F435384

General Info

Members Datasets Scaffolds Average Seq Length
403 199 403 150

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10008234|Ga0157373_100082346
Length 173
Sequence VRPRFKPQRREEVLATKTHKTQKEIVARVSRFLSHYLPLIVWLAFISFASSDEFNAGNTSRIIGPLVLWLFPGTSPDTLAVVHLTTRKIAHFTEYAILGFLAARAFRTSPQPAIRRRWFLICAALIVVYALMDEYHQSFVPSRTASIYDSMIDIAAGLTALLIVRKRAADFRG

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
166 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
167 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
168 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
169 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
170 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
171 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
172 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
175 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
176 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
177 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
178 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
179 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
180 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
181 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
184 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
185 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
186 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
187 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
188 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
189 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
190 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
191 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
192 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
193 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
194 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
195 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
196 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.23
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000060 3300002459 Bacteria 61937
2 JGI25406J46586_10007886 3300003203 Bacteria 4842
3 Ga0065712_10071747 3300005290 Bacteria 5080
4 Ga0065715_10007306 3300005293 Bacteria 3645
5 Ga0065715_10124639 3300005293 Bacteria 2149
6 Ga0065715_10200290 3300005293 Bacteria 1351
7 Ga0065707_10019004 3300005295 Bacteria 2307
8 Ga0065707_10117404 3300005295 Unclassified 2212
9 Ga0070676_10123758 3300005328 Unclassified 1627
10 Ga0070676_10317425 3300005328 Unclassified 1061
11 Ga0070690_100021743 3300005330 Bacteria 3919
12 Ga0070690_100379854 3300005330 Bacteria 1033
13 Ga0070670_100000932 3300005331 Bacteria 22941
14 Ga0070670_100068473 3300005331 Bacteria 3046
15 Ga0070670_100398305 3300005331 Bacteria 1215
16 Ga0070670_101304328 3300005331 Unclassified 665
17 Ga0068869_100301046 3300005334 Bacteria 1295
18 Ga0068869_100739930 3300005334 Bacteria 841
19 Ga0068869_100824453 3300005334 Bacteria 799
20 Ga0070680_100347517 3300005336 Bacteria 1261
21 Ga0070682_100870245 3300005337 Bacteria 738
22 Ga0070682_101541702 3300005337 Unclassified 573
23 Ga0068868_100004720 3300005338 Bacteria 9572
24 Ga0070689_100045765 3300005340 Bacteria 3370
25 Ga0070689_101459913 3300005340 Bacteria 619
26 Ga0070661_100262853 3300005344 Bacteria 1335
27 Ga0070661_101185534 3300005344 Bacteria 638
28 Ga0070692_10063717 3300005345 Bacteria 1948
29 Ga0070692_10279058 3300005345 Unclassified 1012
30 Ga0070692_10415311 3300005345 Bacteria 853
31 Ga0070668_100416297 3300005347 Unclassified 1150
32 Ga0070669_100007248 3300005353 Bacteria 7957
33 Ga0070669_100080228 3300005353 Bacteria 2428
34 Ga0070669_100126450 3300005353 Bacteria 1956
35 Ga0070675_100050807 3300005354 Bacteria 3405
36 Ga0070675_100071383 3300005354 Bacteria 2880
37 Ga0070671_100010320 3300005355 Bacteria 7492
38 Ga0070671_100952447 3300005355 Bacteria 751
39 Ga0070673_100055195 3300005364 Bacteria 3129
40 Ga0070673_101071745 3300005364 Bacteria 752
41 Ga0070688_100020534 3300005365 Bacteria 3841
42 Ga0070659_100120218 3300005366 Bacteria 2127
43 Ga0070701_10108640 3300005438 Bacteria 1547
44 Ga0070705_100518735 3300005440 Unclassified 908
45 Ga0070700_100000055 3300005441 Bacteria 83561
46 Ga0070700_100057115 3300005441 Bacteria 2448
47 Ga0070700_100060283 3300005441 Bacteria 2391
48 Ga0070700_100611014 3300005441 Unclassified 855
49 Ga0070694_100026008 3300005444 Bacteria 3791
50 Ga0070694_100058179 3300005444 Bacteria 2629
51 Ga0070708_100277170 3300005445 Bacteria 1578
52 Ga0070708_101910907 3300005445 Bacteria 550
53 Ga0070678_100007229 3300005456 Bacteria 6572
54 Ga0070662_100247866 3300005457 Bacteria 1431
55 Ga0070681_10023706 3300005458 Bacteria 6177
56 Ga0068867_100830169 3300005459 Bacteria 826
57 Ga0068867_101511131 3300005459 Bacteria 626
58 Ga0070685_10006136 3300005466 Bacteria 6119
59 Ga0070685_10295002 3300005466 Bacteria 1091
60 Ga0070706_100039572 3300005467 Bacteria 4353
61 Ga0070707_100092986 3300005468 Bacteria 2919
62 Ga0070698_100013093 3300005471 Bacteria 8781
63 Ga0070698_100065856 3300005471 Bacteria 3648
64 Ga0070699_100001863 3300005518 Bacteria 19105
65 Ga0070679_100203070 3300005530 Bacteria 1947
66 Ga0070697_100061571 3300005536 Bacteria 3061
67 Ga0068853_100176823 3300005539 Bacteria 1934
68 Ga0068853_101467821 3300005539 Unclassified 660
69 Ga0070686_100006666 3300005544 Bacteria 6430
70 Ga0070686_101360330 3300005544 Unclassified 595
71 Ga0070695_100040384 3300005545 Bacteria 2954
72 Ga0070695_100043315 3300005545 Bacteria 2862
73 Ga0070695_100787951 3300005545 Unclassified 761
74 Ga0070696_100034951 3300005546 Bacteria 3459
75 Ga0070696_100143363 3300005546 Bacteria 1748
76 Ga0070696_100351326 3300005546 Unclassified 1142
77 Ga0070696_100431462 3300005546 Unclassified 1037
78 Ga0070693_100024669 3300005547 Bacteria 3227
79 Ga0070693_100228209 3300005547 Bacteria 1224
80 Ga0070693_100504314 3300005547 Bacteria 859
81 Ga0070704_100056371 3300005549 Bacteria 2790
