ga0065715_101426561 | 198 |
| 21 | 3300005293 | Ga0065715_10228239 | Ga0065715_102282392 | 198 |
| 22 | 3300005328 | Ga0070676_10036088 | Ga0070676_100360882 | 198 |
| 23 | 3300005328 | Ga0070676_10305592 | Ga0070676_103055922 | 198 |
| 24 | 3300005329 | Ga0070683_100007518 | Ga0070683_1000075188 | 198 |
| 25 | 3300005330 | Ga0070690_100006139 | Ga0070690_1000061395 | 198 |
| 26 | 3300005331 | Ga0070670_100010889 | Ga0070670_1000108895 | 198 |
| 27 | 3300005331 | Ga0070670_100013239 | Ga0070670_1000132396 | 198 |
| 28 | 3300005331 | Ga0070670_100238749 | Ga0070670_1002387492 | 198 |
| 29 | 3300005333 | Ga0070677_10005763 | Ga0070677_100057633 | 198 |
| 30 | 3300005333 | Ga0070677_10010892 | Ga0070677_100108924 | 198 |
| 31 | 3300005335 | Ga0070666_10015255 | Ga0070666_100152555 | 198 |
| 32 | 3300005335 | Ga0070666_10021867 | Ga0070666_100218674 | 198 |
| 33 | 3300005335 | Ga0070666_10057181 | Ga0070666_100571813 | 198 |
| 34 | 3300005336 | Ga0070680_100358048 | Ga0070680_1003580481 | 198 |
| 35 | 3300005337 | Ga0070682_100150951 | Ga0070682_1001509512 | 198 |
| 36 | 3300005337 | Ga0070682_100531214 | Ga0070682_1005312142 | 198 |
| 37 | 3300005338 | Ga0068868_100003793 | Ga0068868_1000037932 | 198 |
| 38 | 3300005338 | Ga0068868_100075866 | Ga0068868_1000758662 | 198 |
| 39 | 3300005338 | Ga0068868_100129315 | Ga0068868_1001293152 | 198 |
| 40 | 3300005339 | Ga0070660_100126376 | Ga0070660_1001263762 | 198 |
| 41 | 3300005340 | Ga0070689_100000455 | Ga0070689_10000045518 | 198 |
| 42 | 3300005340 | Ga0070689_100035029 | Ga0070689_1000350294 | 198 |
| 43 | 3300005340 | Ga0070689_100646812 | Ga0070689_1006468122 | 198 |
| 44 | 3300005343 | Ga0070687_100021009 | Ga0070687_1000210092 | 198 |
| 45 | 3300005343 | Ga0070687_100081645 | Ga0070687_1000816452 | 198 |
| 46 | 3300005343 | Ga0070687_100361702 | Ga0070687_1003617022 | 198 |
| 47 | 3300005344 | Ga0070661_100009861 | Ga0070661_1000098612 | 198 |
| 48 | 3300005344 | Ga0070661_100032261 | Ga0070661_1000322613 | 198 |
| 49 | 3300005344 | Ga0070661_100100511 | Ga0070661_1001005113 | 198 |
| 50 | 3300005345 | Ga0070692_10285935 | Ga0070692_102859352 | 198 |
| 51 | 3300005345 | Ga0070692_10516177 | Ga0070692_105161771 | 198 |
| 52 | 3300005347 | Ga0070668_100249021 | Ga0070668_1002490212 | 198 |
| 53 | 3300005347 | Ga0070668_100580326 | Ga0070668_1005803261 | 198 |
| 54 | 3300005353 | Ga0070669_100006869 | Ga0070669_1000068692 | 198 |
| 55 | 3300005353 | Ga0070669_100827394 | Ga0070669_1008273941 | 198 |
| 56 | 3300005354 | Ga0070675_100448494 | Ga0070675_1004484941 | 198 |
| 57 | 3300005355 | Ga0070671_100022544 | Ga0070671_1000225445 | 198 |
| 58 | 3300005355 | Ga0070671_100037938 | Ga0070671_1000379382 | 198 |
| 59 | 3300005355 | Ga0070671_100052321 | Ga0070671_1000523214 | 198 |
| 60 | 3300005355 | Ga0070671_100293287 | Ga0070671_1002932872 | 198 |
| 61 | 3300005364 | Ga0070673_100007703 | Ga0070673_1000077036 | 198 |
| 62 | 3300005364 | Ga0070673_100527808 | Ga0070673_1005278081 | 198 |
| 63 | 3300005365 | Ga0070688_100013282 | Ga0070688_1000132824 | 198 |
| 64 | 3300005367 | Ga0070667_100141363 | Ga0070667_1001413633 | 198 |
| 65 | 3300005367 | Ga0070667_100228515 | Ga0070667_1002285152 | 198 |
| 66 | 3300005406 | Ga0070703_10000274 | Ga0070703_1000027416 | 198 |
| 67 | 3300005434 | Ga0070709_10263141 | Ga0070709_102631412 | 198 |
| 68 | 3300005435 | Ga0070714_100000912 | Ga0070714_1000009128 | 198 |
| 69 | 3300005438 | Ga0070701_10004148 | Ga0070701_100041484 | 198 |
| 70 | 3300005438 | Ga0070701_10286502 | Ga0070701_102865021 | 198 |
| 71 | 3300005441 | Ga0070700_100008331 | Ga0070700_1000083313 | 198 |
| 72 | 3300005441 | Ga0070700_100026964 | Ga0070700_1000269642 | 198 |
