F433806

General Info

Members Datasets Scaffolds Average Seq Length
397 226 387 239

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10021234|Ga0265314_100212342
Length 252
Sequence MTRFTTAFRHIWPIFKREFGAYFATPLAYVFIVIFLFTMGAFTFYVGHFYERGIADLGDPFFAFHPWLYLFLVPAISMRLWADERRTGTMELLLTLPVPLWATVVGKYLAAWVFTGIALALTFPIWLTVNFLGQPDNGVVVASYIGSFLVAGGYLAIGACISATTNNQVIAFVVSVAVCFLFTVSGSPMVLDVFRAWAPQALTEAIASFSFVTHFTSITQGVLDFRDLVFFLSLIALFLAANIVVVDLKKGG

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
3 2734482264 Dyella sp. AD052 Isolate Unclassified
4 2738543009 Luteibacter sp. OK325 Isolate Unclassified
5 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
6 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
7 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
8 2919085039 Luteibacter sp. 1214 Isolate Unclassified
9 2919404418 Luteibacter sp. 3190 Isolate Unclassified
10 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
221 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
222 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
223 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 0.5
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0
Rhizoplane 1.01
Rhizosphere 87.15
Stem 0
Stem Tuber 0
Unclassified 7.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10106885 3300003320 Bacteria 6460
2 Ga0006562J51391_1149534 3300003578 Bacteria 5080
3 Ga0006562J51391_1149536 3300003578 Bacteria 4760
4 Ga0065165_1000108 3300005262 Bacteria 139605
5 Ga0070658_10028786 3300005327 Bacteria 4460
6 Ga0070683_100768575 3300005329 Bacteria 923
7 Ga0070690_100389054 3300005330 Bacteria 1021
8 Ga0070666_10009608 3300005335 Bacteria 6037
9 Ga0070680_100000724 3300005336 Bacteria 22972
10 Ga0070680_100006875 3300005336 Bacteria 8675
11 Ga0070680_100433429 3300005336 Bacteria 1122
12 Ga0068868_100102570 3300005338 Bacteria 2317
13 Ga0070660_100268457 3300005339 Bacteria 1394
14 Ga0070661_100000360 3300005344 Bacteria 35942
15 Ga0070661_100017286 3300005344 Bacteria 5114
16 Ga0070661_100036785 3300005344 Bacteria 3558
17 Ga0070714_100019936 3300005435 Bacteria 5472
18 Ga0070714_100118761 3300005435 Bacteria 2350
19 Ga0070711_100030947 3300005439 Bacteria 3548
20 Ga0070711_100093953 3300005439 Bacteria 2167
21 Ga0070681_10000010 3300005458 Bacteria 140126
22 Ga0070681_10013143 3300005458 Bacteria 8224
23 Ga0070681_10225057 3300005458 Bacteria 1791
24 Ga0070698_100504365 3300005471 Bacteria 1148
25 Ga0070679_100001075 3300005530 Bacteria 23895
26 Ga0070679_100011487 3300005530 Bacteria 8440
27 Ga0070679_100536238 3300005530 Bacteria 1114
28 Ga0068853_100001947 3300005539 Bacteria 15217
29 Ga0068853_100488391 3300005539 Bacteria 1161
30 Ga0068853_100538609 3300005539 Bacteria 1105
31 Ga0070686_100108344 3300005544 Bacteria 1888
32 Ga0070696_100002124 3300005546 Bacteria 13032
33 Ga0070696_100446924 3300005546 Bacteria 1019
34 Ga0070665_100253814 3300005548 Bacteria 1759
35 Ga0068855_100000034 3300005563 Bacteria 166436
36 Ga0068855_100016425 3300005563 Bacteria 8899
37 Ga0068855_100023900 3300005563 Bacteria 7319
38 Ga0068855_100137597 3300005563 Bacteria 2786
39 Ga0068855_100446900 3300005563 Unclassified 1411
40 Ga0068857_100405770 3300005577 Bacteria 1269
41 Ga0068854_100158121 3300005578 Bacteria 1753
42 Ga0068856_100000447 3300005614 Bacteria 45620
43 Ga0068852_100001775 3300005616 Bacteria 14678
44 Ga0068860_100182711 3300005843 Bacteria 2027
45 Ga0081455_10003906 3300005937 Bacteria 16972
46 Ga0070715_10228363 3300006163 Bacteria 961
47 Ga0070712_100002406 3300006175 Bacteria 11525
48 Ga0097621_100097701 3300006237 Bacteria 2466
49 Ga0097621_100232825 3300006237 Bacteria 1608
50 Ga0068871_100055957 3300006358 Bacteria 3205
51 Ga0068871_100145129 3300006358 Bacteria 2020
52 Ga0075428_100082727 3300006844 Bacteria 3502
53 Ga0068865_100021465 3300006881 Bacteria 4199
54 Ga0105240_10000382 3300009093 Bacteria 83108
55 Ga0105240_10012354 3300009093 Bacteria 11792
56 Ga0105240_10045106 3300009093 Bacteria 5595
57 Ga0105240_10070497 3300009093 Bacteria 4324
58 Ga0105240_10117279 3300009093 Bacteria 3210
59 Ga0105240_10348512 3300009093 Bacteria 1680
60 Ga0111539_10231556 3300009094 Bacteria 2151
61 Ga0105247_10002256 3300009101 Bacteria 13254
62 Ga0105247_10016589 3300009101 Bacteria 4417
63 Ga0105241_10030426 3300009174 Bacteria 4035
64 Ga0105241_10393686 3300009174 Bacteria 1214
65 Ga0105248_10128348 3300009177 Bacteria 2861
66 Ga0105248_10195096 3300009177 Bacteria 2281
67 Ga0105237_10027958 3300009545 Bacteria 5747
68 Ga0105237_10028534 3300009545 Bacteria 5683
69 Ga0105237_10049898 3300009545 Bacteria 4205
70 Ga0105237_10658674 3300009545 Bacteria 1054
71 Ga0105237_10810097 3300009545 Bacteria 943
72 Ga0105238_10019434 3300009551 Bacteria 6919
73 Ga0105238_10065151 3300009551 Bacteria 3644
74 Ga0105238_10114926 3300009551 Bacteria 2671
75 Ga0105238_10183043 3300009551 Bacteria 2072
76 Ga0105238_10193669 3300009551 Bacteria 2009
77 Ga0105239_10001611 3300010375 Bacteria 29829
78 Ga0105239_10002698 3300010375 Bacteria 22316
79 Ga0105239_10038394 3300010375 Bacteria 5248
80 Ga0105239_10207978 3300010375 Bacteria 2193
81 Ga0157371_10009283 3300013102 Bacteria 7756
82 Ga0157370_10000272 3300013104 Bacteria 65739
83 Ga0157370_10190578 3300013104 Bacteria 1903
84 Ga0157369_10007410 3300013105 Bacteria 12633
85 Ga0157369_10007650 3300013105 Bacteria 12427
86 Ga0157369_10062014 3300013105 Bacteria 4030
87 Ga0157372_10002339 3300013307 Bacteria 20526
88 Ga0157372_10086540 3300013307 Bacteria 3555
89 Ga0157372_10207136 3300013307 Bacteria 2272
90 Ga0157372_10679134 3300013307 Bacteria 1199
91 Ga0163163_10486535 3300014325 Bacteria 1295
92 Ga0163163_10882989 3300014325 Bacteria 957
93 Ga0157380_10266729 3300014326 Bacteria 1558