82 Ga0070704_101046808 3300005549 Unclassified 740
83 Ga0070664_100041587 3300005564 Bacteria 3879
84 Ga0068857_100748854 3300005577 Bacteria 930
85 Ga0068854_100143337 3300005578 Bacteria 1835
86 Ga0068854_100258314 3300005578 Bacteria 1394
87 Ga0068854_100446978 3300005578 Bacteria 1079
88 Ga0068854_100600140 3300005578 Bacteria 940
89 Ga0070702_100007138 3300005615 Bacteria 5335
90 Ga0070702_100542785 3300005615 Bacteria 861
91 Ga0070702_100766720 3300005615 Unclassified 742
92 Ga0068852_100079283 3300005616 Bacteria 2909
93 Ga0068852_100371112 3300005616 Unclassified 1402
94 Ga0068852_100564301 3300005616 Bacteria 1140
95 Ga0068859_100017815 3300005617 Bacteria 7140
96 Ga0068859_100027075 3300005617 Bacteria 5751
97 Ga0068859_100055260 3300005617 Bacteria 3995
98 Ga0068859_100153308 3300005617 Bacteria 2380
99 Ga0068859_100173385 3300005617 Bacteria 2239
100 Ga0068859_100238623 3300005617 Bacteria 1907
101 Ga0068859_100352057 3300005617 Bacteria 1567
102 Ga0068859_100576023 3300005617 Unclassified 1219
103 Ga0068859_101354823 3300005617 Bacteria 785
104 Ga0068864_100252299 3300005618 Unclassified 1638
105 Ga0068864_100508914 3300005618 Unclassified 1159
106 Ga0068864_100541493 3300005618 Bacteria 1124
107 Ga0068864_100766860 3300005618 Bacteria 946
108 Ga0068864_101076007 3300005618 Bacteria 800
109 Ga0068866_10003064 3300005718 Bacteria 6895
110 Ga0068861_100032522 3300005719 Bacteria 3840
111 Ga0068870_10003055 3300005840 Bacteria 7052
112 Ga0068870_10034587 3300005840 Bacteria 2586
113 Ga0068870_10072444 3300005840 Bacteria 1882
114 Ga0068863_100004161 3300005841 Bacteria 14288
115 Ga0068863_100173865 3300005841 Bacteria 2066
116 Ga0068863_100276678 3300005841 Bacteria 1626
117 Ga0068863_100299271 3300005841 Unclassified 1560
118 Ga0068863_100502024 3300005841 Bacteria 1195
119 Ga0068863_100972643 3300005841 Bacteria 851
120 Ga0068858_100094538 3300005842 Bacteria 2784
121 Ga0068858_100112773 3300005842 Bacteria 2539
122 Ga0068858_100149863 3300005842 Bacteria 2192
123 Ga0068858_100208692 3300005842 Bacteria 1848
124 Ga0068858_100362933 3300005842 Bacteria 1388
125 Ga0068858_100401096 3300005842 Bacteria 1318
126 Ga0068858_100586629 3300005842 Bacteria 1080
127 Ga0068858_100606974 3300005842 Bacteria 1062
128 Ga0068860_100055038 3300005843 Bacteria 3781
129 Ga0068860_100216362 3300005843 Bacteria 1859
130 Ga0068860_100282488 3300005843 Bacteria 1622
131 Ga0068860_100939924 3300005843 Bacteria 881
132 Ga0068862_100006743 3300005844 Bacteria 9521
133 Ga0068862_100062403 3300005844 Bacteria 3205
134 Ga0081539_10000279 3300005985 Bacteria 115766
135 Ga0097621_100028856 3300006237 Bacteria 4377
136 Ga0068871_100002633 3300006358 Bacteria 12253
137 Ga0075433_10039460 3300006852 Bacteria 4083
138 Ga0075434_100589700 3300006871 Bacteria 1131
139 Ga0075434_101509268 3300006871 Unclassified 681
140 Ga0068865_100045296 3300006881 Bacteria 3015
141 Ga0097620_100017815 3300006931 Bacteria 7140
142 Ga0097620_100027076 3300006931 Bacteria 5751
143 Ga0097620_100055259 3300006931 Bacteria 3995
144 Ga0097620_100061445 3300006931 Bacteria 3786
145 Ga0097620_100153295 3300006931 Bacteria 2380
146 Ga0097620_100173377 3300006931 Bacteria 2239
147 Ga0097620_100238628 3300006931 Bacteria 1907
148 Ga0097620_100352067 3300006931 Bacteria 1567
149 Ga0097620_100575980 3300006931 Unclassified 1219
150 Ga0097620_101354832 3300006931 Bacteria 785
151 Ga0105251_10260600 3300009011 Bacteria 782
152 Ga0105250_10020664 3300009092 Bacteria 2659
153 Ga0105240_10476278 3300009093 Unclassified 1392
154 Ga0105240_10622687 3300009093 Bacteria 1186
155 Ga0105240_11624661 3300009093 Unclassified 676
156 Ga0105245_10014548 3300009098 Bacteria 6850
157 Ga0105245_10269750 3300009098 Bacteria 1659
158 Ga0105245_10271497 3300009098 Bacteria 1654
159 Ga0105245_10472977 3300009098 Unclassified 1265
160 Ga0105245_10722007 3300009098 Bacteria 1031
161 Ga0105247_10000358 3300009101 Bacteria 39248
162 Ga0105247_10052082 3300009101 Bacteria 2523
163 Ga0105247_10221128 3300009101 Bacteria 1282
164 Ga0105247_10617727 3300009101 Bacteria 806
165 Ga0114129_10581806 3300009147 Bacteria 1453
166 Ga0105243_10001654 3300009148 Bacteria 19301
167 Ga0105243_10212835 3300009148 Bacteria 1703
168 Ga0105243_10448774 3300009148 Bacteria 1209
169 Ga0105243_11144856 3300009148 Bacteria 788
170 Ga0105243_11462910 3300009148 Bacteria 706
171 Ga0105243_12436090 3300009148 Bacteria 562
172 Ga0105241_10267084 3300009174 Bacteria 1456
173 Ga0105241_10416848 3300009174 Bacteria 1181
174 Ga0105241_10511051 3300009174 Unclassified 1073
175 Ga0105241_11088620 3300009174 Bacteria 752
176 Ga0105241_11174499 3300009174 Bacteria 726
177 Ga0105241_11852209 3300009174 Unclassified 590
178 Ga0105242_10003374 3300009176 Bacteria 12429
179 Ga0105242_10854743 3300009176 Bacteria 906
180 Ga0105242_11022355 3300009176 Bacteria 836
181 Ga0105248_10003923 3300009177 Bacteria 16445
182 Ga0105248_10101966 3300009177 Bacteria 3235
183 Ga0105248_10203666 3300009177 Bacteria 2230
184 Ga0105248_10220169 3300009177 Bacteria 2137
185 Ga0105248_10844580 3300009177 Bacteria 1034
186 Ga0105248_11238122 3300009177 Bacteria 844
187 Ga0105237_10461802 3300009545 Unclassified 1276
188 Ga0105237_10590049 3300009545 Bacteria 1118
189 Ga0105237_11718246 3300009545 Bacteria 635
190 Ga0105238_10004864 3300009551 Bacteria 13288
191 Ga0105238_10106746 3300009551 Bacteria 2782
192 Ga0105238_10498644 3300009551 Bacteria 1218
193 Ga0105249_10004981 3300009553 Bacteria 11457
194 Ga0105249_10820441 3300009553 Bacteria 995
195 Ga0105249_11134050 3300009553 Bacteria 852
196 Ga0105239_10098219 3300010375 Bacteria 3237
197 Ga0105239_10664159 3300010375 Bacteria 1191
198 Ga0105239_10698411 3300010375 Bacteria 1160
199 Ga0105239_10902335 3300010375 Bacteria 1014
200 Ga0105239_12613608 3300010375 Unclassified 589
201 Ga0105246_10181006 3300011119 Bacteria 1623
202 Ga0105246_10207257 3300011119 Bacteria 1528