| 73 | 3300005441 | Ga0070700_100656379 | Ga0070700_1006563791 | 198 |
| 74 | 3300005444 | Ga0070694_100719141 | Ga0070694_1007191412 | 198 |
| 75 | 3300005455 | Ga0070663_100006399 | Ga0070663_1000063996 | 198 |
| 76 | 3300005455 | Ga0070663_100616597 | Ga0070663_1006165971 | 198 |
| 77 | 3300005456 | Ga0070678_100063454 | Ga0070678_1000634543 | 198 |
| 78 | 3300005456 | Ga0070678_100113039 | Ga0070678_1001130393 | 198 |
| 79 | 3300005456 | Ga0070678_100574997 | Ga0070678_1005749972 | 198 |
| 80 | 3300005456 | Ga0070678_100748144 | Ga0070678_1007481442 | 198 |
| 81 | 3300005457 | Ga0070662_100021163 | Ga0070662_1000211634 | 198 |
| 82 | 3300005458 | Ga0070681_10050282 | Ga0070681_100502823 | 198 |
| 83 | 3300005458 | Ga0070681_10231759 | Ga0070681_102317592 | 198 |
| 84 | 3300005459 | Ga0068867_100013241 | Ga0068867_1000132413 | 198 |
| 85 | 3300005459 | Ga0068867_100142545 | Ga0068867_1001425453 | 198 |
| 86 | 3300005459 | Ga0068867_100393457 | Ga0068867_1003934572 | 198 |
| 87 | 3300005467 | Ga0070706_100089894 | Ga0070706_1000898943 | 198 |
| 88 | 3300005468 | Ga0070707_100368774 | Ga0070707_1003687742 | 198 |
| 89 | 3300005471 | Ga0070698_100051033 | Ga0070698_1000510334 | 198 |
| 90 | 3300005471 | Ga0070698_100069387 | Ga0070698_1000693874 | 198 |
| 91 | 3300005471 | Ga0070698_100180874 | Ga0070698_1001808742 | 198 |
| 92 | 3300005518 | Ga0070699_100193761 | Ga0070699_1001937613 | 198 |
| 93 | 3300005535 | Ga0070684_100001324 | Ga0070684_10000132412 | 198 |
| 94 | 3300005539 | Ga0068853_100076897 | Ga0068853_1000768971 | 198 |
| 95 | 3300005539 | Ga0068853_100200646 | Ga0068853_1002006462 | 198 |
| 96 | 3300005543 | Ga0070672_100068120 | Ga0070672_1000681202 | 198 |
| 97 | 3300005544 | Ga0070686_100191071 | Ga0070686_1001910712 | 198 |
| 98 | 3300005544 | Ga0070686_100586849 | Ga0070686_1005868492 | 198 |
| 99 | 3300005546 | Ga0070696_100081615 | Ga0070696_1000816152 | 198 |
| 100 | 3300005547 | Ga0070693_100013862 | Ga0070693_1000138622 | 198 |
| 101 | 3300005547 | Ga0070693_100525429 | Ga0070693_1005254292 | 198 |
| 102 | 3300005548 | Ga0070665_100218901 | Ga0070665_1002189013 | 198 |
| 103 | 3300005549 | Ga0070704_101109695 | Ga0070704_1011096951 | 198 |
| 104 | 3300005563 | Ga0068855_100345152 | Ga0068855_1003451522 | 198 |
| 105 | 3300005564 | Ga0070664_100000841 | Ga0070664_10000084111 | 198 |
| 106 | 3300005564 | Ga0070664_100001423 | Ga0070664_10000142312 | 198 |
| 107 | 3300005564 | Ga0070664_100580695 | Ga0070664_1005806952 | 198 |
| 108 | 3300005577 | Ga0068857_100001955 | Ga0068857_1000019557 | 198 |
| 109 | 3300005577 | Ga0068857_100028809 | Ga0068857_1000288094 | 198 |
| 110 | 3300005578 | Ga0068854_100011953 | Ga0068854_1000119536 | 198 |
| 111 | 3300005578 | Ga0068854_100025076 | Ga0068854_1000250763 | 198 |
| 112 | 3300005578 | Ga0068854_100938782 | Ga0068854_1009387821 | 198 |
| 113 | 3300005614 | Ga0068856_100155178 | Ga0068856_1001551783 | 198 |
| 114 | 3300005614 | Ga0068856_100211652 | Ga0068856_1002116522 | 198 |
| 115 | 3300005615 | Ga0070702_100052390 | Ga0070702_1000523903 | 198 |
| 116 | 3300005615 | Ga0070702_100090211 | Ga0070702_1000902111 | 198 |
| 117 | 3300005616 | Ga0068852_100024229 | Ga0068852_1000242293 | 198 |
| 118 | 3300005616 | Ga0068852_100025890 | Ga0068852_1000258903 | 198 |
| 119 | 3300005617 | Ga0068859_100003129 | Ga0068859_10000312912 | 198 |
| 120 | 3300005617 | Ga0068859_100011695 | Ga0068859_1000116955 | 198 |
| 121 | 3300005617 | Ga0068859_100282818 | Ga0068859_1002828183 | 198 |
| 122 | 3300005618 | Ga0068864_100023166 | Ga0068864_1000231664 | 198 |
| 123 | 3300005718 | Ga0068866_10013907 | Ga0068866_100139073 | 198 |
| 124 | 3300005719 | Ga0068861_100061602 | Ga0068861_1000616023 | 198 |
| 125 | 3300005840 | Ga0068870_10012503 | Ga0068870_100125034 | 198 |