94 Ga0182008_10000889 3300014497 Bacteria 20766
95 Ga0182008_10027123 3300014497 Bacteria 2904
96 Ga0157379_10004217 3300014968 Bacteria 12274
97 Ga0157379_10036150 3300014968 Unclassified 4405
98 Ga0182006_1000034 3300015261 Bacteria 232484
99 Ga0182006_1000563 3300015261 Bacteria 27731
100 Ga0182007_10002936 3300015262 Bacteria 8277
101 Ga0182005_1000362 3300015265 Bacteria 25350
102 Ga0182005_1000900 3300015265 Bacteria 13006
103 Ga0182005_1001909 3300015265 Bacteria 7895
104 Ga0213874_10008193 3300021377 Bacteria 2539
105 Ga0213876_10000198 3300021384 Bacteria 61717
106 Ga0213876_10000235 3300021384 Bacteria 53826
107 Ga0209674_100539 3300025226 Bacteria 15278
108 Ga0207427_110111 3300025231 Bacteria 992
109 Ga0209437_100744 3300025233 Bacteria 16152
110 Ga0209148_1001545 3300025254 Bacteria 11177
111 Ga0209129_1001227 3300025258 Bacteria 14697
112 Ga0209675_1002156 3300025291 Bacteria 10371
113 Ga0209758_1025577 3300025297 Bacteria 2585
114 Ga0209256_1002466 3300025299 Bacteria 15041
115 Ga0207426_1010198 3300025302 Bacteria 3664
116 Ga0207710_10010076 3300025900 Bacteria 3976
117 Ga0207680_10001208 3300025903 Bacteria 12231
118 Ga0207705_10059938 3300025909 Bacteria 2748
119 Ga0207705_10216714 3300025909 Bacteria 1453
120 Ga0207654_10088507 3300025911 Bacteria 1882
121 Ga0207707_10000005 3300025912 Bacteria 382024
122 Ga0207707_10076080 3300025912 Bacteria 2929
123 Ga0207695_10000004 3300025913 Bacteria 1288665
124 Ga0207695_10035573 3300025913 Bacteria 5398
125 Ga0207695_10109782 3300025913 Bacteria 2740
126 Ga0207695_10154297 3300025913 Bacteria 2232
127 Ga0207695_10549803 3300025913 Bacteria 1036
128 Ga0207671_10050585 3300025914 Bacteria 3077
129 Ga0207671_10073799 3300025914 Bacteria 2549
130 Ga0207693_10000079 3300025915 Bacteria 86388
131 Ga0207663_10027338 3300025916 Bacteria 3323
132 Ga0207660_10002390 3300025917 Bacteria 12338
133 Ga0207660_10030236 3300025917 Bacteria 3722
134 Ga0207660_10399752 3300025917 Bacteria 1106
135 Ga0207662_10183911 3300025918 Bacteria 1346
136 Ga0207649_10000822 3300025920 Bacteria 19938
137 Ga0207649_10083037 3300025920 Bacteria 2078
138 Ga0207649_10200234 3300025920 Bacteria 1410
139 Ga0207652_10000068 3300025921 Bacteria 110287
140 Ga0207652_10327306 3300025921 Bacteria 1383
141 Ga0207694_10000010 3300025924 Bacteria 439722
142 Ga0207694_10055827 3300025924 Bacteria 3066
143 Ga0207650_10057323 3300025925 Bacteria 2897
144 Ga0207700_10334801 3300025928 Bacteria 1315
145 Ga0207664_10026725 3300025929 Bacteria 4365
146 Ga0207664_10062654 3300025929 Bacteria 2970
147 Ga0207686_10040265 3300025934 Bacteria 2840
148 Ga0207704_10432282 3300025938 Bacteria 1046
149 Ga0207711_10224280 3300025941 Bacteria 1720
150 Ga0207667_10000065 3300025949 Bacteria 186655
151 Ga0207667_10013394 3300025949 Bacteria 9383
152 Ga0207667_10235247 3300025949 Bacteria 1875
153 Ga0207658_10144565 3300025986 Bacteria 1929
154 Ga0207677_10102202 3300026023 Bacteria 2113
155 Ga0207703_10326363 3300026035 Unclassified 1407
156 Ga0207639_10002186 3300026041 Bacteria 13162
157 Ga0207639_10199235 3300026041 Bacteria 1716
158 Ga0207639_10430767 3300026041 Bacteria 1194
159 Ga0207678_10058486 3300026067 Bacteria 3317
160 Ga0207702_10000644 3300026078 Bacteria 38190
161 Ga0207702_10255730 3300026078 Bacteria 1647
162 Ga0207674_10018536 3300026116 Bacteria 7562
163 Ga0207698_10243440 3300026142 Bacteria 1641
164 Ga0207428_10261895 3300027907 Bacteria 1288
165 Ga0268266_10016857 3300028379 Bacteria 6242
166 Ga0265337_1001180 3300028556 Bacteria 13316
167 Ga0265334_10007647 3300028573 Bacteria 4628
168 Ga0265318_10000071 3300028577 Bacteria 96845
169 Ga0265338_10009876 3300028800 Bacteria 11299
170 Ga0265338_10034326 3300028800 Bacteria 4905
171 Ga0265338_10041512 3300028800 Bacteria 4301
172 Ga0265338_10110897 3300028800 Bacteria 2210
173 Ga0265332_10049509 3300031238 Bacteria 1807
174 Ga0265332_10074576 3300031238 Unclassified 1443
175 Ga0265332_10154368 3300031238 Bacteria 960
176 Ga0265320_10000801 3300031240 Bacteria 23887
177 Ga0265325_10000809 3300031241 Bacteria 22626
178 Ga0265325_10009988 3300031241 Bacteria 5517
179 Ga0265325_10012469 3300031241 Bacteria 4860
180 Ga0265325_10019893 3300031241 Bacteria 3706
181 Ga0265340_10002765 3300031247 Bacteria 9997
182 Ga0265340_10010247 3300031247 Bacteria 5016
183 Ga0265340_10020859 3300031247 Bacteria 3362
184 Ga0265339_10004571 3300031249 Bacteria 9424
185 Ga0265331_10000003 3300031250 Bacteria 499358
186 Ga0265331_10004471 3300031250 Bacteria 8726
187 Ga0265331_10012713 3300031250 Bacteria 4549
188 Ga0265331_10138944 3300031250 Bacteria 1106
189 Ga0265331_10230485 3300031250 Bacteria 832
190 Ga0265327_10000414 3300031251 Bacteria 78352
191 Ga0265327_10001092 3300031251 Bacteria 37637
192 Ga0265316_10256282 3300031344 Unclassified 1283
193 Ga0265313_10001177 3300031595 Bacteria 25003
194 Ga0265313_10003595 3300031595 Bacteria 12458
195 Ga0265313_10013427 3300031595 Bacteria 4917
196 Ga0316575_10033840 3300031665 Bacteria 2006
197 Ga0265314_10001607 3300031711 Bacteria 24822
198 Ga0265314_10019370 3300031711 Bacteria 5273
199 Ga0265314_10020907 3300031711 Bacteria 5045
200 Ga0265314_10021234 3300031711 Bacteria 4998
201 Ga0265314_10028081 3300031711 Bacteria 4200
202 Ga0265314_10092170 3300031711 Bacteria 1970
203 Ga0265314_10097092 3300031711 Bacteria 1904
204 Ga0265342_10016481 3300031712 Bacteria 4828
205 Ga0265342_10035120 3300031712 Bacteria 3071
206 Ga0307410_10113452 3300031852 Bacteria 1965
207 Ga0307406_10516762 3300031901 Bacteria 971
208 Ga0307412_10000409 3300031911 Bacteria 26195
209 Ga0316583_10017260 3300032133 Bacteria 2596
210 Ga0373934_0076450 3300035086 Bacteria 1343
211 Ga0373940_0104943 3300035088 Bacteria 862