203 Ga0105246_10270977 3300011119 Bacteria 1357
204 Ga0157373_10008234 3300013100 Bacteria 7750
205 Ga0157373_10026160 3300013100 Bacteria 4217
206 Ga0157371_10885293 3300013102 Unclassified 676
207 Ga0157374_10309520 3300013296 Bacteria 1564
208 Ga0157378_10006520 3300013297 Bacteria 10203
209 Ga0157378_10677872 3300013297 Bacteria 1049
210 Ga0157378_11025033 3300013297 Bacteria 860
211 Ga0163162_10179151 3300013306 Bacteria 2245
212 Ga0163162_10759119 3300013306 Bacteria 1089
213 Ga0163162_11546106 3300013306 Bacteria 756
214 Ga0163162_12090585 3300013306 Bacteria 649
215 Ga0163162_12434435 3300013306 Unclassified 602
216 Ga0157372_10252833 3300013307 Bacteria 2046
217 Ga0157372_11196502 3300013307 Unclassified 878
218 Ga0157375_10009615 3300013308 Bacteria 8495
219 Ga0157375_10844627 3300013308 Bacteria 1062
220 Ga0163163_10000984 3300014325 Bacteria 24168
221 Ga0163163_10029217 3300014325 Bacteria 5302
222 Ga0163163_10393788 3300014325 Unclassified 1443
223 Ga0163163_10626994 3300014325 Bacteria 1139
224 Ga0157380_10389097 3300014326 Unclassified 1319
225 Ga0157380_10422770 3300014326 Bacteria 1271
226 Ga0157377_10017831 3300014745 Unclassified 3680
227 Ga0157377_10771564 3300014745 Bacteria 706
228 Ga0157379_10050275 3300014968 Bacteria 3721
229 Ga0157379_10406067 3300014968 Bacteria 1253
230 Ga0157379_10544879 3300014968 Bacteria 1079
231 Ga0157379_11132246 3300014968 Bacteria 751
232 Ga0157379_11248529 3300014968 Unclassified 716
233 Ga0157379_11473240 3300014968 Unclassified 661
234 Ga0157376_10010339 3300014969 Bacteria 6819
235 Ga0163161_10625089 3300017792 Unclassified 890
236 Ga0207697_10005134 3300025315 Bacteria 6124
237 Ga0207642_10032500 3300025899 Bacteria 2198
238 Ga0207710_10019193 3300025900 Bacteria 2916
239 Ga0207710_10073747 3300025900 Bacteria 1570
240 Ga0207710_10139588 3300025900 Bacteria 1169
241 Ga0207710_10297630 3300025900 Bacteria 815
242 Ga0207647_10223823 3300025904 Bacteria 1084
243 Ga0207643_10010907 3300025908 Bacteria 4900
244 Ga0207684_10000023 3300025910 Bacteria 334838
245 Ga0207684_10051582 3300025910 Bacteria 3491
246 Ga0207654_10079404 3300025911 Bacteria 1971
247 Ga0207707_10231384 3300025912 Bacteria 1608
248 Ga0207671_10093653 3300025914 Bacteria 2266
249 Ga0207662_10006238 3300025918 Bacteria 6418
250 Ga0207662_10030662 3300025918 Unclassified 3122
251 Ga0207652_10122547 3300025921 Bacteria 2314
252 Ga0207646_10222169 3300025922 Bacteria 1706
253 Ga0207646_11370309 3300025922 Unclassified 616
254 Ga0207681_10004345 3300025923 Bacteria 8745
255 Ga0207681_10474374 3300025923 Unclassified 1021
256 Ga0207694_10006258 3300025924 Bacteria 9089
257 Ga0207650_10000001 3300025925 Bacteria 1545726
258 Ga0207650_10122521 3300025925 Bacteria 2026
259 Ga0207650_10257135 3300025925 Bacteria 1415
260 Ga0207650_10805527 3300025925 Unclassified 796
261 Ga0207659_10073862 3300025926 Bacteria 2498
262 Ga0207659_10199095 3300025926 Bacteria 1598
263 Ga0207687_10503329 3300025927 Unclassified 1011
264 Ga0207687_10657027 3300025927 Bacteria 887
265 Ga0207687_10827673 3300025927 Bacteria 790
266 Ga0207644_10129895 3300025931 Bacteria 1927
267 Ga0207644_10822410 3300025931 Bacteria 777
268 Ga0207690_10114657 3300025932 Bacteria 1946
269 Ga0207706_10156737 3300025933 Bacteria 2002
270 Ga0207686_10033535 3300025934 Bacteria 3066
271 Ga0207709_10130693 3300025935 Bacteria 1711
272 Ga0207704_10011612 3300025938 Bacteria 4343
273 Ga0207704_10436267 3300025938 Bacteria 1042
274 Ga0207691_10002754 3300025940 Bacteria 17133
275 Ga0207691_10237646 3300025940 Bacteria 1576
276 Ga0207711_10019725 3300025941 Bacteria 5616
277 Ga0207711_10044135 3300025941 Bacteria 3805
278 Ga0207711_10093334 3300025941 Unclassified 2651
279 Ga0207711_11197688 3300025941 Unclassified 701
280 Ga0207689_10002753 3300025942 Bacteria 16258
281 Ga0207679_10189544 3300025945 Bacteria 1708
282 Ga0207679_11518931 3300025945 Bacteria 614
283 Ga0207651_10342068 3300025960 Bacteria 1257
284 Ga0207712_10001743 3300025961 Bacteria 14543
285 Ga0207712_10142433 3300025961 Bacteria 1842
286 Ga0207640_10152202 3300025981 Bacteria 1701
287 Ga0207640_11028602 3300025981 Bacteria 726
288 Ga0207703_10050574 3300026035 Bacteria 3365
289 Ga0207703_10128906 3300026035 Bacteria 2182
290 Ga0207703_10479351 3300026035 Bacteria 1166
291 Ga0207703_11191994 3300026035 Bacteria 732
292 Ga0207639_10617748 3300026041 Bacteria 1000
293 Ga0207639_11758961 3300026041 Bacteria 580
294 Ga0207708_10003805 3300026075 Bacteria 11125
295 Ga0207708_10041895 3300026075 Bacteria 3490
296 Ga0207708_10087624 3300026075 Bacteria 2397
297 Ga0207708_10094264 3300026075 Bacteria 2311
298 Ga0207641_10102846 3300026088 Unclassified 2520
299 Ga0207641_10547815 3300026088 Bacteria 1128
300 Ga0207648_10275076 3300026089 Bacteria 1505
301 Ga0207648_11218327 3300026089 Bacteria 707
302 Ga0207676_10005333 3300026095 Bacteria 9104
303 Ga0207676_10137641 3300026095 Bacteria 2086
304 Ga0207676_10268018 3300026095 Unclassified 1545
305 Ga0207676_10607794 3300026095 Bacteria 1051
306 Ga0207676_10729332 3300026095 Bacteria 962
307 Ga0207674_10032493 3300026116 Bacteria 5474
308 Ga0207674_10139219 3300026116 Bacteria 2387
309 Ga0207674_10407725 3300026116 Bacteria 1313
310 Ga0207674_11043140 3300026116 Bacteria 787
311 Ga0207675_100004243 3300026118 Bacteria 13862
312 Ga0207675_100083031 3300026118 Bacteria 3005
313 Ga0207675_100608903 3300026118 Bacteria 1096
314 Ga0207675_100727268 3300026118 Bacteria 1003
315 Ga0207683_10092090 3300026121 Bacteria 2701
316 Ga0207698_10166832 3300026142 Bacteria 1933
317 Ga0207698_10248234 3300026142 Bacteria 1627
318 Ga0207698_10458334 3300026142 Bacteria 1232
319 Ga0268265_10338336 3300028380 Bacteria 1369
320 Ga0268265_11292112 3300028380 Unclassified 729
321 Ga0268265_11357166 3300028380 Unclassified 712
322 Ga0268264_10054592 3300028381 Bacteria 3337
323 Ga0268264_10365644 3300028381 Bacteria 1377
324 Ga0268264_10597435 3300028381 Bacteria 1087