| 126 | 3300005840 | Ga0068870_10214974 | Ga0068870_102149741 | 198 |
| 127 | 3300005841 | Ga0068863_100030581 | Ga0068863_1000305813 | 198 |
| 128 | 3300005842 | Ga0068858_100002579 | Ga0068858_1000025797 | 198 |
| 129 | 3300005842 | Ga0068858_100114049 | Ga0068858_1001140492 | 198 |
| 130 | 3300005842 | Ga0068858_100129273 | Ga0068858_1001292733 | 198 |
| 131 | 3300005842 | Ga0068858_100144785 | Ga0068858_1001447852 | 198 |
| 132 | 3300005842 | Ga0068858_100216304 | Ga0068858_1002163042 | 198 |
| 133 | 3300005842 | Ga0068858_100225391 | Ga0068858_1002253913 | 198 |
| 134 | 3300005843 | Ga0068860_100025812 | Ga0068860_1000258123 | 198 |
| 135 | 3300005843 | Ga0068860_100040445 | Ga0068860_1000404455 | 198 |
| 136 | 3300005844 | Ga0068862_100025500 | Ga0068862_1000255004 | 198 |
| 137 | 3300005844 | Ga0068862_100082649 | Ga0068862_1000826492 | 198 |
| 138 | 3300005844 | Ga0068862_100133740 | Ga0068862_1001337403 | 198 |
| 139 | 3300006028 | Ga0070717_10026903 | Ga0070717_100269033 | 198 |
| 140 | 3300006028 | Ga0070717_10130843 | Ga0070717_101308432 | 198 |
| 141 | 3300006058 | Ga0075432_10105500 | Ga0075432_101055001 | 198 |
| 142 | 3300006175 | Ga0070712_100006531 | Ga0070712_10000653110 | 198 |
| 143 | 3300006237 | Ga0097621_100028451 | Ga0097621_1000284514 | 198 |
| 144 | 3300006237 | Ga0097621_100260972 | Ga0097621_1002609722 | 198 |
| 145 | 3300006358 | Ga0068871_100109527 | Ga0068871_1001095273 | 198 |
| 146 | 3300006844 | Ga0075428_100004174 | Ga0075428_1000041749 | 198 |
| 147 | 3300006844 | Ga0075428_100249197 | Ga0075428_1002491972 | 198 |
| 148 | 3300006846 | Ga0075430_100075061 | Ga0075430_1000750615 | 198 |
| 149 | 3300006847 | Ga0075431_100000173 | Ga0075431_10000017324 | 198 |
| 150 | 3300006852 | Ga0075433_10046552 | Ga0075433_100465523 | 198 |
| 151 | 3300006852 | Ga0075433_10201881 | Ga0075433_102018812 | 198 |
| 152 | 3300006871 | Ga0075434_100670857 | Ga0075434_1006708572 | 198 |
| 153 | 3300006880 | Ga0075429_100057416 | Ga0075429_1000574162 | 198 |
| 154 | 3300006881 | Ga0068865_100099730 | Ga0068865_1000997303 | 198 |
| 155 | 3300006881 | Ga0068865_100556975 | Ga0068865_1005569751 | 198 |
| 156 | 3300006931 | Ga0097620_100003129 | Ga0097620_10000312912 | 198 |
| 157 | 3300006931 | Ga0097620_100011695 | Ga0097620_1000116955 | 198 |
| 158 | 3300006931 | Ga0097620_100282841 | Ga0097620_1002828413 | 198 |
| 159 | 3300007076 | Ga0075435_100460135 | Ga0075435_1004601352 | 198 |
| 160 | 3300007788 | Ga0099795_10121632 | Ga0099795_101216322 | 198 |
| 161 | 3300009093 | Ga0105240_10055902 | Ga0105240_100559023 | 198 |
| 162 | 3300009093 | Ga0105240_10215286 | Ga0105240_102152861 | 198 |
| 163 | 3300009093 | Ga0105240_11813178 | Ga0105240_118131781 | 198 |
| 164 | 3300009094 | Ga0111539_10008939 | Ga0111539_100089396 | 198 |
| 165 | 3300009094 | Ga0111539_10316853 | Ga0111539_103168532 | 198 |
| 166 | 3300009094 | Ga0111539_10627567 | Ga0111539_106275672 | 198 |
| 167 | 3300009098 | Ga0105245_10112071 | Ga0105245_101120712 | 198 |
| 168 | 3300009098 | Ga0105245_10254971 | Ga0105245_102549712 | 198 |
| 169 | 3300009147 | Ga0114129_10303057 | Ga0114129_103030572 | 198 |
| 170 | 3300009174 | Ga0105241_10066757 | Ga0105241_100667573 | 198 |
| 171 | 3300009174 | Ga0105241_10181428 | Ga0105241_101814282 | 198 |
| 172 | 3300009176 | Ga0105242_10232273 | Ga0105242_102322732 | 198 |
| 173 | 3300009176 | Ga0105242_10704477 | Ga0105242_107044771 | 198 |
| 174 | 3300009177 | Ga0105248_10041089 | Ga0105248_100410892 | 198 |
| 175 | 3300009177 | Ga0105248_10200541 | Ga0105248_102005413 | 198 |
| 176 | 3300009177 | Ga0105248_10702973 | Ga0105248_107029732 | 198 |
| 177 | 3300009553 | Ga0105249_10007432 | Ga0105249_100074328 | 198 |