212 Ga0373957_0221045 3300035120 Bacteria 793
213 Ga0373943_0002675 3300035170 Bacteria 8101
214 Ga0373955_0200886 3300035172 Bacteria 1187
215 Ga0373935_0043442 3300035692 Bacteria 2828
216 Ga0373927_0115126 3300035695 Bacteria 1753
217 Ga0373933_0072424 3300035724 Bacteria 2099
218 Ga0373947_0203717 3300035725 Bacteria 1296
219 Ga0373937_0004265 3300036401 Bacteria 12117
220 Ga0373937_0006118 3300036401 Bacteria 10361
221 Ga0373937_0075594 3300036401 Bacteria 3110
222 Ga0373937_0221806 3300036401 Bacteria 1780
223 Ga0316582_0061969 3300036647 Bacteria 2401
224 Ga0316584_0160965 3300036712 Bacteria 1668
225 Ga0373925_0003984 3300037068 Bacteria 11258
226 Ga0395899_0166234 3300037312 Bacteria 1556
227 Ga0395898_0044205 3300037466 Bacteria 4387
228 Ga0395901_0041862 3300038443 Bacteria 4748
229 Ga0436365_0943727 3300039437 Bacteria 72096
230 Ga0436365_1532329 3300039437 Bacteria 4091
231 Ga0436365_1650855 3300039437 Bacteria 128546
232 Ga0436363_0436423 3300039450 Bacteria 7095
233 Ga0436363_0610517 3300039450 Bacteria 2129
234 Ga0439436_0000109 3300041404 Bacteria 19183
235 Ga0439436_0079877 3300041404 Bacteria 910
236 Ga0450908_000442 3300042184 Bacteria 8062
237 Ga0466982_0000076 3300044672 Bacteria 25815
238 Ga0466961_0129904 3300044693 Bacteria 1579
239 Ga0466957_0814226 3300044842 Bacteria 664
240 Ga0495617_000819 3300046452 Bacteria 14924
241 Ga0495638_0001393 3300046460 Bacteria 22041
242 Ga0495638_0060354 3300046460 Bacteria 2346
243 Ga0495650_0001294 3300046471 Bacteria 25431
244 Ga0495650_0128134 3300046471 Bacteria 928
245 Ga0495580_0009019 3300046472 Bacteria 7874
246 Ga0495580_0032315 3300046472 Bacteria 3778
247 Ga0495580_0062871 3300046472 Bacteria 2604
248 Ga0495580_0207219 3300046472 Unclassified 1350
249 Ga0495582_0049984 3300046473 Bacteria 2303
250 Ga0495584_0027248 3300046491 Bacteria 2895
251 Ga0495585_0001164 3300046492 Bacteria 21400
252 Ga0495607_0000247 3300046501 Bacteria 57993
253 Ga0495607_0001296 3300046501 Bacteria 22305
254 Ga0495607_0019603 3300046501 Bacteria 4294
255 Ga0495607_0065478 3300046501 Bacteria 2049
256 Ga0495583_0041117 3300046506 Bacteria 2167
257 Ga0495606_0002600 3300046507 Bacteria 20645
258 Ga0495606_0007504 3300046507 Bacteria 9737
259 Ga0495610_0003286 3300046512 Bacteria 12737
260 Ga0495610_0103900 3300046512 Bacteria 1268
261 Ga0495616_0001330 3300046513 Bacteria 17268
262 Ga0495616_0019547 3300046513 Bacteria 3695
263 Ga0495620_0002194 3300046515 Bacteria 11336
264 Ga0495631_0000153 3300046518 Bacteria 47259
265 Ga0495631_0007682 3300046518 Bacteria 5474
266 Ga0495632_0000008 3300046519 Bacteria 294056
267 Ga0495632_0006156 3300046519 Bacteria 7771
268 Ga0495632_0013076 3300046519 Bacteria 4754
269 Ga0495637_0036906 3300046520 Bacteria 2125
270 Ga0495648_0011086 3300046524 Bacteria 6825
271 Ga0495648_0012908 3300046524 Bacteria 6204
272 Ga0495652_0112295 3300046529 Bacteria 2190
273 Ga0495652_0309800 3300046529 Bacteria 1144
274 Ga0495587_0102714 3300046536 Bacteria 1646
275 Ga0495587_0273244 3300046536 Unclassified 948
276 Ga0495609_0007060 3300046538 Bacteria 5652
277 Ga0495645_0057017 3300046543 Unclassified 2836
278 Ga0495645_0081310 3300046543 Bacteria 2324
279 Ga0495668_0037616 3300046616 Bacteria 2707
280 Ga0495611_0000029 3300046648 Bacteria 115887
281 Ga0495611_0000076 3300046648 Bacteria 69480
282 Ga0495625_0000260 3300046660 Bacteria 82175
283 Ga0495625_0020854 3300046660 Bacteria 5052
284 Ga0495625_0071849 3300046660 Bacteria 2427
285 Ga0495659_0014748 3300046664 Bacteria 2563
286 Ga0495661_0001341 3300046665 Bacteria 20869
287 Ga0495613_0247072 3300046689 Bacteria 1246
288 Ga0495670_0001129 3300046691 Bacteria 12956
289 Ga0495670_0001187 3300046691 Bacteria 12636
290 Ga0495670_0005369 3300046691 Bacteria 6301
291 Ga0495671_0000545 3300046692 Bacteria 28273
292 Ga0495589_0000144 3300046794 Bacteria 65654
293 Ga0495660_0001067 3300046810 Bacteria 19811
294 Ga0495660_0001338 3300046810 Bacteria 16974
295 Ga0495674_0096981 3300047319 Bacteria 2512
296 Ga0495683_0031801 3300047323 Bacteria 2688
297 Ga0495675_0238175 3300047444 Unclassified 1096
298 Ga0495679_000091 3300047446 Bacteria 82366
299 Ga0495673_0000175 3300047469 Bacteria 105273
300 Ga0495673_0000548 3300047469 Bacteria 38312
301 Ga0495673_0002420 3300047469 Bacteria 13144
302 Ga0495686_0001999 3300047472 Bacteria 20216
303 Ga0495686_0043527 3300047472 Bacteria 2845
304 Ga0495686_0065907 3300047472 Bacteria 2238
305 Ga0495602_0144145 3300048088 Unclassified 1882
306 Ga0496100_0002831 3300048903 Bacteria 8892
307 Ga0496106_0002506 3300048909 Bacteria 13675
308 Ga0496106_0341355 3300048909 Bacteria 1203
309 Ga0496111_0059383 3300048914 Bacteria 2771
310 Ga0496118_0094185 3300048921 Bacteria 2049
311 Ga0496119_0004342 3300048922 Bacteria 14149
312 Ga0496121_0004608 3300048924 Bacteria 18364
313 Ga0496121_0008190 3300048924 Bacteria 12408
314 Ga0496122_0017937 3300048925 Bacteria 6570
315 Ga0496123_0039567 3300048926 Bacteria 3296
316 Ga0496124_0004967 3300048927 Bacteria 15213
317 Ga0496124_0006167 3300048927 Bacteria 13144
318 Ga0496126_0338168 3300048929 Bacteria 1234
319 Ga0495678_000762 3300049459 Bacteria 29192
320 Ga0495682_0003228 3300049460 Bacteria 7324
321 Ga0495682_0005280 3300049460 Bacteria 5393
322 Ga0495682_0016053 3300049460 Bacteria 2833
323 Ga0501032_0056289 3300049569 Bacteria 2644
324 Ga0501032_0117279 3300049569 Bacteria 1760
325 Ga0501033_0014863 3300049570 Bacteria 5910
326 Ga0501033_0083654 3300049570 Bacteria 2339
327 Ga0501033_0113384 3300049570 Bacteria 1971
328 Ga0501033_0410902 3300049570 Bacteria 943
329 Ga0501034_0066879 3300049571 Bacteria 3607
330 Ga0501034_0070139 3300049571 Bacteria 3516
331 Ga0501034_0131395 3300049571 Bacteria 2487