325 Ga0268264_11136637 3300028381 Bacteria 790
326 Ga0268264_11348581 3300028381 Bacteria 724
327 Ga0307408_100063768 3300031548 Bacteria 2697
328 Ga0307405_10818642 3300031731 Unclassified 781
329 Ga0307412_10178253 3300031911 Unclassified 1595
330 Ga0307409_100050818 3300031995 Bacteria 3169
331 Ga0307416_100045524 3300032002 Unclassified 3455
332 Ga0307414_10116723 3300032004 Unclassified 2044
333 Ga0307411_10029006 3300032005 Unclassified 3373
334 Ga0307415_100069166 3300032126 Bacteria 2474
335 Ga0373939_0115660 3300035114 Bacteria 940
336 Ga0373941_0089508 3300035115 Bacteria 1054
337 Ga0373942_0004270 3300035207 Bacteria 3327
338 Ga0373931_0617237 3300035691 Unclassified 710
339 Ga0395900_0354487 3300037418 Bacteria 1440
340 Ga0395898_0050866 3300037466 Bacteria 4054
341 Ga0395901_0084926 3300038443 Bacteria 3309
342 Ga0395901_0151693 3300038443 Bacteria 2435
343 Ga0395901_0355359 3300038443 Bacteria 1512
344 Ga0242420_000401 3300038996 Bacteria 4813
345 Ga0439448_0043780 3300042005 Bacteria 1454
346 Ga0439458_0000311 3300042157 Bacteria 12105
347 Ga0451576_0413802 3300045051 Bacteria 1414
348 Ga0495669_0086568 3300046684 Unclassified 1443
349 Ga0496104_1278645 3300048907 Bacteria 637
350 Ga0496106_0045690 3300048909 Bacteria 3290
351 Ga0496106_0160312 3300048909 Bacteria 1779
352 Ga0496106_0194570 3300048909 Bacteria 1613
353 Ga0496107_0116231 3300048910 Bacteria 1969
354 Ga0496108_0057804 3300048911 Bacteria 3259
355 Ga0496109_0613768 3300048912 Bacteria 1024
356 Ga0496110_0109878 3300048913 Bacteria 2476
357 Ga0496111_0462456 3300048914 Bacteria 936
358 Ga0496112_0113061 3300048915 Bacteria 2686
359 Ga0496112_0716552 3300048915 Bacteria 928
360 Ga0496112_0904046 3300048915 Bacteria 805
361 Ga0496113_0056817 3300048916 Bacteria 2940
362 Ga0501292_023134 3300049515 Bacteria 1014
363 Ga0501292_046468 3300049515 Unclassified 760
364 Ga0501294_023647 3300049517 Bacteria 681
365 Ga0501295_026626 3300049518 Bacteria 1108
366 Ga0501296_003115 3300049519 Bacteria 1761
367 Ga0501297_000940 3300049520 Bacteria 2629
368 Ga0501298_000392 3300049521 Bacteria 5957
369 Ga0501298_005670 3300049521 Bacteria 2013
370 Ga0501300_017814 3300049523 Bacteria 1037
371 Ga0501303_006133 3300049526 Bacteria 1042
372 Ga0501038_0000710 3300049574 Bacteria 29744
373 Ga0501202_007957 3300049652 Bacteria 1925
374 Ga0501202_080463 3300049652 Bacteria 764
375 Ga0501206_023703 3300049653 Unclassified 886
376 Ga0501206_068338 3300049653 Unclassified 596
377 Ga0501207_027227 3300049654 Bacteria 946
378 Ga0501208_039122 3300049655 Unclassified 870
379 Ga0501216_028338 3300049660 Bacteria 1020
380 Ga0501217_036582 3300049661 Bacteria 1233
381 Ga0501223_021204 3300049663 Bacteria 1271
382 Ga0501223_044632 3300049663 Unclassified 860
383 Ga0501224_018282 3300049664 Bacteria 1044
384 Ga0501233_004453 3300049668 Bacteria 2569
385 Ga0501233_016347 3300049668 Bacteria 1538
386 Ga0501235_001682 3300049669 Bacteria 4742
387 Ga0501238_034690 3300049671 Unclassified 734
388 Ga0501240_026872 3300049673 Bacteria 901
389 Ga0501243_011059 3300049675 Bacteria 1413
390 Ga0501243_046311 3300049675 Unclassified 775
391 Ga0501249_025313 3300049679 Bacteria 1309
392 Ga0501253_051304 3300049683 Unclassified 865
393 Ga0501261_010572 3300049690 Bacteria 1218
394 Ga0501221_015198 3300049704 Bacteria 1441
395 Ga0501225_0008482 3300049705 Bacteria 2948
396 Ga0501268_050666 3300049765 Unclassified 803
397 Ga0501269_044707 3300049766 Unclassified 597
398 Ga0501275_027022 3300049772 Unclassified 740
399 Ga0501283_000473 3300049779 Bacteria 5282
400 Ga0501212_006919 3300049851 Bacteria 1541
401 nmdc:mga05p37_431843_c1 3300050507 Bacteria 1530
402 nmdc:mga08x19_171597_c1 3300050514 Bacteria 1477
403 nmdc:mga0a205_902487_c1 3300050515 Unclassified 731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_101185534 Ga0070661_1011855342 129
2 3300005458 Ga0070681_10023706 Ga0070681_100237066 129
3 3300005618 Ga0068864_100766860 Ga0068864_1007668601 129
4 3300025912 Ga0207707_10231384 Ga0207707_102313842 129
5 3300026095 Ga0207676_10607794 Ga0207676_106077942 129
6 3300048909 Ga0496106_0194570 Ga0496106_0194570_208_666 129
7 3300048907 Ga0496104_1278645 Ga0496104_1278645_160_618 130
8 3300005345 Ga0070692_10279058 Ga0070692_102790582 139
9 3300005441 Ga0070700_100000055 Ga0070700_10000005510 139
10 3300005518 Ga0070699_100001863 Ga0070699_1000018637 139
11 3300005547 Ga0070693_100024669 Ga0070693_1000246694 139
12 3300005617 Ga0068859_100027075 Ga0068859_1000270757 139
13 3300005841 Ga0068863_100276678 Ga0068863_1002766782 139
14 3300006931 Ga0097620_100027076 Ga0097620_1000270767 139
15 3300009093 Ga0105240_10622687 Ga0105240_106226872 139
16 3300009098 Ga0105245_10472977 Ga0105245_104729771 139
17 3300009101 Ga0105247_10221128 Ga0105247_102211282 139
18 3300009174 Ga0105241_11174499 Ga0105241_111744992 139
19 3300009177 Ga0105248_10003923 Ga0105248_100039232 139
20 3300009545 Ga0105237_11718246 Ga0105237_117182461 139
21 3300014968 Ga0157379_11248529 Ga0157379_112485291 139
22 3300005293 Ga0065715_10200290 Ga0065715_102002901 141
23 3300005334 Ga0068869_100301046 Ga0068869_1003010462 141
24 3300005337 Ga0070682_100870245 Ga0070682_1008702451 141
25 3300005340 Ga0070689_101459913 Ga0070689_1014599131 141
26 3300005841 Ga0068863_100972643 Ga0068863_1009726432 141
27 3300005842 Ga0068858_100401096 Ga0068858_1004010962 141
28 3300009098 Ga0105245_10271497 Ga0105245_102714972 141
29 3300009101 Ga0105247_10617727 Ga0105247_106177271 141
30 3300013307 Ga0157372_10252833 Ga0157372_102528333 141
31 3300025900 Ga0207710_10297630 Ga0207710_102976302 141
32 3300025927 Ga0207687_10827673 Ga0207687_108276732 141
33 3300026035 Ga0207703_11191994 Ga0207703_111919942 141
34 3300026088 Ga0207641_10547815 Ga0207641_105478152 141
35 3300026118 Ga0207675_100083031 Ga0207675_1000830312 141
36 3300035114 Ga0373939_0115660 Ga0373939_0115660_444_872 141