| 178 | 3300009553 | Ga0105249_10586733 | Ga0105249_105867332 | 198 |
| 179 | 3300010159 | Ga0099796_10099037 | Ga0099796_100990372 | 198 |
| 180 | 3300010159 | Ga0099796_10195155 | Ga0099796_101951551 | 198 |
| 181 | 3300010375 | Ga0105239_10381334 | Ga0105239_103813341 | 198 |
| 182 | 3300013102 | Ga0157371_10056301 | Ga0157371_100563013 | 198 |
| 183 | 3300013104 | Ga0157370_10131265 | Ga0157370_101312653 | 198 |
| 184 | 3300013105 | Ga0157369_10027692 | Ga0157369_100276927 | 198 |
| 185 | 3300013296 | Ga0157374_10002418 | Ga0157374_100024187 | 198 |
| 186 | 3300013297 | Ga0157378_10000261 | Ga0157378_1000026147 | 198 |
| 187 | 3300013297 | Ga0157378_10000621 | Ga0157378_1000062119 | 198 |
| 188 | 3300013297 | Ga0157378_10000648 | Ga0157378_1000064830 | 198 |
| 189 | 3300013297 | Ga0157378_10156735 | Ga0157378_101567352 | 198 |
| 190 | 3300013297 | Ga0157378_11345554 | Ga0157378_113455541 | 198 |
| 191 | 3300013306 | Ga0163162_10079039 | Ga0163162_100790393 | 198 |
| 192 | 3300013307 | Ga0157372_10002757 | Ga0157372_1000275710 | 198 |
| 193 | 3300013307 | Ga0157372_10005695 | Ga0157372_1000569512 | 198 |
| 194 | 3300013308 | Ga0157375_10000010 | Ga0157375_10000010275 | 198 |
| 195 | 3300013308 | Ga0157375_10025824 | Ga0157375_100258242 | 198 |
| 196 | 3300013308 | Ga0157375_10376554 | Ga0157375_103765543 | 198 |
| 197 | 3300014325 | Ga0163163_10153027 | Ga0163163_101530272 | 198 |
| 198 | 3300014326 | Ga0157380_10012453 | Ga0157380_100124534 | 198 |
| 199 | 3300014326 | Ga0157380_10026131 | Ga0157380_100261313 | 198 |
| 200 | 3300014326 | Ga0157380_10037471 | Ga0157380_100374714 | 198 |
| 201 | 3300014745 | Ga0157377_10036008 | Ga0157377_100360083 | 198 |
| 202 | 3300014745 | Ga0157377_10304597 | Ga0157377_103045971 | 198 |
| 203 | 3300014745 | Ga0157377_10594542 | Ga0157377_105945422 | 198 |
| 204 | 3300014968 | Ga0157379_10081794 | Ga0157379_100817942 | 198 |
| 205 | 3300014969 | Ga0157376_10256439 | Ga0157376_102564392 | 198 |
| 206 | 3300017792 | Ga0163161_10067755 | Ga0163161_100677553 | 198 |
| 207 | 3300017792 | Ga0163161_10547207 | Ga0163161_105472072 | 198 |
| 208 | 3300021358 | Ga0213873_10051776 | Ga0213873_100517761 | 198 |
| 209 | 3300021361 | Ga0213872_10011469 | Ga0213872_100114695 | 198 |
| 210 | 3300021361 | Ga0213872_10044143 | Ga0213872_100441434 | 198 |
| 211 | 3300021441 | Ga0213871_10002238 | Ga0213871_100022384 | 198 |
| 212 | 3300021441 | Ga0213871_10016351 | Ga0213871_100163512 | 198 |
| 213 | 3300021441 | Ga0213871_10039214 | Ga0213871_100392142 | 198 |
| 214 | 3300025284 | Ga0209130_1000053 | Ga0209130_1000053180 | 198 |
| 215 | 3300025299 | Ga0209256_1010723 | Ga0209256_10107234 | 198 |
| 216 | 3300025302 | Ga0207426_1000054 | Ga0207426_1000054348 | 198 |
| 217 | 3300025315 | Ga0207697_10001639 | Ga0207697_100016395 | 198 |
| 218 | 3300025885 | Ga0207653_10000023 | Ga0207653_1000002319 | 198 |
| 219 | 3300025893 | Ga0207682_10008990 | Ga0207682_100089903 | 198 |
| 220 | 3300025893 | Ga0207682_10019213 | Ga0207682_100192134 | 198 |
| 221 | 3300025899 | Ga0207642_10031738 | Ga0207642_100317381 | 198 |
| 222 | 3300025899 | Ga0207642_10675705 | Ga0207642_106757051 | 198 |
| 223 | 3300025901 | Ga0207688_10004795 | Ga0207688_100047954 | 198 |
| 224 | 3300025901 | Ga0207688_10005805 | Ga0207688_100058055 | 198 |
| 225 | 3300025901 | Ga0207688_10014735 | Ga0207688_100147353 | 198 |
| 226 | 3300025903 | Ga0207680_10027351 | Ga0207680_100273512 | 198 |
| 227 | 3300025903 | Ga0207680_10066938 | Ga0207680_100669382 | 198 |
| 228 | 3300025906 | Ga0207699_10106830 | Ga0207699_101068302 | 198 |
| 229 | 3300025907 | Ga0207645_10037618 | Ga0207645_100376183 | 198 |
| 230 | 3300025907 | Ga0207645_10108991 | Ga0207645_101089913 | 198 |