332 Ga0501034_0178018 3300049571 Bacteria 2092
333 Ga0501034_0230320 3300049571 Bacteria 1802
334 Ga0501036_0030751 3300049572 Bacteria 4536
335 Ga0501037_0123477 3300049573 Bacteria 1860
336 Ga0501037_0188843 3300049573 Bacteria 1460
337 Ga0501037_0358724 3300049573 Bacteria 1004
338 Ga0501037_0395793 3300049573 Bacteria 948
339 Ga0501038_0126312 3300049574 Bacteria 2105
340 Ga0501043_0025665 3300049579 Bacteria 4623
341 Ga0501043_0147411 3300049579 Bacteria 1842
342 Ga0501047_0021052 3300049581 Bacteria 6262
343 Ga0501047_0029385 3300049581 Bacteria 5301
344 Ga0501047_0050647 3300049581 Bacteria 4010
345 Ga0501047_0056378 3300049581 Bacteria 3799
346 Ga0501047_0129512 3300049581 Bacteria 2404
347 Ga0501067_0000388 3300049583 Bacteria 23959
348 Ga0501067_0006032 3300049583 Bacteria 6717
349 Ga0501069_0016851 3300049585 Unclassified 3926
350 Ga0501070_0000015 3300049586 Bacteria 179449
351 Ga0501072_0009159 3300049588 Bacteria 7521
352 Ga0501072_0253802 3300049588 Bacteria 1400
353 Ga0501073_0018031 3300049589 Bacteria 5104
354 Ga0501073_0060991 3300049589 Bacteria 2632
355 Ga0501074_0037839 3300049590 Bacteria 3496
356 Ga0501079_0042690 3300049741 Bacteria 3501
357 Ga0501079_0136419 3300049741 Bacteria 1910
358 Ga0501079_0611046 3300049741 Unclassified 858
359 Ga0501080_0002648 3300049742 Bacteria 15660
360 Ga0501080_0106417 3300049742 Bacteria 2599
361 Ga0501080_0128178 3300049742 Bacteria 2349
362 Ga0501080_0302414 3300049742 Bacteria 1450
363 Ga0501083_0291111 3300049744 Bacteria 1062
364 Ga0501035_0005672 3300049822 Bacteria 11783
365 Ga0501035_0016894 3300049822 Bacteria 6728
366 Ga0501035_0038017 3300049822 Bacteria 4358
367 Ga0501035_0066571 3300049822 Bacteria 3197
368 Ga0501035_0076000 3300049822 Bacteria 2970
369 Ga0501035_0079324 3300049822 Bacteria 2900
370 Ga0501044_0001308 3300049823 Bacteria 29339
371 Ga0501044_0012721 3300049823 Bacteria 9114
372 Ga0501044_0013613 3300049823 Bacteria 8793
373 Ga0501044_0031805 3300049823 Bacteria 5550
374 Ga0501044_0048396 3300049823 Bacteria 4392
375 Ga0501044_0207801 3300049823 Bacteria 1913
376 nmdc:mga08y16_49304_c1 3300050511 Bacteria 4407
377 nmdc:mga0sz30_85928_c1 3300050516 Bacteria 1365
378 Ga0500643_000120 3300053087 Bacteria 81701
379 Ga0500555_002408 3300053103 Bacteria 5438
380 Ga0500562_057890 3300053108 Bacteria 1040
381 Ga0500655_020371 3300053133 Bacteria 1238
382 Ga0500633_0014068 3300053160 Bacteria 2261
383 Ga0500645_004364 3300053730 Bacteria 5437
384 Ga0501084_0014235 3300054114 Bacteria 6587
385 Ga0501084_0037793 3300054114 Bacteria 4035
386 Ga0501084_0049469 3300054114 Bacteria 3519
387 Ga0501082_0517547 3300060353 Bacteria 1043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0019547 Ga0495616_0019547_1257_1982 202
2 3300046660 Ga0495625_0020854 Ga0495625_0020854_4057_4782 202
3 3300044842 Ga0466957_0814226 Ga0466957_0814226_11_631 206
4 3300049570 Ga0501033_0410902 Ga0501033_0410902_11_643 210
5 3300049571 Ga0501034_0178018 Ga0501034_0178018_14_646 210
6 3300014325 Ga0163163_10486535 Ga0163163_104865352 211
7 3300031238 Ga0265332_10049509 Ga0265332_100495092 216
8 3300031241 Ga0265325_10012469 Ga0265325_100124693 216
9 3300031595 Ga0265313_10003595 Ga0265313_100035952 216
10 3300031711 Ga0265314_10092170 Ga0265314_100921702 216
11 3300005329 Ga0070683_100768575 Ga0070683_1007685751 217
12 3300028800 Ga0265338_10009876 Ga0265338_1000987611 217
13 3300031712 Ga0265342_10035120 Ga0265342_100351202 217
14 3300035088 Ga0373940_0104943 Ga0373940_0104943_14_673 219
15 3300006163 Ga0070715_10228363 Ga0070715_102283631 221
16 3300035725 Ga0373947_0203717 Ga0373947_0203717_100_834 221
17 3300006237 Ga0097621_100232825 Ga0097621_1002328252 222
18 3300006358 Ga0068871_100055957 Ga0068871_1000559572 222
19 3300021377 Ga0213874_10008193 Ga0213874_100081932 223
20 3300039450 Ga0436363_0436423 Ga0436363_0436423_1182_1916 223
21 3300005458 Ga0070681_10225057 Ga0070681_102250572 224
22 3300035120 Ga0373957_0221045 Ga0373957_0221045_15_749 225
23 3300036401 Ga0373937_0075594 Ga0373937_0075594_1821_2555 225
24 3300005530 Ga0070679_100536238 Ga0070679_1005362382 226
25 3300005539 Ga0068853_100001947 Ga0068853_10000194713 227
26 3300026041 Ga0207639_10002186 Ga0207639_100021864 227
27 3300031712 Ga0265342_10016481 Ga0265342_100164813 227
28 3300009093 Ga0105240_10348512 Ga0105240_103485121 228
29 3300009094 Ga0111539_10231556 Ga0111539_102315562 229
30 3300035172 Ga0373955_0200886 Ga0373955_0200886_20_751 229
31 3300050511 nmdc:mga08y16_49304_c1 nmdc:mga08y16_49304_c1_3090_3812 229
32 3300035086 Ga0373934_0076450 Ga0373934_0076450_180_914 230
33 3300035724 Ga0373933_0072424 Ga0373933_0072424_1330_2064 230
34 3300036401 Ga0373937_0004265 Ga0373937_0004265_1091_1825 230
35 3300014326 Ga0157380_10266729 Ga0157380_102667292 231
36 3300025938 Ga0207704_10432282 Ga0207704_104322822 231
37 3300049588 Ga0501072_0253802 Ga0501072_0253802_197_931 231
38 3300054114 Ga0501084_0049469 Ga0501084_0049469_853_1587 231
39 3300005439 Ga0070711_100030947 Ga0070711_1000309475 232
40 3300006175 Ga0070712_100002406 Ga0070712_1000024065 232
41 3300014968 Ga0157379_10004217 Ga0157379_100042173 232
42 3300025915 Ga0207693_10000079 Ga0207693_1000007927 232
43 3300025916 Ga0207663_10027338 Ga0207663_100273382 232
44 3300028800 Ga0265338_10041512 Ga0265338_100415124 232
45 3300031241 Ga0265325_10000809 Ga0265325_100008092 232
46 3300031249 Ga0265339_10004571 Ga0265339_100045714 232
47 3300031250 Ga0265331_10230485 Ga0265331_102304851 232
48 3300031595 Ga0265313_10001177 Ga0265313_100011774 232
49 3300036401 Ga0373937_0006118 Ga0373937_0006118_699_1433 232
50 3300046472 Ga0495580_0062871 Ga0495580_0062871_1249_1983 232