37 3300038996 Ga0242420_000401 Ga0242420_000401_3390_3824 141
38 3300045051 Ga0451576_0413802 Ga0451576_0413802_116_550 141
39 3300048909 Ga0496106_0045690 Ga0496106_0045690_2493_2927 141
40 3300048911 Ga0496108_0057804 Ga0496108_0057804_2633_3067 141
41 3300048915 Ga0496112_0113061 Ga0496112_0113061_674_1108 141
42 3300005331 Ga0070670_100398305 Ga0070670_1003983052 142
43 3300005334 Ga0068869_100739930 Ga0068869_1007399301 142
44 3300005345 Ga0070692_10063717 Ga0070692_100637172 142
45 3300005471 Ga0070698_100065856 Ga0070698_1000658563 142
46 3300005546 Ga0070696_100143363 Ga0070696_1001433632 142
47 3300005578 Ga0068854_100600140 Ga0068854_1006001402 142
48 3300005617 Ga0068859_100017815 Ga0068859_1000178152 142
49 3300005618 Ga0068864_100541493 Ga0068864_1005414932 142
50 3300005840 Ga0068870_10034587 Ga0068870_100345873 142
51 3300005844 Ga0068862_100062403 Ga0068862_1000624033 142
52 3300006931 Ga0097620_100017815 Ga0097620_1000178152 142
53 3300009174 Ga0105241_10416848 Ga0105241_104168482 142
54 3300010375 Ga0105239_10902335 Ga0105239_109023351 142
55 3300010375 Ga0105239_12613608 Ga0105239_126136081 142
56 3300011119 Ga0105246_10207257 Ga0105246_102072572 142
57 3300013100 Ga0157373_10026160 Ga0157373_100261603 142
58 3300013102 Ga0157371_10885293 Ga0157371_108852931 142
59 3300013306 Ga0163162_10179151 Ga0163162_101791512 142
60 3300025910 Ga0207684_10000023 Ga0207684_1000002315 142
61 3300025923 Ga0207681_10474374 Ga0207681_104743742 142
62 3300025925 Ga0207650_10257135 Ga0207650_102571352 142
63 3300026095 Ga0207676_10137641 Ga0207676_101376413 142
64 3300028380 Ga0268265_10338336 Ga0268265_103383362 142
65 3300031548 Ga0307408_100063768 Ga0307408_1000637683 142
66 3300031731 Ga0307405_10818642 Ga0307405_108186422 142
67 3300037418 Ga0395900_0354487 Ga0395900_0354487_903_1370 142
68 3300037466 Ga0395898_0050866 Ga0395898_0050866_488_916 142
69 3300038443 Ga0395901_0084926 Ga0395901_0084926_1161_1628 142
70 3300038443 Ga0395901_0151693 Ga0395901_0151693_61_489 142
71 3300038443 Ga0395901_0355359 Ga0395901_0355359_679_1107 142
72 3300050514 nmdc:mga08x19_171597_c1 nmdc:mga08x19_171597_c1_803_1270 142
73 3300048909 Ga0496106_0160312 Ga0496106_0160312_1118_1552 143
74 3300048910 Ga0496107_0116231 Ga0496107_0116231_937_1371 143
75 3300049673 Ga0501240_026872 Ga0501240_026872_135_566 143
76 3300005444 Ga0070694_100058179 Ga0070694_1000581792 144
77 3300005445 Ga0070708_100277170 Ga0070708_1002771701 144
78 3300005539 Ga0068853_101467821 Ga0068853_1014678211 144
79 3300005615 Ga0070702_100766720 Ga0070702_1007667202 144
80 3300005616 Ga0068852_100564301 Ga0068852_1005643012 144
81 3300005617 Ga0068859_100576023 Ga0068859_1005760232 144
82 3300005841 Ga0068863_100299271 Ga0068863_1002992712 144
83 3300005842 Ga0068858_100208692 Ga0068858_1002086923 144
84 3300006852 Ga0075433_10039460 Ga0075433_100394602 144
85 3300006931 Ga0097620_100575980 Ga0097620_1005759802 144
86 3300009148 Ga0105243_12436090 Ga0105243_124360901 144
87 3300009174 Ga0105241_10511051 Ga0105241_105110512 144
88 3300009174 Ga0105241_11852209 Ga0105241_118522091 144
89 3300009176 Ga0105242_11022355 Ga0105242_110223552 144
90 3300010375 Ga0105239_10698411 Ga0105239_106984112 144
91 3300013307 Ga0157372_11196502 Ga0157372_111965022 144
92 3300014326 Ga0157380_10422770 Ga0157380_104227702 144
93 3300014968 Ga0157379_11473240 Ga0157379_114732402 144
94 3300026088 Ga0207641_10102846 Ga0207641_101028463 144
95 3300028380 Ga0268265_11357166 Ga0268265_113571661 144
96 3300028381 Ga0268264_10365644 Ga0268264_103656442 144
97 3300042005 Ga0439448_0043780 Ga0439448_0043780_112_561 144
98 3300042157 Ga0439458_0000311 Ga0439458_0000311_9995_10444 144
99 3300050515 nmdc:mga0a205_902487_c1 nmdc:mga0a205_902487_c1_42_491 144
100 3300003203 JGI25406J46586_10007886 JGI25406J46586_100078863 145
101 3300005290 Ga0065712_10071747 Ga0065712_100717473 145
102 3300005293 Ga0065715_10124639 Ga0065715_101246392 145
103 3300005295 Ga0065707_10117404 Ga0065707_101174042 145
104 3300005328 Ga0070676_10123758 Ga0070676_101237583 145
105 3300005328 Ga0070676_10317425 Ga0070676_103174252 145
106 3300005330 Ga0070690_100021743 Ga0070690_1000217433 145
107 3300005331 Ga0070670_100068473 Ga0070670_1000684732 145
108 3300005338 Ga0068868_100004720 Ga0068868_1000047208 145
109 3300005340 Ga0070689_100045765 Ga0070689_1000457653 145
110 3300005347 Ga0070668_100416297 Ga0070668_1004162972 145
111 3300005353 Ga0070669_100080228 Ga0070669_1000802282 145
112 3300005354 Ga0070675_100050807 Ga0070675_1000508072 145
113 3300005355 Ga0070671_100010320 Ga0070671_1000103203 145
114 3300005364 Ga0070673_100055195 Ga0070673_1000551953 145
115 3300005365 Ga0070688_100020534 Ga0070688_1000205343 145
116 3300005440 Ga0070705_100518735 Ga0070705_1005187351 145
117 3300005441 Ga0070700_100057115 Ga0070700_1000571152 145
118 3300005444 Ga0070694_100026008 Ga0070694_1000260083 145
119 3300005456 Ga0070678_100007229 Ga0070678_1000072295 145
120 3300005457 Ga0070662_100247866 Ga0070662_1002478662 145
121 3300005459 Ga0068867_101511131 Ga0068867_1015111311 145
122 3300005466 Ga0070685_10006136 Ga0070685_100061362 145
123 3300005539 Ga0068853_100176823 Ga0068853_1001768232 145
124 3300005544 Ga0070686_100006666 Ga0070686_1000066663 145
125 3300005545 Ga0070695_100043315 Ga0070695_1000433152 145
126 3300005545 Ga0070695_100787951 Ga0070695_1007879511 145
127 3300005546 Ga0070696_100431462 Ga0070696_1004314622 145
128 3300005549 Ga0070704_101046808 Ga0070704_1010468081 145
129 3300005564 Ga0070664_100041587 Ga0070664_1000415873 145
130 3300005578 Ga0068854_100258314 Ga0068854_1002583142 145
131 3300005615 Ga0070702_100007138 Ga0070702_1000071383 145
132 3300005616 Ga0068852_100371112 Ga0068852_1003711121 145
133 3300005617 Ga0068859_100055260 Ga0068859_1000552603 145
134 3300005618 Ga0068864_100252299 Ga0068864_1002522992 145
135 3300005618 Ga0068864_100508914 Ga0068864_1005089142 145
136 3300005718 Ga0068866_10003064 Ga0068866_100030645 145