| 231 | 3300025908 | Ga0207643_10001683 | Ga0207643_1000168314 | 198 |
| 232 | 3300025908 | Ga0207643_10062752 | Ga0207643_100627523 | 198 |
| 233 | 3300025910 | Ga0207684_10068471 | Ga0207684_100684713 | 198 |
| 234 | 3300025911 | Ga0207654_10042260 | Ga0207654_100422602 | 198 |
| 235 | 3300025912 | Ga0207707_10030792 | Ga0207707_100307923 | 198 |
| 236 | 3300025912 | Ga0207707_10190148 | Ga0207707_101901482 | 198 |
| 237 | 3300025913 | Ga0207695_10000153 | Ga0207695_10000153192 | 198 |
| 238 | 3300025913 | Ga0207695_10135387 | Ga0207695_101353872 | 198 |
| 239 | 3300025915 | Ga0207693_10012249 | Ga0207693_100122498 | 198 |
| 240 | 3300025916 | Ga0207663_10056825 | Ga0207663_100568253 | 198 |
| 241 | 3300025918 | Ga0207662_10003446 | Ga0207662_100034464 | 198 |
| 242 | 3300025918 | Ga0207662_10103340 | Ga0207662_101033402 | 198 |
| 243 | 3300025920 | Ga0207649_10014544 | Ga0207649_100145443 | 198 |
| 244 | 3300025920 | Ga0207649_10036209 | Ga0207649_100362093 | 198 |
| 245 | 3300025920 | Ga0207649_10246453 | Ga0207649_102464532 | 198 |
| 246 | 3300025922 | Ga0207646_10320038 | Ga0207646_103200382 | 198 |
| 247 | 3300025922 | Ga0207646_10332313 | Ga0207646_103323132 | 198 |
| 248 | 3300025923 | Ga0207681_10019413 | Ga0207681_100194132 | 198 |
| 249 | 3300025923 | Ga0207681_10167583 | Ga0207681_101675832 | 198 |
| 250 | 3300025925 | Ga0207650_10008131 | Ga0207650_100081312 | 198 |
| 251 | 3300025925 | Ga0207650_10085746 | Ga0207650_100857463 | 198 |
| 252 | 3300025925 | Ga0207650_10388583 | Ga0207650_103885832 | 198 |
| 253 | 3300025926 | Ga0207659_10006063 | Ga0207659_100060636 | 198 |
| 254 | 3300025928 | Ga0207700_10088312 | Ga0207700_100883121 | 198 |
| 255 | 3300025929 | Ga0207664_10002101 | Ga0207664_100021014 | 198 |
| 256 | 3300025931 | Ga0207644_10107687 | Ga0207644_101076873 | 198 |
| 257 | 3300025931 | Ga0207644_10259818 | Ga0207644_102598182 | 198 |
| 258 | 3300025932 | Ga0207690_10347282 | Ga0207690_103472822 | 198 |
| 259 | 3300025933 | Ga0207706_10009687 | Ga0207706_100096873 | 198 |
| 260 | 3300025933 | Ga0207706_10095014 | Ga0207706_100950143 | 198 |
| 261 | 3300025933 | Ga0207706_10153532 | Ga0207706_101535322 | 198 |
| 262 | 3300025938 | Ga0207704_10047139 | Ga0207704_100471393 | 198 |
| 263 | 3300025938 | Ga0207704_10428768 | Ga0207704_104287682 | 198 |
| 264 | 3300025940 | Ga0207691_10039070 | Ga0207691_100390703 | 198 |
| 265 | 3300025941 | Ga0207711_10626491 | Ga0207711_106264911 | 198 |
| 266 | 3300025941 | Ga0207711_10818656 | Ga0207711_108186561 | 198 |
| 267 | 3300025942 | Ga0207689_10042422 | Ga0207689_100424222 | 198 |
| 268 | 3300025942 | Ga0207689_10059166 | Ga0207689_100591663 | 198 |
| 269 | 3300025942 | Ga0207689_10077279 | Ga0207689_100772792 | 198 |
| 270 | 3300025944 | Ga0207661_10009912 | Ga0207661_100099128 | 198 |
| 271 | 3300025945 | Ga0207679_10097760 | Ga0207679_100977603 | 198 |
| 272 | 3300025949 | Ga0207667_10027664 | Ga0207667_100276643 | 198 |
| 273 | 3300025949 | Ga0207667_10186258 | Ga0207667_101862582 | 198 |
| 274 | 3300025949 | Ga0207667_11026987 | Ga0207667_110269872 | 198 |
| 275 | 3300025960 | Ga0207651_10291606 | Ga0207651_102916062 | 198 |
| 276 | 3300025960 | Ga0207651_10745940 | Ga0207651_107459402 | 198 |
| 277 | 3300025961 | Ga0207712_10305108 | Ga0207712_103051082 | 198 |
| 278 | 3300025961 | Ga0207712_10465479 | Ga0207712_104654792 | 198 |
| 279 | 3300025961 | Ga0207712_10543335 | Ga0207712_105433351 | 198 |
| 280 | 3300025981 | Ga0207640_10006837 | Ga0207640_100068373 | 198 |
| 281 | 3300025981 | Ga0207640_10050156 | Ga0207640_100501563 | 198 |
| 282 | 3300025986 | Ga0207658_10124806 | Ga0207658_101248062 | 198 |
| 283 | 3300025986 | Ga0207658_10130409 | Ga0207658_101304092 | 198 |