51 3300048909 Ga0496106_0341355 Ga0496106_0341355_390_1124 232
52 3300048914 Ga0496111_0059383 Ga0496111_0059383_232_966 232
53 3300005336 Ga0070680_100433429 Ga0070680_1004334292 233
54 3300005563 Ga0068855_100023900 Ga0068855_1000239004 233
55 3300005843 Ga0068860_100182711 Ga0068860_1001827112 233
56 3300006844 Ga0075428_100082727 Ga0075428_1000827275 233
57 3300009093 Ga0105240_10045106 Ga0105240_100451064 233
58 3300009545 Ga0105237_10027958 Ga0105237_100279583 233
59 3300009551 Ga0105238_10114926 Ga0105238_101149263 233
60 3300014968 Ga0157379_10036150 Ga0157379_100361504 233
61 3300025914 Ga0207671_10073799 Ga0207671_100737992 233
62 3300025949 Ga0207667_10013394 Ga0207667_100133943 233
63 3300026035 Ga0207703_10326363 Ga0207703_103263632 233
64 3300027907 Ga0207428_10261895 Ga0207428_102618952 233
65 3300031247 Ga0265340_10010247 Ga0265340_100102473 233
66 3300046472 Ga0495580_0207219 Ga0495580_0207219_97_831 233
67 3300046536 Ga0495587_0102714 Ga0495587_0102714_180_926 233
68 3300005327 Ga0070658_10028786 Ga0070658_100287862 234
69 3300005335 Ga0070666_10009608 Ga0070666_100096083 234
70 3300005548 Ga0070665_100253814 Ga0070665_1002538142 234
71 3300005563 Ga0068855_100016425 Ga0068855_1000164254 234
72 3300005563 Ga0068855_100137597 Ga0068855_1001375972 234
73 3300005563 Ga0068855_100446900 Ga0068855_1004469002 234
74 3300005577 Ga0068857_100405770 Ga0068857_1004057702 234
75 3300006881 Ga0068865_100021465 Ga0068865_1000214652 234
76 3300009093 Ga0105240_10012354 Ga0105240_1001235413 234
77 3300009093 Ga0105240_10117279 Ga0105240_101172792 234
78 3300009174 Ga0105241_10393686 Ga0105241_103936862 234
79 3300009177 Ga0105248_10195096 Ga0105248_101950962 234
80 3300009545 Ga0105237_10028534 Ga0105237_100285344 234
81 3300009545 Ga0105237_10049898 Ga0105237_100498982 234
82 3300009545 Ga0105237_10810097 Ga0105237_108100972 234
83 3300009551 Ga0105238_10065151 Ga0105238_100651513 234
84 3300010375 Ga0105239_10207978 Ga0105239_102079782 234
85 3300013307 Ga0157372_10679134 Ga0157372_106791342 234
86 3300021384 Ga0213876_10000235 Ga0213876_100002359 234
87 3300025903 Ga0207680_10001208 Ga0207680_100012089 234
88 3300025909 Ga0207705_10059938 Ga0207705_100599382 234
89 3300025909 Ga0207705_10216714 Ga0207705_102167142 234
90 3300025911 Ga0207654_10088507 Ga0207654_100885072 234
91 3300025913 Ga0207695_10035573 Ga0207695_100355732 234
92 3300025913 Ga0207695_10109782 Ga0207695_101097822 234
93 3300025913 Ga0207695_10154297 Ga0207695_101542972 234
94 3300025913 Ga0207695_10549803 Ga0207695_105498032 234
95 3300025914 Ga0207671_10050585 Ga0207671_100505853 234
96 3300025924 Ga0207694_10055827 Ga0207694_100558272 234
97 3300025941 Ga0207711_10224280 Ga0207711_102242802 234
98 3300025949 Ga0207667_10235247 Ga0207667_102352473 234
99 3300025986 Ga0207658_10144565 Ga0207658_101445652 234
100 3300026116 Ga0207674_10018536 Ga0207674_100185365 234
101 3300028379 Ga0268266_10016857 Ga0268266_100168574 234
102 3300031250 Ga0265331_10138944 Ga0265331_101389442 234
103 3300031711 Ga0265314_10028081 Ga0265314_100280817 234
104 3300037312 Ga0395899_0166234 Ga0395899_0166234_309_1043 234
105 3300037466 Ga0395898_0044205 Ga0395898_0044205_1357_2091 234
106 3300038443 Ga0395901_0041862 Ga0395901_0041862_197_931 234
107 3300039437 Ga0436365_1650855 Ga0436365_1650855_121698_122432 234
108 3300049570 Ga0501033_0014863 Ga0501033_0014863_4157_4891 234
109 3300049579 Ga0501043_0147411 Ga0501043_0147411_343_1077 234
110 3300049581 Ga0501047_0029385 Ga0501047_0029385_4092_4826 234
111 3300049822 Ga0501035_0038017 Ga0501035_0038017_3334_4068 234
112 3300049823 Ga0501044_0012721 Ga0501044_0012721_3322_4056 234
113 3300005338 Ga0068868_100102570 Ga0068868_1001025702 235
114 3300005539 Ga0068853_100488391 Ga0068853_1004883911 235
115 3300026023 Ga0207677_10102202 Ga0207677_101022022 235
116 3300026041 Ga0207639_10430767 Ga0207639_104307672 235
117 3300028800 Ga0265338_10110897 Ga0265338_101108972 235
118 3300039437 Ga0436365_1532329 Ga0436365_1532329_828_1562 235
119 3300049571 Ga0501034_0230320 Ga0501034_0230320_64_798 235
120 3300005439 Ga0070711_100093953 Ga0070711_1000939532 236
121 3300005471 Ga0070698_100504365 Ga0070698_1005043652 236
122 3300049571 Ga0501034_0131395 Ga0501034_0131395_1256_1990 236
123 3300049581 Ga0501047_0021052 Ga0501047_0021052_1892_2626 236
124 3300049583 Ga0501067_0000388 Ga0501067_0000388_19742_20476 236
125 3300049588 Ga0501072_0009159 Ga0501072_0009159_2339_3073 236
126 3300049589 Ga0501073_0018031 Ga0501073_0018031_3982_4716 236
127 3300049741 Ga0501079_0042690 Ga0501079_0042690_2638_3372 236
128 3300049742 Ga0501080_0302414 Ga0501080_0302414_437_1171 236
129 3300054114 Ga0501084_0037793 Ga0501084_0037793_607_1341 236
130 3300060353 Ga0501082_0517547 Ga0501082_0517547_27_761 236
131 3300028800 Ga0265338_10034326 Ga0265338_100343267 237
132 3300031238 Ga0265332_10154368 Ga0265332_101543682 237
133 3300046810 Ga0495660_0001338 Ga0495660_0001338_5039_5752 237
134 3300047469 Ga0495673_0000175 Ga0495673_0000175_19823_20536 237
135 3300025917 Ga0207660_10399752 Ga0207660_103997522 238
136 3300046471 Ga0495650_0128134 Ga0495650_0128134_197_913 238
137 3300005336 Ga0070680_100000724 Ga0070680_1000007249 239
138 3300005458 Ga0070681_10000010 Ga0070681_1000001065 239
139 3300005530 Ga0070679_100001075 Ga0070679_10000107517 239
140 3300010375 Ga0105239_10002698 Ga0105239_100026988 239
141 3300025912 Ga0207707_10000005 Ga0207707_1000000565 239
142 3300025917 Ga0207660_10002390 Ga0207660_100023903 239
143 3300025921 Ga0207652_10000068 Ga0207652_1000006844 239
144 3300031240 Ga0265320_10000801 Ga0265320_1000080115 239
145 3300031241 Ga0265325_10009988 Ga0265325_100099888 239
146 3300031250 Ga0265331_10012713 Ga0265331_100127135 239