137 3300005719 Ga0068861_100032522 Ga0068861_1000325222 145
138 3300005840 Ga0068870_10003055 Ga0068870_100030552 145
139 3300005841 Ga0068863_100004161 Ga0068863_1000041617 145
140 3300005841 Ga0068863_100502024 Ga0068863_1005020242 145
141 3300005842 Ga0068858_100094538 Ga0068858_1000945382 145
142 3300005843 Ga0068860_100055038 Ga0068860_1000550383 145
143 3300005844 Ga0068862_100006743 Ga0068862_1000067432 145
144 3300005985 Ga0081539_10000279 Ga0081539_1000027953 145
145 3300006237 Ga0097621_100028856 Ga0097621_1000288565 145
146 3300006358 Ga0068871_100002633 Ga0068871_1000026337 145
147 3300006871 Ga0075434_101509268 Ga0075434_1015092681 145
148 3300006881 Ga0068865_100045296 Ga0068865_1000452963 145
149 3300006931 Ga0097620_100055259 Ga0097620_1000552592 145
150 3300009092 Ga0105250_10020664 Ga0105250_100206642 145
151 3300009093 Ga0105240_10476278 Ga0105240_104762782 145
152 3300009093 Ga0105240_11624661 Ga0105240_116246611 145
153 3300009098 Ga0105245_10014548 Ga0105245_100145483 145
154 3300009148 Ga0105243_10001654 Ga0105243_1000165414 145
155 3300009148 Ga0105243_10448774 Ga0105243_104487742 145
156 3300009174 Ga0105241_11088620 Ga0105241_110886202 145
157 3300009176 Ga0105242_10003374 Ga0105242_100033743 145
158 3300009177 Ga0105248_10220169 Ga0105248_102201693 145
159 3300009545 Ga0105237_10461802 Ga0105237_104618022 145
160 3300009551 Ga0105238_10106746 Ga0105238_101067462 145
161 3300010375 Ga0105239_10098219 Ga0105239_100982193 145
162 3300013100 Ga0157373_10008234 Ga0157373_100082346 145
163 3300013297 Ga0157378_10006520 Ga0157378_100065206 145
164 3300013306 Ga0163162_12434435 Ga0163162_124344351 145
165 3300014325 Ga0163163_10029217 Ga0163163_100292173 145
166 3300014326 Ga0157380_10389097 Ga0157380_103890971 145
167 3300014745 Ga0157377_10017831 Ga0157377_100178313 145
168 3300014969 Ga0157376_10010339 Ga0157376_100103393 145
169 3300017792 Ga0163161_10625089 Ga0163161_106250892 145
170 3300025315 Ga0207697_10005134 Ga0207697_100051344 145
171 3300025899 Ga0207642_10032500 Ga0207642_100325003 145
172 3300025908 Ga0207643_10010907 Ga0207643_100109075 145
173 3300025911 Ga0207654_10079404 Ga0207654_100794042 145
174 3300025918 Ga0207662_10006238 Ga0207662_100062388 145
175 3300025925 Ga0207650_10122521 Ga0207650_101225211 145
176 3300025925 Ga0207650_10805527 Ga0207650_108055272 145
177 3300025926 Ga0207659_10073862 Ga0207659_100738622 145
178 3300025927 Ga0207687_10503329 Ga0207687_105033292 145
179 3300025931 Ga0207644_10129895 Ga0207644_101298952 145
180 3300025933 Ga0207706_10156737 Ga0207706_101567372 145
181 3300025938 Ga0207704_10011612 Ga0207704_100116124 145
182 3300025940 Ga0207691_10002754 Ga0207691_100027548 145
183 3300025941 Ga0207711_10044135 Ga0207711_100441353 145
184 3300025942 Ga0207689_10002753 Ga0207689_100027533 145
185 3300025945 Ga0207679_10189544 Ga0207679_101895442 145
186 3300025961 Ga0207712_10142433 Ga0207712_101424332 145
187 3300026041 Ga0207639_10617748 Ga0207639_106177482 145
188 3300026075 Ga0207708_10003805 Ga0207708_100038053 145
189 3300026075 Ga0207708_10041895 Ga0207708_100418951 145
190 3300026075 Ga0207708_10087624 Ga0207708_100876243 145
191 3300026089 Ga0207648_11218327 Ga0207648_112183272 145
192 3300026095 Ga0207676_10005333 Ga0207676_100053337 145
193 3300026095 Ga0207676_10268018 Ga0207676_102680182 145
194 3300026116 Ga0207674_10032493 Ga0207674_100324935 145
195 3300026116 Ga0207674_10139219 Ga0207674_101392192 145
196 3300026118 Ga0207675_100004243 Ga0207675_10000424312 145
197 3300026121 Ga0207683_10092090 Ga0207683_100920902 145
198 3300026142 Ga0207698_10166832 Ga0207698_101668321 145
199 3300028380 Ga0268265_11292112 Ga0268265_112921122 145
200 3300035691 Ga0373931_0617237 Ga0373931_0617237_100_570 145
201 3300046684 Ga0495669_0086568 Ga0495669_0086568_379_849 145
202 3300048913 Ga0496110_0109878 Ga0496110_0109878_102_548 145
203 3300048914 Ga0496111_0462456 Ga0496111_0462456_32_478 145
204 3300005295 Ga0065707_10019004 Ga0065707_100190042 146
205 3300005355 Ga0070671_100952447 Ga0070671_1009524472 146
206 3300005840 Ga0068870_10072444 Ga0068870_100724441 146
207 3300005841 Ga0068863_100173865 Ga0068863_1001738653 146
208 3300005843 Ga0068860_100939924 Ga0068860_1009399241 146
209 3300009011 Ga0105251_10260600 Ga0105251_102606002 146
210 3300009177 Ga0105248_10203666 Ga0105248_102036662 146
211 3300009553 Ga0105249_10004981 Ga0105249_100049817 146
212 3300013306 Ga0163162_11546106 Ga0163162_115461062 146
213 3300013306 Ga0163162_12090585 Ga0163162_120905851 146
214 3300014325 Ga0163163_10626994 Ga0163163_106269942 146
215 3300014745 Ga0157377_10771564 Ga0157377_107715641 146
216 3300025931 Ga0207644_10822410 Ga0207644_108224101 146
217 3300025941 Ga0207711_10019725 Ga0207711_100197257 146
218 3300025961 Ga0207712_10001743 Ga0207712_100017436 146
219 3300026035 Ga0207703_10479351 Ga0207703_104793512 146
220 3300028381 Ga0268264_11348581 Ga0268264_113485812 146
221 3300048915 Ga0496112_0716552 Ga0496112_0716552_216_665 146
222 3300005467 Ga0070706_100039572 Ga0070706_1000395723 147
223 3300005468 Ga0070707_100092986 Ga0070707_1000929863 147
224 3300005471 Ga0070698_100013093 Ga0070698_1000130933 147
225 3300005536 Ga0070697_100061571 Ga0070697_1000615712 147
226 3300005545 Ga0070695_100040384 Ga0070695_1000403842 147
227 3300005546 Ga0070696_100034951 Ga0070696_1000349513 147
228 3300005549 Ga0070704_100056371 Ga0070704_1000563712 147
229 3300013297 Ga0157378_10677872 Ga0157378_106778722 147
230 3300013308 Ga0157375_10009615 Ga0157375_100096155 147
231 3300025910 Ga0207684_10051582 Ga0207684_100515822 147
232 3300025922 Ga0207646_10222169 Ga0207646_102221692 147
233 3300031911 Ga0307412_10178253 Ga0307412_101782532 147
234 3300031995 Ga0307409_100050818 Ga0307409_1000508182 147
235 3300032002 Ga0307416_100045524 Ga0307416_1000455242 147
236 3300032004 Ga0307414_10116723 Ga0307414_101167232 147