| 284 | 3300026023 | Ga0207677_10107798 | Ga0207677_101077982 | 198 |
| 285 | 3300026023 | Ga0207677_10330166 | Ga0207677_103301662 | 198 |
| 286 | 3300026023 | Ga0207677_10912867 | Ga0207677_109128671 | 198 |
| 287 | 3300026035 | Ga0207703_10007939 | Ga0207703_100079393 | 198 |
| 288 | 3300026035 | Ga0207703_10055079 | Ga0207703_100550793 | 198 |
| 289 | 3300026035 | Ga0207703_10103630 | Ga0207703_101036302 | 198 |
| 290 | 3300026035 | Ga0207703_10134741 | Ga0207703_101347413 | 198 |
| 291 | 3300026035 | Ga0207703_10620937 | Ga0207703_106209372 | 198 |
| 292 | 3300026041 | Ga0207639_10000006 | Ga0207639_10000006330 | 198 |
| 293 | 3300026041 | Ga0207639_10163341 | Ga0207639_101633412 | 198 |
| 294 | 3300026067 | Ga0207678_10041390 | Ga0207678_100413905 | 198 |
| 295 | 3300026075 | Ga0207708_10002308 | Ga0207708_100023089 | 198 |
| 296 | 3300026075 | Ga0207708_10043165 | Ga0207708_100431652 | 198 |
| 297 | 3300026075 | Ga0207708_10331051 | Ga0207708_103310512 | 198 |
| 298 | 3300026078 | Ga0207702_10004232 | Ga0207702_100042326 | 198 |
| 299 | 3300026088 | Ga0207641_10003668 | Ga0207641_100036685 | 198 |
| 300 | 3300026089 | Ga0207648_10012064 | Ga0207648_100120643 | 198 |
| 301 | 3300026089 | Ga0207648_10151559 | Ga0207648_101515593 | 198 |
| 302 | 3300026095 | Ga0207676_10042974 | Ga0207676_100429744 | 198 |
| 303 | 3300026116 | Ga0207674_10004111 | Ga0207674_100041116 | 198 |
| 304 | 3300026118 | Ga0207675_100019782 | Ga0207675_1000197825 | 198 |
| 305 | 3300026118 | Ga0207675_100142983 | Ga0207675_1001429832 | 198 |
| 306 | 3300026121 | Ga0207683_10087059 | Ga0207683_100870593 | 198 |
| 307 | 3300026121 | Ga0207683_10106266 | Ga0207683_101062663 | 198 |
| 308 | 3300026121 | Ga0207683_10145905 | Ga0207683_101459053 | 198 |
| 309 | 3300026121 | Ga0207683_10732204 | Ga0207683_107322042 | 198 |
| 310 | 3300026142 | Ga0207698_10073719 | Ga0207698_100737193 | 198 |
| 311 | 3300027617 | Ga0210002_1026392 | Ga0210002_10263922 | 198 |
| 312 | 3300027907 | Ga0207428_10011427 | Ga0207428_100114278 | 198 |
| 313 | 3300028379 | Ga0268266_10116401 | Ga0268266_101164012 | 198 |
| 314 | 3300028380 | Ga0268265_10114812 | Ga0268265_101148122 | 198 |
| 315 | 3300028380 | Ga0268265_10187479 | Ga0268265_101874792 | 198 |
| 316 | 3300028381 | Ga0268264_10046622 | Ga0268264_100466224 | 198 |
| 317 | 3300028381 | Ga0268264_10156575 | Ga0268264_101565753 | 198 |
| 318 | 3300028381 | Ga0268264_10309708 | Ga0268264_103097083 | 198 |
| 319 | 3300028666 | Ga0265336_10003255 | Ga0265336_100032552 | 198 |
| 320 | 3300028800 | Ga0265338_10003361 | Ga0265338_1000336118 | 198 |
| 321 | 3300031090 | Ga0265760_10066543 | Ga0265760_100665431 | 198 |
| 322 | 3300031240 | Ga0265320_10070803 | Ga0265320_100708033 | 198 |
| 323 | 3300031241 | Ga0265325_10145092 | Ga0265325_101450922 | 198 |
| 324 | 3300031242 | Ga0265329_10026789 | Ga0265329_100267892 | 198 |
| 325 | 3300031250 | Ga0265331_10005346 | Ga0265331_100053465 | 198 |
| 326 | 3300031344 | Ga0265316_10005766 | Ga0265316_1000576611 | 198 |
| 327 | 3300031344 | Ga0265316_10017587 | Ga0265316_100175874 | 198 |
| 328 | 3300031456 | Ga0307513_10337123 | Ga0307513_103371232 | 198 |
| 329 | 3300031711 | Ga0265314_10111161 | Ga0265314_101111612 | 198 |
| 330 | 3300031712 | Ga0265342_10232486 | Ga0265342_102324862 | 198 |
| 331 | 3300035114 | Ga0373939_0221890 | Ga0373939_0221890_50_646 | 198 |
| 332 | 3300035691 | Ga0373931_0207712 | Ga0373931_0207712_527_1147 | 198 |
| 333 | 3300035691 | Ga0373931_0229585 | Ga0373931_0229585_253_849 | 198 |
| 334 | 3300039438 | Ga0436360_0059810 | Ga0436360_0059810_1584_2180 | 198 |
| 335 | 3300039438 | Ga0436360_0331514 | Ga0436360_0331514_1530_2132 | 198 |
| 336 | 3300039438 | Ga0436360_1001917 | Ga0436360_1001917_1754_2398 | 198 |