147 3300044693 Ga0466961_0129904 Ga0466961_0129904_379_1113 239
148 iso_pu_bacteria 2593339238 2595448021 240
149 iso_pu_bacteria 2593339239 2595451317 240
150 iso_pu_bacteria 2734482264 2735835746 240
151 iso_pu_bacteria 2738543009 2739227048 240
152 iso_pu_bacteria 2842914999 2842918218 240
153 iso_pu_bacteria 2842918807 2842922194 240
154 iso_pu_bacteria 2895395659 2895397051 240
155 iso_pu_bacteria 2919085039 2919086837 240
156 iso_pu_bacteria 2919404418 2919408100 240
157 iso_pu_bacteria 2953994433 2953997311 240
158 3300014497 Ga0182008_10000889 Ga0182008_100008892 241
159 3300031711 Ga0265314_10020907 Ga0265314_100209072 241
160 3300005435 Ga0070714_100019936 Ga0070714_1000199366 242
161 3300025929 Ga0207664_10026725 Ga0207664_100267256 242
162 3300049569 Ga0501032_0117279 Ga0501032_0117279_923_1654 243
163 3300049570 Ga0501033_0083654 Ga0501033_0083654_1331_2062 243
164 3300049573 Ga0501037_0358724 Ga0501037_0358724_113_844 243
165 3300049581 Ga0501047_0129512 Ga0501047_0129512_1142_1873 243
166 3300049586 Ga0501070_0000015 Ga0501070_0000015_132661_133392 243
167 3300049741 Ga0501079_0611046 Ga0501079_0611046_81_812 243
168 3300049742 Ga0501080_0002648 Ga0501080_0002648_3841_4572 243
169 3300049822 Ga0501035_0005672 Ga0501035_0005672_2821_3552 243
170 3300049823 Ga0501044_0001308 Ga0501044_0001308_17088_17819 243
171 3300003320 rootH2_10106885 rootH2_101068855 244
172 3300003578 Ga0006562J51391_1149534 Ga0006562J51391_11495344 244
173 3300003578 Ga0006562J51391_1149536 Ga0006562J51391_11495362 244
174 3300005262 Ga0065165_1000108 Ga0065165_1000108113 244
175 3300005330 Ga0070690_100389054 Ga0070690_1003890541 244
176 3300005336 Ga0070680_100006875 Ga0070680_1000068753 244
177 3300005339 Ga0070660_100268457 Ga0070660_1002684572 244
178 3300005344 Ga0070661_100000360 Ga0070661_10000036014 244
179 3300005344 Ga0070661_100017286 Ga0070661_1000172862 244
180 3300005344 Ga0070661_100036785 Ga0070661_1000367853 244
181 3300005435 Ga0070714_100118761 Ga0070714_1001187612 244
182 3300005458 Ga0070681_10013143 Ga0070681_100131432 244
183 3300005530 Ga0070679_100011487 Ga0070679_1000114872 244
184 3300005539 Ga0068853_100538609 Ga0068853_1005386091 244
185 3300005544 Ga0070686_100108344 Ga0070686_1001083442 244
186 3300005546 Ga0070696_100002124 Ga0070696_10000212414 244
187 3300005546 Ga0070696_100446924 Ga0070696_1004469241 244
188 3300005563 Ga0068855_100000034 Ga0068855_100000034134 244
189 3300005578 Ga0068854_100158121 Ga0068854_1001581212 244
190 3300005614 Ga0068856_100000447 Ga0068856_10000044721 244
191 3300005616 Ga0068852_100001775 Ga0068852_10000177510 244
192 3300005937 Ga0081455_10003906 Ga0081455_1000390617 244
193 3300006237 Ga0097621_100097701 Ga0097621_1000977012 244
194 3300006358 Ga0068871_100145129 Ga0068871_1001451292 244
195 3300009093 Ga0105240_10000382 Ga0105240_1000038214 244
196 3300009093 Ga0105240_10070497 Ga0105240_100704972 244
197 3300009101 Ga0105247_10002256 Ga0105247_100022565 244
198 3300009101 Ga0105247_10016589 Ga0105247_100165892 244
199 3300009174 Ga0105241_10030426 Ga0105241_100304262 244
200 3300009177 Ga0105248_10128348 Ga0105248_101283482 244
201 3300009545 Ga0105237_10658674 Ga0105237_106586742 244
202 3300009551 Ga0105238_10019434 Ga0105238_100194341 244
203 3300009551 Ga0105238_10183043 Ga0105238_101830432 244
204 3300009551 Ga0105238_10193669 Ga0105238_101936691 244
205 3300010375 Ga0105239_10001611 Ga0105239_1000161117 244
206 3300010375 Ga0105239_10038394 Ga0105239_100383944 244
207 3300013102 Ga0157371_10009283 Ga0157371_100092837 244
208 3300013104 Ga0157370_10000272 Ga0157370_1000027243 244
209 3300013104 Ga0157370_10190578 Ga0157370_101905782 244
210 3300013105 Ga0157369_10007410 Ga0157369_1000741010 244
211 3300013105 Ga0157369_10007650 Ga0157369_100076509 244
212 3300013105 Ga0157369_10062014 Ga0157369_100620144 244
213 3300013307 Ga0157372_10002339 Ga0157372_100023398 244
214 3300013307 Ga0157372_10086540 Ga0157372_100865404 244
215 3300013307 Ga0157372_10207136 Ga0157372_102071363 244
216 3300014325 Ga0163163_10882989 Ga0163163_108829892 244
217 3300014497 Ga0182008_10027123 Ga0182008_100271232 244
218 3300015261 Ga0182006_1000034 Ga0182006_1000034202 244
219 3300015261 Ga0182006_1000563 Ga0182006_100056324 244
220 3300015262 Ga0182007_10002936 Ga0182007_100029362 244
221 3300015265 Ga0182005_1000362 Ga0182005_10003629 244
222 3300015265 Ga0182005_1000900 Ga0182005_10009002 244
223 3300015265 Ga0182005_1001909 Ga0182005_10019095 244
224 3300021384 Ga0213876_10000198 Ga0213876_100001986 244
225 3300025226 Ga0209674_100539 Ga0209674_1005395 244
226 3300025231 Ga0207427_110111 Ga0207427_1101112 244
227 3300025233 Ga0209437_100744 Ga0209437_10074415 244
228 3300025254 Ga0209148_1001545 Ga0209148_10015455 244
229 3300025258 Ga0209129_1001227 Ga0209129_10012276 244
230 3300025291 Ga0209675_1002156 Ga0209675_10021567 244
231 3300025297 Ga0209758_1025577 Ga0209758_10255772 244
232 3300025299 Ga0209256_1002466 Ga0209256_100246613 244
233 3300025302 Ga0207426_1010198 Ga0207426_10101982 244
234 3300025900 Ga0207710_10010076 Ga0207710_100100762 244
235 3300025912 Ga0207707_10076080 Ga0207707_100760801 244
236 3300025913 Ga0207695_10000004 Ga0207695_100000041112 244
237 3300025917 Ga0207660_10030236 Ga0207660_100302362 244
238 3300025918 Ga0207662_10183911 Ga0207662_101839112 244
239 3300025920 Ga0207649_10000822 Ga0207649_100008223 244
240 3300025920 Ga0207649_10083037 Ga0207649_100830372 244
241 3300025920 Ga0207649_10200234 Ga0207649_102002342 244
242 3300025921 Ga0207652_10327306 Ga0207652_103273062 244
243 3300025924 Ga0207694_10000010 Ga0207694_10000010151 244
244 3300025925 Ga0207650_10057323 Ga0207650_100573233 244
245 3300025928 Ga0207700_10334801 Ga0207700_103348012 244
246 3300025929 Ga0207664_10062654 Ga0207664_100626543 244
247 3300025934 Ga0207686_10040265 Ga0207686_100402652 244
248 3300025949 Ga0207667_10000065 Ga0207667_1000006576 244
249 3300026041 Ga0207639_10199235 Ga0207639_101992353 244
250 3300026067 Ga0207678_10058486 Ga0207678_100584862 244
251 3300026078 Ga0207702_10000644 Ga0207702_1000064416 244
252 3300026078 Ga0207702_10255730 Ga0207702_102557302 244
253 3300026142 Ga0207698_10243440 Ga0207698_102434402 244
254 3300028556 Ga0265337_1001180 Ga0265337_10011802 244
255 3300028573 Ga0265334_10007647 Ga0265334_100076473 244
256 3300028577 Ga0265318_10000071 Ga0265318_1000007153 244
257 3300031238 Ga0265332_10074576 Ga0265332_100745762 244
258 3300031241 Ga0265325_10019893 Ga0265325_100198932 244
259 3300031247 Ga0265340_10002765 Ga0265340_100027655 244
260 3300031247 Ga0265340_10020859 Ga0265340_100208592 244
261 3300031250 Ga0265331_10000003 Ga0265331_10000003315 244
262 3300031250 Ga0265331_10004471 Ga0265331_100044714 244
263 3300031251 Ga0265327_10000414 Ga0265327_1000041427 244
264 3300031251 Ga0265327_10001092 Ga0265327_1000109214 244
265 3300031344 Ga0265316_10256282 Ga0265316_102562822 244
266 3300031595 Ga0265313_10013427 Ga0265313_100134274 244
267 3300031665 Ga0316575_10033840 Ga0316575_100338402 244
268 3300031711 Ga0265314_10001607 Ga0265314_1000160714 244
269 3300031711 Ga0265314_10019370 Ga0265314_100193702 244
270 3300031711 Ga0265314_10021234 Ga0265314_100212342 244
271 3300031711 Ga0265314_10097092 Ga0265314_100970922 244
272 3300031852 Ga0307410_10113452 Ga0307410_101134522 244
273 3300031901 Ga0307406_10516762 Ga0307406_105167621 244
274 3300031911 Ga0307412_10000409 Ga0307412_1000040921 244
275 3300032133 Ga0316583_10017260 Ga0316583_100172602 244
276 3300035170 Ga0373943_0002675 Ga0373943_0002675_7062_7796 244
277 3300035692 Ga0373935_0043442 Ga0373935_0043442_796_1530 244
278 3300035695 Ga0373927_0115126 Ga0373927_0115126_868_1602 244
279 3300036401 Ga0373937_0221806 Ga0373937_0221806_293_1027 244
280 3300036647 Ga0316582_0061969 Ga0316582_0061969_1309_2046 244
281 3300036712 Ga0316584_0160965 Ga0316584_0160965_206_943 244
282 3300037068 Ga0373925_0003984 Ga0373925_0003984_306_1040 244
283 3300039437 Ga0436365_0943727 Ga0436365_0943727_65082_65816 244
284 3300039450 Ga0436363_0610517 Ga0436363_0610517_159_893 244
285 3300041404 Ga0439436_0000109 Ga0439436_0000109_18415_19149 244
286 3300041404 Ga0439436_0079877 Ga0439436_0079877_103_837 244
287 3300042184 Ga0450908_000442 Ga0450908_000442_5336_6070 244
288 3300044672 Ga0466982_0000076 Ga0466982_0000076_5798_6532 244
289 3300046452 Ga0495617_000819 Ga0495617_000819_510_1244 244
290 3300046460 Ga0495638_0001393 Ga0495638_0001393_19964_20698 244
291 3300046460 Ga0495638_0060354 Ga0495638_0060354_110_844 244
292 3300046471 Ga0495650_0001294 Ga0495650_0001294_18537_19271 244
293 3300046472 Ga0495580_0009019 Ga0495580_0009019_5918_6652 244
294 3300046472 Ga0495580_0032315 Ga0495580_0032315_688_1422 244
295 3300046473 Ga0495582_0049984 Ga0495582_0049984_507_1241 244
296 3300046491 Ga0495584_0027248 Ga0495584_0027248_1119_1853 244
297 3300046492 Ga0495585_0001164 Ga0495585_0001164_19539_20273 244
298 3300046501 Ga0495607_0000247 Ga0495607_0000247_39320_40054 244
299 3300046501 Ga0495607_0001296 Ga0495607_0001296_20298_21032 244
300 3300046501 Ga0495607_0019603 Ga0495607_0019603_1382_2116 244
301 3300046501 Ga0495607_0065478 Ga0495607_0065478_1272_2006 244
302 3300046506 Ga0495583_0041117 Ga0495583_0041117_1212_1946 244
303 3300046507 Ga0495606_0002600 Ga0495606_0002600_1151_1885 244
304 3300046507 Ga0495606_0007504 Ga0495606_0007504_5467_6201 244
305 3300046512 Ga0495610_0003286 Ga0495610_0003286_4190_4924 244
306 3300046512 Ga0495610_0103900 Ga0495610_0103900_191_925 244
307 3300046513 Ga0495616_0001330 Ga0495616_0001330_11000_11734 244
308 3300046515 Ga0495620_0002194 Ga0495620_0002194_5832_6566 244
309 3300046518 Ga0495631_0000153 Ga0495631_0000153_27360_28094 244
310 3300046518 Ga0495631_0007682 Ga0495631_0007682_1119_1853 244
311 3300046519 Ga0495632_0000008 Ga0495632_0000008_275168_275902 244
312 3300046519 Ga0495632_0006156 Ga0495632_0006156_6072_6806 244
313 3300046519 Ga0495632_0013076 Ga0495632_0013076_3680_4414 244
314 3300046520 Ga0495637_0036906 Ga0495637_0036906_753_1487 244
315 3300046524 Ga0495648_0011086 Ga0495648_0011086_1168_1902 244
316 3300046524 Ga0495648_0012908 Ga0495648_0012908_1944_2678 244
317 3300046529 Ga0495652_0112295 Ga0495652_0112295_14_748 244
318 3300046529 Ga0495652_0309800 Ga0495652_0309800_104_838 244
319 3300046536 Ga0495587_0273244 Ga0495587_0273244_62_796 244
320 3300046538 Ga0495609_0007060 Ga0495609_0007060_3709_4443 244
321 3300046543 Ga0495645_0057017 Ga0495645_0057017_1958_2692 244
322 3300046543 Ga0495645_0081310 Ga0495645_0081310_1191_1925 244
323 3300046616 Ga0495668_0037616 Ga0495668_0037616_1440_2174 244
324 3300046648 Ga0495611_0000029 Ga0495611_0000029_60197_60931 244
325 3300046648 Ga0495611_0000076 Ga0495611_0000076_18537_19271 244
326 3300046660 Ga0495625_0000260 Ga0495625_0000260_20510_21244 244
327 3300046660 Ga0495625_0071849 Ga0495625_0071849_446_1180 244
328 3300046664 Ga0495659_0014748 Ga0495659_0014748_1017_1751 244
329 3300046665 Ga0495661_0001341 Ga0495661_0001341_19140_19874 244
330 3300046689 Ga0495613_0247072 Ga0495613_0247072_472_1206 244
331 3300046691 Ga0495670_0001129 Ga0495670_0001129_1202_1936 244
332 3300046691 Ga0495670_0001187 Ga0495670_0001187_10773_11507 244
333 3300046691 Ga0495670_0005369 Ga0495670_0005369_3268_4002 244
334 3300046692 Ga0495671_0000545 Ga0495671_0000545_3644_4378 244
335 3300046794 Ga0495589_0000144 Ga0495589_0000144_62607_63341 244