237 3300032005 Ga0307411_10029006 Ga0307411_100290064 147
238 3300032126 Ga0307415_100069166 Ga0307415_1000691663 147
239 3300049515 Ga0501292_023134 Ga0501292_023134_422_865 147
240 3300049515 Ga0501292_046468 Ga0501292_046468_107_583 147
241 3300049517 Ga0501294_023647 Ga0501294_023647_27_470 147
242 3300049518 Ga0501295_026626 Ga0501295_026626_499_942 147
243 3300049519 Ga0501296_003115 Ga0501296_003115_299_742 147
244 3300049520 Ga0501297_000940 Ga0501297_000940_1264_1707 147
245 3300049521 Ga0501298_000392 Ga0501298_000392_4745_5188 147
246 3300049521 Ga0501298_005670 Ga0501298_005670_897_1373 147
247 3300049523 Ga0501300_017814 Ga0501300_017814_100_543 147
248 3300049526 Ga0501303_006133 Ga0501303_006133_185_628 147
249 3300049574 Ga0501038_0000710 Ga0501038_0000710_2601_3044 147
250 3300049652 Ga0501202_007957 Ga0501202_007957_651_1127 147
251 3300049652 Ga0501202_080463 Ga0501202_080463_50_493 147
252 3300049653 Ga0501206_023703 Ga0501206_023703_160_636 147
253 3300049653 Ga0501206_068338 Ga0501206_068338_103_546 147
254 3300049654 Ga0501207_027227 Ga0501207_027227_259_702 147
255 3300049655 Ga0501208_039122 Ga0501208_039122_109_585 147
256 3300049660 Ga0501216_028338 Ga0501216_028338_416_892 147
257 3300049661 Ga0501217_036582 Ga0501217_036582_308_751 147
258 3300049663 Ga0501223_021204 Ga0501223_021204_642_1085 147
259 3300049663 Ga0501223_044632 Ga0501223_044632_254_730 147
260 3300049664 Ga0501224_018282 Ga0501224_018282_13_456 147
261 3300049668 Ga0501233_004453 Ga0501233_004453_222_665 147
262 3300049668 Ga0501233_016347 Ga0501233_016347_163_639 147
263 3300049669 Ga0501235_001682 Ga0501235_001682_2026_2469 147
264 3300049671 Ga0501238_034690 Ga0501238_034690_192_668 147
265 3300049675 Ga0501243_011059 Ga0501243_011059_889_1332 147
266 3300049675 Ga0501243_046311 Ga0501243_046311_161_637 147
267 3300049679 Ga0501249_025313 Ga0501249_025313_156_599 147
268 3300049683 Ga0501253_051304 Ga0501253_051304_104_580 147
269 3300049690 Ga0501261_010572 Ga0501261_010572_680_1123 147
270 3300049704 Ga0501221_015198 Ga0501221_015198_744_1187 147
271 3300049705 Ga0501225_0008482 Ga0501225_0008482_259_702 147
272 3300049765 Ga0501268_050666 Ga0501268_050666_142_618 147
273 3300049766 Ga0501269_044707 Ga0501269_044707_49_492 147
274 3300049772 Ga0501275_027022 Ga0501275_027022_174_650 147
275 3300049779 Ga0501283_000473 Ga0501283_000473_4230_4673 147
276 3300049851 Ga0501212_006919 Ga0501212_006919_205_648 147
277 3300005337 Ga0070682_101541702 Ga0070682_1015417021 148
278 3300005530 Ga0070679_100203070 Ga0070679_1002030702 148
279 3300025921 Ga0207652_10122547 Ga0207652_101225472 148
280 3300026118 Ga0207675_100727268 Ga0207675_1007272682 148
281 3300002459 JGI24751J29686_10000060 JGI24751J29686_1000006031 150
282 3300005293 Ga0065715_10007306 Ga0065715_100073062 150
283 3300005330 Ga0070690_100379854 Ga0070690_1003798542 150
284 3300005331 Ga0070670_100000932 Ga0070670_10000093219 150
285 3300005331 Ga0070670_101304328 Ga0070670_1013043281 150
286 3300005334 Ga0068869_100824453 Ga0068869_1008244532 150
287 3300005336 Ga0070680_100347517 Ga0070680_1003475172 150
288 3300005344 Ga0070661_100262853 Ga0070661_1002628532 150
289 3300005345 Ga0070692_10415311 Ga0070692_104153111 150
290 3300005353 Ga0070669_100007248 Ga0070669_1000072489 150
291 3300005353 Ga0070669_100126450 Ga0070669_1001264501 150
292 3300005354 Ga0070675_100071383 Ga0070675_1000713833 150
293 3300005364 Ga0070673_101071745 Ga0070673_1010717452 150
294 3300005366 Ga0070659_100120218 Ga0070659_1001202182 150
295 3300005438 Ga0070701_10108640 Ga0070701_101086401 150
296 3300005441 Ga0070700_100060283 Ga0070700_1000602833 150
297 3300005441 Ga0070700_100611014 Ga0070700_1006110142 150
298 3300005445 Ga0070708_101910907 Ga0070708_1019109071 150
299 3300005459 Ga0068867_100830169 Ga0068867_1008301691 150
300 3300005466 Ga0070685_10295002 Ga0070685_102950021 150
301 3300005544 Ga0070686_101360330 Ga0070686_1013603301 150
302 3300005546 Ga0070696_100351326 Ga0070696_1003513262 150
303 3300005547 Ga0070693_100228209 Ga0070693_1002282092 150
304 3300005547 Ga0070693_100504314 Ga0070693_1005043142 150
305 3300005577 Ga0068857_100748854 Ga0068857_1007488542 150
306 3300005578 Ga0068854_100143337 Ga0068854_1001433372 150
307 3300005578 Ga0068854_100446978 Ga0068854_1004469782 150
308 3300005615 Ga0070702_100542785 Ga0070702_1005427852 150
309 3300005616 Ga0068852_100079283 Ga0068852_1000792832 150
310 3300005617 Ga0068859_100153308 Ga0068859_1001533082 150
311 3300005617 Ga0068859_100173385 Ga0068859_1001733852 150
312 3300005617 Ga0068859_100238623 Ga0068859_1002386232 150
313 3300005617 Ga0068859_100352057 Ga0068859_1003520572 150
314 3300005617 Ga0068859_101354823 Ga0068859_1013548232 150
315 3300005618 Ga0068864_101076007 Ga0068864_1010760072 150
316 3300005842 Ga0068858_100112773 Ga0068858_1001127732 150
317 3300005842 Ga0068858_100149863 Ga0068858_1001498632 150
318 3300005842 Ga0068858_100362933 Ga0068858_1003629332 150
319 3300005842 Ga0068858_100586629 Ga0068858_1005866291 150
320 3300005842 Ga0068858_100606974 Ga0068858_1006069742 150
321 3300005843 Ga0068860_100216362 Ga0068860_1002163622 150
322 3300005843 Ga0068860_100282488 Ga0068860_1002824882 150
323 3300006871 Ga0075434_100589700 Ga0075434_1005897002 150
324 3300006931 Ga0097620_100061445 Ga0097620_1000614453 150
325 3300006931 Ga0097620_100153295 Ga0097620_1001532952 150
326 3300006931 Ga0097620_100173377 Ga0097620_1001733772 150
327 3300006931 Ga0097620_100238628 Ga0097620_1002386282 150
328 3300006931 Ga0097620_100352067 Ga0097620_1003520671 150
329 3300006931 Ga0097620_101354832 Ga0097620_1013548322 150
330 3300009098 Ga0105245_10269750 Ga0105245_102697503 150
331 3300009098 Ga0105245_10722007 Ga0105245_107220072 150
332 3300009101 Ga0105247_10000358 Ga0105247_1000035817 150
333 3300009101 Ga0105247_10052082 Ga0105247_100520822 150
334 3300009147 Ga0114129_10581806 Ga0114129_105818062 150
335 3300009148 Ga0105243_10212835 Ga0105243_102128352 150
336 3300009148 Ga0105243_11144856 Ga0105243_111448562 150
337 3300009148 Ga0105243_11462910 Ga0105243_114629102 150
338 3300009174 Ga0105241_10267084 Ga0105241_102670842 150
339 3300009176 Ga0105242_10854743 Ga0105242_108547432 150
340 3300009177 Ga0105248_10101966 Ga0105248_101019662 150
341 3300009177 Ga0105248_10844580 Ga0105248_108445801 150
342 3300009177 Ga0105248_11238122 Ga0105248_112381222 150
343 3300009545 Ga0105237_10590049 Ga0105237_105900492 150
344 3300009551 Ga0105238_10004864 Ga0105238_100048648 150
345 3300009551 Ga0105238_10498644 Ga0105238_104986442 150
346 3300009553 Ga0105249_10820441 Ga0105249_108204412 150
347 3300009553 Ga0105249_11134050 Ga0105249_111340502 150
348 3300010375 Ga0105239_10664159 Ga0105239_106641593 150
349 3300011119 Ga0105246_10181006 Ga0105246_101810062 150
350 3300011119 Ga0105246_10270977 Ga0105246_102709772 150
351 3300013296 Ga0157374_10309520 Ga0157374_103095202 150
352 3300013297 Ga0157378_11025033 Ga0157378_110250332 150
353 3300013306 Ga0163162_10759119 Ga0163162_107591191 150
354 3300013308 Ga0157375_10844627 Ga0157375_108446272 150
355 3300014325 Ga0163163_10000984 Ga0163163_1000098414 150
356 3300014325 Ga0163163_10393788 Ga0163163_103937881 150
357 3300014968 Ga0157379_10050275 Ga0157379_100502753 150
358 3300014968 Ga0157379_10406067 Ga0157379_104060672 150
359 3300014968 Ga0157379_10544879 Ga0157379_105448792 150
360 3300014968 Ga0157379_11132246 Ga0157379_111322462 150
361 3300025900 Ga0207710_10019193 Ga0207710_100191933 150
362 3300025900 Ga0207710_10073747 Ga0207710_100737472 150
363 3300025900 Ga0207710_10139588 Ga0207710_101395882 150
364 3300025904 Ga0207647_10223823 Ga0207647_102238232 150
365 3300025914 Ga0207671_10093653 Ga0207671_100936532 150
366 3300025918 Ga0207662_10030662 Ga0207662_100306623 150
367 3300025922 Ga0207646_11370309 Ga0207646_113703091 150
368 3300025923 Ga0207681_10004345 Ga0207681_100043457 150
369 3300025924 Ga0207694_10006258 Ga0207694_100062586 150
370 3300025925 Ga0207650_10000001 Ga0207650_10000001383 150
371 3300025926 Ga0207659_10199095 Ga0207659_101990952 150
372 3300025927 Ga0207687_10657027 Ga0207687_106570272 150
373 3300025932 Ga0207690_10114657 Ga0207690_101146572 150
374 3300025934 Ga0207686_10033535 Ga0207686_100335353 150
375 3300025935 Ga0207709_10130693 Ga0207709_101306932 150
376 3300025938 Ga0207704_10436267 Ga0207704_104362672 150
377 3300025940 Ga0207691_10237646 Ga0207691_102376462 150
378 3300025941 Ga0207711_10093334 Ga0207711_100933343 150
379 3300025941 Ga0207711_11197688 Ga0207711_111976881 150
380 3300025945 Ga0207679_11518931 Ga0207679_115189311 150
381 3300025960 Ga0207651_10342068 Ga0207651_103420682 150
382 3300025981 Ga0207640_10152202 Ga0207640_101522022 150
383 3300025981 Ga0207640_11028602 Ga0207640_110286022 150
384 3300026035 Ga0207703_10050574 Ga0207703_100505743 150
385 3300026035 Ga0207703_10128906 Ga0207703_101289063 150
386 3300026041 Ga0207639_11758961 Ga0207639_117589611 150
387 3300026075 Ga0207708_10094264 Ga0207708_100942643 150
388 3300026089 Ga0207648_10275076 Ga0207648_102750762 150
389 3300026095 Ga0207676_10729332 Ga0207676_107293322 150
390 3300026116 Ga0207674_10407725 Ga0207674_104077252 150
391 3300026116 Ga0207674_11043140 Ga0207674_110431402 150
392 3300026118 Ga0207675_100608903 Ga0207675_1006089031 150
393 3300026142 Ga0207698_10248234 Ga0207698_102482342 150
394 3300026142 Ga0207698_10458334 Ga0207698_104583342 150
395 3300028381 Ga0268264_10054592 Ga0268264_100545924 150
396 3300028381 Ga0268264_10597435 Ga0268264_105974352 150
397 3300028381 Ga0268264_11136637 Ga0268264_111366372 150
398 3300035115 Ga0373941_0089508 Ga0373941_0089508_509_1009 150
399 3300035207 Ga0373942_0004270 Ga0373942_0004270_692_1183 150
400 3300048912 Ga0496109_0613768 Ga0496109_0613768_85_546 150
401 3300048915 Ga0496112_0904046 Ga0496112_0904046_269_730 150
402 3300048916 Ga0496113_0056817 Ga0496113_0056817_1648_2109 150
403 3300050507 nmdc:mga05p37_431843_c1 nmdc:mga05p37_431843_c1_735_1187 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04892

VanZ

VanZ like family

35

168

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tcl-assembly1.cif.gz_L1 photosystem i tetramer 0.751 60 144
6tcl-assembly1.cif.gz_L photosystem i tetramer 0.7393 60 148
6vpv-assembly1.cif.gz_L trimeric photosystem i from the high-light tolerant cyanobacteria cyanobacterium aponinum 0.7384 60 135
7f4v-assembly1.cif.gz_cL cryo-em structure of a primordial cyanobacterial photosystem i 0.7134 60 135
6kif-assembly1.cif.gz_L structure of cyanobacterial photosystem i-isia-flavodoxin supercomplex 0.7095 60 135
ID Description Score Start End Superfamily
af_O13689_1_162_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.7329 60 149 1.20.1270.60
4rkuL00 Mainly Alpha;Up-down Bundle;Photosystem 1 Reaction Centre Subunit Xi; Chain: L;;Photosystem I PsaL, reaction centre subunit XI 0.5983 60 134 1.20.1240.10
af_B4FUT9_48_211_1.20.1240.10 Mainly Alpha;Up-down Bundle;Photosystem 1 Reaction Centre Subunit Xi; Chain: L;;Photosystem I PsaL, reaction centre subunit XI 0.5716 45 134 1.20.1240.10
af_A0A1D6F6H3_27_143_1.20.1280.170 Mainly Alpha;Up-down Bundle;Monooxygenase;Exocyst complex component Exo70 0.5672 50 133 1.20.1280.170
af_Q651I6_271_428_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5601 38 134 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7X9E2X0-F1-model_v4 VanZ family protein 0.9436 60 144 GO:0016020
AF-A0A524LUV9-F1-model_v4 VanZ family protein 0.9277 60 144 GO:0016020
AF-A0A532BZX9-F1-model_v4 VanZ-like domain-containing protein 0.9246 66 137 GO:0016020
AF-A0A0S8IV11-F1-model_v4 VanZ-like domain-containing protein 0.923 60 150 GO:0016020
AF-H1XSD4-F1-model_v4 VanZ family protein (VanZ like family protein) 0.9145 60 147 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.88 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map