| 337 | 3300039438 | Ga0436360_1017485 | Ga0436360_1017485_2417_3016 | 198 |
| 338 | 3300039447 | Ga0436361_0014707 | Ga0436361_0014707_3161_3760 | 198 |
| 339 | 3300039447 | Ga0436361_0278206 | Ga0436361_0278206_5218_5862 | 198 |
| 340 | 3300039453 | Ga0436362_0047029 | Ga0436362_0047029_4524_5120 | 198 |
| 341 | 3300039453 | Ga0436362_0914181 | Ga0436362_0914181_641_1297 | 198 |
| 342 | 3300039453 | Ga0436362_0940395 | Ga0436362_0940395_684_1328 | 198 |
| 343 | 3300042436 | Ga0439435_0097237 | Ga0439435_0097237_98_694 | 198 |
| 344 | 3300044694 | Ga0466963_0663756 | Ga0466963_0663756_46_642 | 198 |
| 345 | 3300044712 | Ga0453684_0059673 | Ga0453684_0059673_4083_4682 | 198 |
| 346 | 3300045051 | Ga0451576_0015319 | Ga0451576_0015319_6160_6756 | 198 |
| 347 | 3300045051 | Ga0451576_0033174 | Ga0451576_0033174_4630_5226 | 198 |
| 348 | 3300045976 | Ga0466967_0624245 | Ga0466967_0624245_378_986 | 198 |
| 349 | 3300046455 | Ga0495603_0042072 | Ga0495603_0042072_246_845 | 198 |
| 350 | 3300046459 | Ga0495629_0002437 | Ga0495629_0002437_9376_9975 | 198 |
| 351 | 3300046461 | Ga0495641_0249466 | Ga0495641_0249466_117_713 | 198 |
| 352 | 3300046499 | Ga0495594_0142996 | Ga0495594_0142996_26_625 | 198 |
| 353 | 3300046506 | Ga0495583_0004658 | Ga0495583_0004658_7504_8103 | 198 |
| 354 | 3300046516 | Ga0495628_0396464 | Ga0495628_0396464_104_703 | 198 |
| 355 | 3300046543 | Ga0495645_0393936 | Ga0495645_0393936_11_610 | 198 |
| 356 | 3300046557 | Ga0495622_0088661 | Ga0495622_0088661_665_1264 | 198 |
| 357 | 3300046642 | Ga0495634_0090683 | Ga0495634_0090683_1233_1829 | 198 |
| 358 | 3300046660 | Ga0495625_0019551 | Ga0495625_0019551_328_927 | 198 |
| 359 | 3300046681 | Ga0495647_0158952 | Ga0495647_0158952_197_796 | 198 |
| 360 | 3300046683 | Ga0495658_0113690 | Ga0495658_0113690_23_619 | 198 |
| 361 | 3300046809 | Ga0495600_0088126 | Ga0495600_0088126_426_1025 | 198 |
| 362 | 3300047321 | Ga0495676_0123658 | Ga0495676_0123658_694_1293 | 198 |
| 363 | 3300047446 | Ga0495679_012794 | Ga0495679_012794_645_1253 | 198 |
| 364 | 3300048089 | Ga0495614_0330718 | Ga0495614_0330718_67_663 | 198 |
| 365 | 3300048904 | Ga0496101_0106904 | Ga0496101_0106904_1154_1750 | 198 |
| 366 | 3300048907 | Ga0496104_0085572 | Ga0496104_0085572_241_837 | 198 |
| 367 | 3300048907 | Ga0496104_0337212 | Ga0496104_0337212_95_691 | 198 |
| 368 | 3300048908 | Ga0496105_0022381 | Ga0496105_0022381_1736_2332 | 198 |
| 369 | 3300048911 | Ga0496108_0131925 | Ga0496108_0131925_1226_1822 | 198 |
| 370 | 3300048911 | Ga0496108_0284054 | Ga0496108_0284054_181_777 | 198 |
| 371 | 3300048912 | Ga0496109_0002574 | Ga0496109_0002574_5929_6525 | 198 |
| 372 | 3300048913 | Ga0496110_0026021 | Ga0496110_0026021_2184_2780 | 198 |
| 373 | 3300048913 | Ga0496110_0375946 | Ga0496110_0375946_156_752 | 198 |
| 374 | 3300048914 | Ga0496111_0005431 | Ga0496111_0005431_4778_5374 | 198 |
| 375 | 3300048915 | Ga0496112_0567900 | Ga0496112_0567900_127_723 | 198 |
| 376 | 3300048917 | Ga0496114_0255762 | Ga0496114_0255762_743_1339 | 198 |
| 377 | 3300048924 | Ga0496121_0340411 | Ga0496121_0340411_373_972 | 198 |
| 378 | 3300049570 | Ga0501033_0000008 | Ga0501033_0000008_252514_253110 | 198 |
| 379 | 3300049574 | Ga0501038_0014160 | Ga0501038_0014160_5840_6436 | 198 |
| 380 | 3300049584 | Ga0501068_0350740 | Ga0501068_0350740_96_692 | 198 |
| 381 | 3300049585 | Ga0501069_0063056 | Ga0501069_0063056_1257_1856 | 198 |
| 382 | 3300049586 | Ga0501070_0018902 | Ga0501070_0018902_3746_4345 | 198 |
| 383 | 3300049587 | Ga0501071_0306054 | Ga0501071_0306054_84_683 | 198 |
| 384 | 3300049588 | Ga0501072_0143286 | Ga0501072_0143286_186_785 | 198 |
| 385 | 3300049592 | Ga0501076_0295391 | Ga0501076_0295391_101_697 | 198 |