336 3300046810 Ga0495660_0001067 Ga0495660_0001067_17905_18639 244
337 3300047319 Ga0495674_0096981 Ga0495674_0096981_602_1336 244
338 3300047323 Ga0495683_0031801 Ga0495683_0031801_844_1578 244
339 3300047444 Ga0495675_0238175 Ga0495675_0238175_282_1016 244
340 3300047446 Ga0495679_000091 Ga0495679_000091_21417_22151 244
341 3300047469 Ga0495673_0000548 Ga0495673_0000548_18496_19230 244
342 3300047469 Ga0495673_0002420 Ga0495673_0002420_1186_1920 244
343 3300047472 Ga0495686_0001999 Ga0495686_0001999_6912_7646 244
344 3300047472 Ga0495686_0043527 Ga0495686_0043527_159_893 244
345 3300047472 Ga0495686_0065907 Ga0495686_0065907_397_1131 244
346 3300048088 Ga0495602_0144145 Ga0495602_0144145_162_896 244
347 3300048903 Ga0496100_0002831 Ga0496100_0002831_1299_2033 244
348 3300048909 Ga0496106_0002506 Ga0496106_0002506_6269_7003 244
349 3300048921 Ga0496118_0094185 Ga0496118_0094185_1249_1983 244
350 3300048922 Ga0496119_0004342 Ga0496119_0004342_5979_6713 244
351 3300048924 Ga0496121_0004608 Ga0496121_0004608_6363_7097 244
352 3300048924 Ga0496121_0008190 Ga0496121_0008190_1110_1844 244
353 3300048925 Ga0496122_0017937 Ga0496122_0017937_2751_3485 244
354 3300048926 Ga0496123_0039567 Ga0496123_0039567_1166_1900 244
355 3300048927 Ga0496124_0004967 Ga0496124_0004967_11159_11893 244
356 3300048927 Ga0496124_0006167 Ga0496124_0006167_1253_1987 244
357 3300048929 Ga0496126_0338168 Ga0496126_0338168_57_791 244
358 3300049459 Ga0495678_000762 Ga0495678_000762_20577_21311 244
359 3300049460 Ga0495682_0003228 Ga0495682_0003228_5436_6170 244
360 3300049460 Ga0495682_0005280 Ga0495682_0005280_1036_1770 244
361 3300049460 Ga0495682_0016053 Ga0495682_0016053_923_1657 244
362 3300049569 Ga0501032_0056289 Ga0501032_0056289_11_757 244
363 3300049570 Ga0501033_0113384 Ga0501033_0113384_45_779 244
364 3300049571 Ga0501034_0066879 Ga0501034_0066879_2639_3373 244
365 3300049571 Ga0501034_0070139 Ga0501034_0070139_690_1424 244
366 3300049572 Ga0501036_0030751 Ga0501036_0030751_2035_2769 244
367 3300049573 Ga0501037_0123477 Ga0501037_0123477_369_1103 244
368 3300049573 Ga0501037_0188843 Ga0501037_0188843_240_974 244
369 3300049573 Ga0501037_0395793 Ga0501037_0395793_111_845 244
370 3300049574 Ga0501038_0126312 Ga0501038_0126312_529_1263 244
371 3300049579 Ga0501043_0025665 Ga0501043_0025665_102_836 244
372 3300049581 Ga0501047_0050647 Ga0501047_0050647_3093_3827 244
373 3300049581 Ga0501047_0056378 Ga0501047_0056378_1426_2160 244
374 3300049583 Ga0501067_0006032 Ga0501067_0006032_2146_2880 244
375 3300049585 Ga0501069_0016851 Ga0501069_0016851_2958_3692 244
376 3300049589 Ga0501073_0060991 Ga0501073_0060991_1365_2111 244
377 3300049590 Ga0501074_0037839 Ga0501074_0037839_1842_2576 244
378 3300049741 Ga0501079_0136419 Ga0501079_0136419_496_1230 244
379 3300049742 Ga0501080_0106417 Ga0501080_0106417_108_842 244
380 3300049742 Ga0501080_0128178 Ga0501080_0128178_569_1303 244
381 3300049744 Ga0501083_0291111 Ga0501083_0291111_257_1003 244
382 3300049822 Ga0501035_0016894 Ga0501035_0016894_5883_6629 244
383 3300049822 Ga0501035_0066571 Ga0501035_0066571_467_1201 244
384 3300049822 Ga0501035_0076000 Ga0501035_0076000_1554_2288 244
385 3300049822 Ga0501035_0079324 Ga0501035_0079324_1192_1926 244
386 3300049823 Ga0501044_0013613 Ga0501044_0013613_3999_4733 244
387 3300049823 Ga0501044_0031805 Ga0501044_0031805_3107_3841 244
388 3300049823 Ga0501044_0048396 Ga0501044_0048396_800_1534 244
389 3300049823 Ga0501044_0207801 Ga0501044_0207801_184_918 244
390 3300050516 nmdc:mga0sz30_85928_c1 nmdc:mga0sz30_85928_c1_209_943 244
391 3300053087 Ga0500643_000120 Ga0500643_000120_79742_80476 244
392 3300053103 Ga0500555_002408 Ga0500555_002408_1136_1870 244
393 3300053108 Ga0500562_057890 Ga0500562_057890_235_969 244
394 3300053133 Ga0500655_020371 Ga0500655_020371_304_1038 244
395 3300053160 Ga0500633_0014068 Ga0500633_0014068_1393_2127 244
396 3300053730 Ga0500645_004364 Ga0500645_004364_1079_1813 244
397 3300054114 Ga0501084_0014235 Ga0501084_0014235_3689_4423 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

48

246

0.74

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

12

246

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o12-assembly1.cif.gz_E abc transporter nosdfy, amppnp-bound in gdn 0.7989 3 239
7qba-assembly1.cif.gz_E cryoem structure of the abc transporter nosdfy complexed with nitrous oxide reductase nosz 0.7958 3 238
7o12-assembly1.cif.gz_E abc transporter nosdfy, amppnp-bound in gdn 0.776 3 239
7r8b-assembly1.cif.gz_B the structure of human abcg5/abcg8 supplemented with cholesterol 0.7757 3 238
7o0z-assembly1.cif.gz_D abc transporter nosfy, nucleotide-free in gdn 0.7724 3 239
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.691 54 237 3.40.1710.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6129 7 238 1.10.3720.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6116 54 237 3.40.1710.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6054 7 238 1.10.3720.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5401 54 237 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7C1Z3M0-F1-model_v4 ABC transporter permease 0.9946 2 244 GO:0005886
GO:0140359
AF-A0A1E5A0B5-F1-model_v4 ABC transporter domain-containing protein 0.9941 3 244 GO:0005524
GO:0005886
GO:0016887
GO:0140359
AF-H5SHT7-F1-model_v4 ABC-2 type transport system permease protein 0.9924 1 239 GO:0005886
AF-A0A2V2SH66-F1-model_v4 ABC-type uncharacterized transport system domain-containing protein 0.9922 1 242 GO:0005886
GO:0140359
AF-A0A450WF97-F1-model_v4 ABC-2 type transport system permease protein 0.9921 1 244 GO:0005886
GO:0140359

Feature Viewer

pLDDT pTM Quality
88.72 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map