| 386 | 3300049742 | Ga0501080_0157507 | Ga0501080_0157507_353_952 | 198 |
| 387 | 3300049742 | Ga0501080_0365605 | Ga0501080_0365605_32_628 | 198 |
| 388 | 3300049743 | Ga0501081_0149767 | Ga0501081_0149767_582_1181 | 198 |
| 389 | 3300049743 | Ga0501081_0235475 | Ga0501081_0235475_609_1205 | 198 |
| 390 | 3300049744 | Ga0501083_0139456 | Ga0501083_0139456_348_962 | 198 |
| 391 | 3300049824 | Ga0501045_0342398 | Ga0501045_0342398_111_707 | 198 |
| 392 | 3300050507 | nmdc:mga05p37_265794_c1 | nmdc:mga05p37_265794_c1_259_855 | 198 |
| 393 | 3300050508 | nmdc:mga09592_199378_c1 | nmdc:mga09592_199378_c1_729_1325 | 198 |
| 394 | 3300050509 | nmdc:mga0qj67_26336_c1 | nmdc:mga0qj67_26336_c1_308_928 | 198 |
| 395 | 3300050510 | nmdc:mga06r32_224_c1 | nmdc:mga06r32_224_c1_18005_18625 | 198 |
| 396 | 3300050511 | nmdc:mga08y16_423807_c1 | nmdc:mga08y16_423807_c1_409_1005 | 198 |
| 397 | 3300050511 | nmdc:mga08y16_521228_c1 | nmdc:mga08y16_521228_c1_376_972 | 198 |
| 398 | 3300050511 | nmdc:mga08y16_66238_c1 | nmdc:mga08y16_66238_c1_1595_2191 | 198 |
| 399 | 3300050512 | nmdc:mga0n895_17292_c1 | nmdc:mga0n895_17292_c1_4328_4924 | 198 |
| 400 | 3300050515 | nmdc:mga0a205_9911_c1 | nmdc:mga0a205_9911_c1_14_610 | 198 |
| 401 | 3300053083 | Ga0495655_0000438 | Ga0495655_0000438_1056_1655 | 198 |
| 402 | 3300053094 | Ga0500566_0266549 | Ga0500566_0266549_215_814 | 198 |
| 403 | 3300053104 | Ga0500556_0106869 | Ga0500556_0106869_437_1033 | 198 |
| 404 | 3300053111 | Ga0500572_093629 | Ga0500572_093629_74_673 | 198 |
| 405 | 3300053122 | Ga0500608_062124 | Ga0500608_062124_885_1484 | 198 |
| 406 | 3300053125 | Ga0500618_000735 | Ga0500618_000735_1790_2389 | 198 |
| 407 | 3300053148 | Ga0500590_000679 | Ga0500590_000679_6290_6889 | 198 |
| 408 | 3300053163 | Ga0500639_176681 | Ga0500639_176681_149_748 | 198 |
| 409 | 3300053177 | Ga0500636_0222237 | Ga0500636_0222237_52_651 | 198 |
| 410 | 3300060353 | Ga0501082_0057343 | Ga0501082_0057343_1330_1929 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1x94-assembly1.cif.gz_A | crystal structure of a hypothetical protein | 0.851 | 4 | 183 |
| 3bjz-assembly1.cif.gz_D | crystal structure of pseudomonas aeruginosa phosphoheptose isomerase | 0.8465 | 4 | 183 |
| 3bjz-assembly1.cif.gz_C | crystal structure of pseudomonas aeruginosa phosphoheptose isomerase | 0.8438 | 4 | 183 |
| 5i01-assembly1.cif.gz_C | structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae | 0.8414 | 4 | 183 |
| 2i2w-assembly3.cif.gz_B | crystal structure of escherichia coli phosphoheptose isomerase | 0.8382 | 4 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5i01C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8414 | 4 | 183 | 3.40.50.10490 |
| 2i2wB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8382 | 4 | 183 | 3.40.50.10490 |
| af_P0ACS7_105_289_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8302 | 8 | 183 | 3.40.50.10490 |
| 5vhuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8221 | 4 | 183 | 3.40.50.10490 |
| 3trjC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8099 | 3 | 183 | 3.40.50.10490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A212KGQ9-F1-model_v4 | Sugar isomerase family protein | 0.9825 | 87 | 196 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A7V8T0J9-F1-model_v4 | Sugar isomerase | 0.9692 | 88 | 194 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A2V5XBY7-F1-model_v4 | Sugar isomerase | 0.9662 | 98 | 196 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A2V6RC29-F1-model_v4 | Sugar isomerase | 0.9609 | 104 | 196 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A7V8T0J9-F1-model_v4 | Sugar isomerase | 0.9604 | 88 | 194 |
GO:0016853
GO:0097367 GO:1901135 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar