metagRoot

F433450

General Info

Members	Datasets	Scaffolds	Average Seq Length
396	266	389	160

Family's Representative Sequence

Representative Sequence	3300005539\|Ga0068853_100107441\|Ga0068853_1001074415
Length	176
Sequence	MRNVAAMDPSFRWDDGVRTMTNFAKAHLLALLLPLALMAGALGSQFIGGLYPCEMCHWQRWPHYTAITLVLLSFFLPQRGARRVLVLLAALAIAASGAIGVFHAGVEYGWWEGLTQCSTGLGSGGSGDTLADIWATPAIRCDVAQWTLFGISLAGFNAIFSLGGAVLILALWLKSR

Samples

	Sample ID	Description	Type	Environment
1	2643221563	Sphingopyxis sp. Root154	Isolate	Unclassified
2	2643221608	Sphingopyxis sp. Root214	Isolate	Unclassified
3	2818991466	Sphingomonas trueperi 1152a	Isolate	Unclassified
4	2879163058	Sphingomonas pokkalii L3B27	Isolate	Rhizosphere
5	2928968154	Sphingomonas trueperi 1075	Isolate	Unclassified
6	2990265787	Sphingomonas sp. SORGH_AS802	Isolate	Aerial Root
7	2993693658	Sphingomonas sp. SORGH_AS438	Isolate	Aerial Root
8	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
9	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
10	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
11	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
12	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
13	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
14	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
15	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
16	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
17	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
18	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
19	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
20	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
21	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
22	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
23	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
24	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
25	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
26	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
27	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
28	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
29	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
30	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
31	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
32	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
33	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
34	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
35	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
36	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
37	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
38	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
39	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
40	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
41	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
42	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
43	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
44	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
45	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
46	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
47	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
48	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
49	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
50	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
51	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
52	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
53	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
54	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
55	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
56	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
57	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
58	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
59	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
60	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
61	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
62	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
63	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
64	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
65	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
66	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
67	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
68	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
69	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
70	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
71	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
72	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
73	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
74	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
75	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
76	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
77	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
78	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
79	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
80	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
81	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
82	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
83	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
84	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
85	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
86	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
87	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
88	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
89	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
90	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
91	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
92	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
93	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
94	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
95	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
96	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
97	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
98	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
99	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
100	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
101	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
102	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
103	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
104	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
105	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
106	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
107	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
108	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
109	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
110	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
111	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
112	3300025223	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
168	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
169	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
170	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
171	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
172	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
173	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
174	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
175	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
176	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
177	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
178	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
179	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
180	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
181	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
182	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
183	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
184	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
185	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
186	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
187	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
188	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
189	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
190	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
191	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
192	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
193	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
194	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
195	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
196	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
197	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
198	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
199	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
200	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
201	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
202	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
203	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
204	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
205	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
206	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
207	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
208	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
209	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
210	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
211	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
212	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
213	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
214	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
215	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
216	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
217	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
218	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
219	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
220	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
221	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
222	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
223	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
224	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
225	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
226	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
227	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
228	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
229	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
230	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
231	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
232	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
233	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
234	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
235	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
236	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
237	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
238	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
239	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
240	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
241	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
242	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
243	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
244	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
245	3300049516	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought	Metagenome	Rhizosphere
246	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
247	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
248	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
249	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
250	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
251	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
252	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
253	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
254	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
255	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
256	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
257	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
258	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
259	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
260	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
261	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
262	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
263	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
264	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
265	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
266	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.23
Metatranscriptomes	0
Isolates	1.77

Biome Distribution

Category	Percentage (%)
Aerial Root	0.51
Bulb	0
Endosphere	4.8
Nodule	0
Rhizoplane	5.56
Rhizosphere	84.6
Stem	0
Stem Tuber	0
Unclassified	4.55

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24736J21556_1000052	3300001904	Bacteria	19247
2	JGI24741J21665_1007715	3300001915	Bacteria	2074
3	JGI24740J21852_10003160	3300001979	Bacteria	7268
4	JGI24739J22299_10005509	3300001989	Bacteria	4803
5	JGI24737J22298_10001775	3300001990	Bacteria	7726
6	JGI24735J21928_10001993	3300002067	Bacteria	7183
7	JGI24750J21931_1000230	3300002070	Bacteria	9530
8	JGI24748J21848_1000034	3300002074	Bacteria	74812
9	JGI24738J21930_10000375	3300002075	Bacteria	12439
10	JGI24749J21850_1000652	3300002076	Bacteria	5031
11	JGI24034J26672_10000018	3300002239	Bacteria	130180
12	JGI24742J22300_10000919	3300002244	Bacteria	4492
13	JGI24751J29686_10003746	3300002459	Bacteria	3068
14	Ga0055536_1010706	3300003781	Bacteria	3602
15	Ga0065165_1040526	3300005262	Bacteria	1388
16	Ga0065707_10082427	3300005295	Bacteria	15304
17	Ga0070658_10023949	3300005327	Bacteria	4898
18	Ga0070676_10449750	3300005328	Bacteria	906
19	Ga0070690_100000008	3300005330	Bacteria	118441
20	Ga0070690_100028084	3300005330	Bacteria	3482
21	Ga0070670_100064015	3300005331	Bacteria	3155
22	Ga0070666_10000032	3300005335	Bacteria	129142
23	Ga0070666_10410314	3300005335	Bacteria	974
24	Ga0070680_100806345	3300005336	Bacteria	809
25	Ga0070682_100034306	3300005337	Bacteria	3090
26	Ga0068868_100000162	3300005338	Bacteria	43570
27	Ga0070660_100001623	3300005339	Bacteria	15463
28	Ga0070689_100003709	3300005340	Bacteria	10213
29	Ga0070689_100161168	3300005340	Bacteria	1813
30	Ga0070691_10000082	3300005341	Bacteria	26541
31	Ga0070661_100149774	3300005344	Bacteria	1763
32	Ga0070661_100306108	3300005344	Bacteria	1238
33	Ga0070669_100000211	3300005353	Bacteria	48717
34	Ga0070675_100022520	3300005354	Bacteria	5036
35	Ga0070675_100377853	3300005354	Bacteria	1261
36	Ga0070671_100007827	3300005355	Bacteria	8540
37	Ga0070671_100010137	3300005355	Bacteria	7568
38	Ga0070674_100027278	3300005356	Bacteria	3742
39	Ga0070673_100014748	3300005364	Bacteria	5460
40	Ga0070673_100670426	3300005364	Bacteria	950
41	Ga0070688_100029160	3300005365	Bacteria	3302
42	Ga0070659_100000022	3300005366	Bacteria	154091
43	Ga0070659_100075727	3300005366	Bacteria	2682
44	Ga0070659_100193173	3300005366	Bacteria	1674
45	Ga0070667_100000174	3300005367	Bacteria	79730
46	Ga0070667_100013233	3300005367	Bacteria	6817
47	Ga0070709_10000238	3300005434	Bacteria	35500
48	Ga0070709_10062345	3300005434	Bacteria	2377
49	Ga0070714_100031391	3300005435	Bacteria	4432
50	Ga0070713_100000011	3300005436	Bacteria	146314
51	Ga0070710_10160155	3300005437	Bacteria	1395
52	Ga0070711_100103191	3300005439	Bacteria	2078
53	Ga0070711_100414096	3300005439	Bacteria	1097
54	Ga0070705_100386918	3300005440	Bacteria	1031
55	Ga0070700_100344220	3300005441	Bacteria	1103
56	Ga0070663_100045783	3300005455	Bacteria	3092
57	Ga0070663_100518954	3300005455	Bacteria	992
58	Ga0070678_100059215	3300005456	Bacteria	2814
59	Ga0070662_100065344	3300005457	Bacteria	2666
60	Ga0070662_100159125	3300005457	Bacteria	1765
61	Ga0070681_10324873	3300005458	Bacteria	1448
62	Ga0070685_10000046	3300005466	Bacteria	73999
63	Ga0070699_100660773	3300005518	Bacteria	954
64	Ga0070679_100912222	3300005530	Bacteria	822
65	Ga0068853_100007449	3300005539	Bacteria	8758
66	Ga0068853_100107441	3300005539	Bacteria	2474
67	Ga0070672_100009120	3300005543	Bacteria	6825
68	Ga0070686_100000030	3300005544	Bacteria	118308
69	Ga0070686_100038761	3300005544	Bacteria	2964
70	Ga0070695_100155517	3300005545	Bacteria	1600
71	Ga0070693_100155792	3300005547	Bacteria	1451
72	Ga0070665_100000056	3300005548	Bacteria	242622
73	Ga0068855_100026889	3300005563	Bacteria	6884
74	Ga0068855_100348908	3300005563	Bacteria	1630
75	Ga0068855_100455943	3300005563	Bacteria	1395
76	Ga0070664_100123448	3300005564	Bacteria	2269
77	Ga0070664_100855998	3300005564	Bacteria	851
78	Ga0068857_100005182	3300005577	Bacteria	11087
79	Ga0068857_100073890	3300005577	Bacteria	3038
80	Ga0068857_101702385	3300005577	Bacteria	616
81	Ga0068854_100350332	3300005578	Bacteria	1208
82	Ga0068854_100447106	3300005578	Bacteria	1078
83	Ga0068856_100000964	3300005614	Bacteria	30705
84	Ga0068856_100003424	3300005614	Bacteria	16037
85	Ga0068852_100005817	3300005616	Bacteria	8853
86	Ga0068852_100006345	3300005616	Bacteria	8535
87	Ga0068852_101103897	3300005616	Bacteria	813
88	Ga0068859_100003975	3300005617	Bacteria	15087
89	Ga0068859_101601715	3300005617	Bacteria	719
90	Ga0068864_100002649	3300005618	Bacteria	14782
91	Ga0068866_10004832	3300005718	Bacteria	5533
92	Ga0068851_10283834	3300005834	Bacteria	947
93	Ga0068863_100000065	3300005841	Bacteria	117925
94	Ga0068863_100005004	3300005841	Bacteria	13068
95	Ga0068863_100186877	3300005841	Bacteria	1990
96	Ga0068858_100004454	3300005842	Bacteria	13729
97	Ga0068858_100082795	3300005842	Bacteria	2983
98	Ga0068858_100138308	3300005842	Bacteria	2286
99	Ga0068860_100000125	3300005843	Bacteria	123363
100	Ga0068860_100000132	3300005843	Bacteria	120657
101	Ga0068860_100069822	3300005843	Bacteria	3340
102	Ga0068862_100000356	3300005844	Bacteria	49670
103	Ga0081455_10000100	3300005937	Bacteria	95033
104	Ga0081539_10006046	3300005985	Bacteria	11858
105	Ga0081539_10072820	3300005985	Bacteria	1835
106	Ga0070716_100025826	3300006173	Bacteria	3140
107	Ga0070712_100000014	3300006175	Bacteria	108668
108	Ga0068871_100060412	3300006358	Bacteria	3092
109	Ga0068871_100559984	3300006358	Unclassified	1036
110	Ga0075434_100069363	3300006871	Bacteria	3515
111	Ga0075429_100839356	3300006880	Bacteria	804
112	Ga0068865_100852338	3300006881	Bacteria	789
113	Ga0075436_100000047	3300006914	Bacteria	72907
114	Ga0075436_100031385	3300006914	Bacteria	3658
115	Ga0097620_100003975	3300006931	Bacteria	15087
116	Ga0097620_101601691	3300006931	Bacteria	719
117	Ga0105251_10334723	3300009011	Bacteria	689
118	Ga0105240_10000355	3300009093	Bacteria	86025
119	Ga0105245_10072879	3300009098	Bacteria	3121
120	Ga0105245_10265011	3300009098	Bacteria	1673
121	Ga0105245_11484915	3300009098	Bacteria	728
122	Ga0105243_10310432	3300009148	Bacteria	1433
123	Ga0105241_10028509	3300009174	Bacteria	4162
124	Ga0105241_10134107	3300009174	Bacteria	2008
125	Ga0105242_10025554	3300009176	Bacteria	4675
126	Ga0105237_10008237	3300009545	Bacteria	11319
127	Ga0105237_10169571	3300009545	Bacteria	2182
128	Ga0105238_10011985	3300009551	Bacteria	8733
129	Ga0105238_10048182	3300009551	Bacteria	4295
130	Ga0105238_10174577	3300009551	Bacteria	2125
131	Ga0105249_10000109	3300009553	Bacteria	112308
132	Ga0105239_10072584	3300010375	Bacteria	3784
133	Ga0157373_10003903	3300013100	Bacteria	11264
134	Ga0157373_10031878	3300013100	Bacteria	3796
135	Ga0157371_10118561	3300013102	Bacteria	1882
136	Ga0157370_10000280	3300013104	Bacteria	64677
137	Ga0157370_10043038	3300013104	Bacteria	4348
138	Ga0157369_10004867	3300013105	Bacteria	15757
139	Ga0157369_10054572	3300013105	Bacteria	4315
140	Ga0157369_10131948	3300013105	Bacteria	2646
141	Ga0157374_10028010	3300013296	Bacteria	5088
142	Ga0157378_10369347	3300013297	Bacteria	1406
143	Ga0157378_10985069	3300013297	Bacteria	877
144	Ga0163162_10205121	3300013306	Bacteria	2100
145	Ga0157372_10008076	3300013307	Bacteria	11194
146	Ga0157372_10334299	3300013307	Bacteria	1764
147	Ga0157375_12004981	3300013308	Bacteria	688
148	Ga0163163_10007312	3300014325	Bacteria	9740
149	Ga0163163_10077061	3300014325	Bacteria	3329
150	Ga0157380_10000599	3300014326	Bacteria	22227
151	Ga0157380_10002112	3300014326	Bacteria	13330
152	Ga0157379_10001288	3300014968	Bacteria	20426
153	Ga0157376_11644970	3300014969	Bacteria	677
154	Ga0163161_10000084	3300017792	Bacteria	93742
155	Ga0207672_1000884	3300025223	Bacteria	3044
156	Ga0209257_1001814	3300025304	Bacteria	23373
157	Ga0209257_1019121	3300025304	Bacteria	2596
158	Ga0207656_10128972	3300025321	Bacteria	1183
159	Ga0207642_10095611	3300025899	Bacteria	1479
160	Ga0207680_10000009	3300025903	Bacteria	464571
161	Ga0207680_10013590	3300025903	Bacteria	4188
162	Ga0207680_10013885	3300025903	Bacteria	4151
163	Ga0207647_10003328	3300025904	Bacteria	12072
164	Ga0207699_10000233	3300025906	Bacteria	31418
165	Ga0207699_10050030	3300025906	Bacteria	2463
166	Ga0207645_10102290	3300025907	Bacteria	1849
167	Ga0207645_10495365	3300025907	Bacteria	827
168	Ga0207705_10102930	3300025909	Bacteria	2102
169	Ga0207705_10695683	3300025909	Bacteria	790
170	Ga0207654_10008410	3300025911	Bacteria	5215
171	Ga0207654_10028143	3300025911	Bacteria	3062
172	Ga0207695_10012890	3300025913	Bacteria	10005
173	Ga0207695_10016906	3300025913	Bacteria	8513
174	Ga0207671_10007095	3300025914	Bacteria	9796
175	Ga0207671_10074643	3300025914	Bacteria	2535
176	Ga0207693_10000018	3300025915	Bacteria	138365
177	Ga0207663_10075064	3300025916	Bacteria	2193
178	Ga0207660_10594779	3300025917	Bacteria	901
179	Ga0207657_10000790	3300025919	Bacteria	33637
180	Ga0207657_10009096	3300025919	Bacteria	10021
181	Ga0207657_10073681	3300025919	Bacteria	2885
182	Ga0207649_10049434	3300025920	Bacteria	2597
183	Ga0207649_10171134	3300025920	Bacteria	1513
184	Ga0207681_10000965	3300025923	Bacteria	18765
185	Ga0207694_10015428	3300025924	Bacteria	5761
186	Ga0207694_10021944	3300025924	Bacteria	4841
187	Ga0207694_10136219	3300025924	Bacteria	1972
188	Ga0207694_10429361	3300025924	Bacteria	1101
189	Ga0207650_10016957	3300025925	Bacteria	5095
190	Ga0207659_10201581	3300025926	Bacteria	1590
191	Ga0207687_10092778	3300025927	Bacteria	2206
192	Ga0207687_10498378	3300025927	Bacteria	1016
193	Ga0207700_10000005	3300025928	Bacteria	394836
194	Ga0207664_10014515	3300025929	Bacteria	5692
195	Ga0207644_10003132	3300025931	Bacteria	10653
196	Ga0207644_10003709	3300025931	Bacteria	9897
197	Ga0207690_10000003	3300025932	Bacteria	783011
198	Ga0207706_10003953	3300025933	Bacteria	14044
199	Ga0207706_10006178	3300025933	Bacteria	11123
200	Ga0207686_10255067	3300025934	Bacteria	1283
201	Ga0207709_10124670	3300025935	Bacteria	1745
202	Ga0207669_10256862	3300025937	Bacteria	1304
203	Ga0207704_10007995	3300025938	Bacteria	5030
204	Ga0207665_10187854	3300025939	Unclassified	1500
205	Ga0207691_10007876	3300025940	Bacteria	10263
206	Ga0207711_10004290	3300025941	Bacteria	12184
207	Ga0207711_10015796	3300025941	Bacteria	6263
208	Ga0207711_10095398	3300025941	Bacteria	2623
209	Ga0207667_10007703	3300025949	Bacteria	12887
210	Ga0207667_10033129	3300025949	Bacteria	5558
211	Ga0207667_10044656	3300025949	Bacteria	4695
212	Ga0207651_10001472	3300025960	Bacteria	10708
213	Ga0207712_10000046	3300025961	Bacteria	162468
214	Ga0207640_10005766	3300025981	Bacteria	6752
215	Ga0207640_10077463	3300025981	Bacteria	2260
216	Ga0207640_10543904	3300025981	Bacteria	974
217	Ga0207658_10000122	3300025986	Bacteria	84415
218	Ga0207658_10000784	3300025986	Bacteria	27123
219	Ga0207677_10000154	3300026023	Bacteria	54637
220	Ga0207677_10045368	3300026023	Bacteria	2935
221	Ga0207703_10006409	3300026035	Bacteria	9405
222	Ga0207703_10069636	3300026035	Bacteria	2902
223	Ga0207703_10142848	3300026035	Bacteria	2079
224	Ga0207639_10034142	3300026041	Bacteria	3757
225	Ga0207639_10053943	3300026041	Bacteria	3070
226	Ga0207678_10043007	3300026067	Bacteria	3910
227	Ga0207702_10000173	3300026078	Bacteria	77458
228	Ga0207702_10001080	3300026078	Bacteria	27929
229	Ga0207702_10008430	3300026078	Bacteria	8695
230	Ga0207702_10019757	3300026078	Bacteria	5578
231	Ga0207641_10000063	3300026088	Bacteria	159283
232	Ga0207641_10000956	3300026088	Bacteria	29693
233	Ga0207641_10023493	3300026088	Bacteria	5078
234	Ga0207648_10007110	3300026089	Bacteria	11043
235	Ga0207676_10008003	3300026095	Bacteria	7514
236	Ga0207676_10442561	3300026095	Bacteria	1223
237	Ga0207676_11798346	3300026095	Bacteria	611
238	Ga0207674_10000112	3300026116	Bacteria	94220
239	Ga0207674_10005308	3300026116	Bacteria	15329
240	Ga0207674_10351836	3300026116	Bacteria	1424
241	Ga0207675_100000167	3300026118	Bacteria	58637
242	Ga0207683_10005286	3300026121	Bacteria	11078
243	Ga0207698_10007028	3300026142	Bacteria	7050
244	Ga0207698_10056097	3300026142	Bacteria	3040
245	Ga0207698_10113714	3300026142	Bacteria	2275
246	Ga0207698_10412971	3300026142	Bacteria	1293
247	Ga0209974_10024148	3300027876	Bacteria	2012
248	Ga0268266_10000066	3300028379	Bacteria	242637
249	Ga0268265_10000129	3300028380	Bacteria	96060
250	Ga0268264_10000130	3300028381	Bacteria	181732
251	Ga0268264_10000166	3300028381	Bacteria	146960
252	Ga0268264_10421459	3300028381	Bacteria	1287
253	Ga0307517_10150311	3300028786	Bacteria	1600
254	Ga0307405_10064076	3300031731	Bacteria	2334
255	Ga0307413_10329982	3300031824	Bacteria	1169
256	Ga0307406_10028951	3300031901	Bacteria	3349
257	Ga0307406_10923357	3300031901	Bacteria	744
258	Ga0307406_11195193	3300031901	Bacteria	660
259	Ga0307412_10000433	3300031911	Bacteria	25242
260	Ga0307412_10347511	3300031911	Bacteria	1189
261	Ga0307416_100021407	3300032002	Bacteria	4641
262	Ga0307416_101230752	3300032002	Bacteria	854
263	Ga0307414_10000107	3300032004	Bacteria	58717
264	Ga0307414_10006362	3300032004	Bacteria	6579
265	Ga0307414_10050595	3300032004	Bacteria	2879
266	Ga0307414_10132154	3300032004	Bacteria	1939
267	Ga0373948_0032511	3300034817	Bacteria	1059
268	Ga0373944_0153296	3300035089	Bacteria	813
269	Ga0373923_0026149	3300035111	Bacteria	2320
270	Ga0373932_0286404	3300035112	Bacteria	611
271	Ga0373939_0022647	3300035114	Bacteria	1733
272	Ga0373960_0064719	3300035121	Bacteria	1117
273	Ga0373960_0167451	3300035121	Bacteria	760
274	Ga0373943_0027114	3300035170	Bacteria	2689
275	Ga0373946_0065754	3300035171	Bacteria	1553
276	Ga0373955_0118921	3300035172	Bacteria	1534
277	Ga0373961_0052734	3300035241	Bacteria	1212
278	Ga0373931_0004731	3300035691	Bacteria	6238
279	Ga0373931_0025071	3300035691	Bacteria	3028
280	Ga0373931_0525813	3300035691	Bacteria	766
281	Ga0373935_0018767	3300035692	Bacteria	4213
282	Ga0373927_0071028	3300035695	Bacteria	2253
283	Ga0373947_0042524	3300035725	Bacteria	2712
284	Ga0373937_0006814	3300036401	Bacteria	9858
285	Ga0373925_0004938	3300037068	Bacteria	10027
286	Ga0373925_0050470	3300037068	Bacteria	3103
287	Ga0395898_1904410	3300037466	Bacteria	515
288	Ga0237819_00490	3300038705	Bacteria	13388
289	Ga0439436_0051358	3300041404	Bacteria	1164
290	Ga0439465_0002948	3300041413	Bacteria	5571
291	Ga0451793_0043240	3300041452	Bacteria	639
292	Ga0450920_051270	3300042122	Bacteria	828
293	Ga0439446_0026382	3300042156	Bacteria	1664
294	Ga0466969_0222273	3300044656	Bacteria	859
295	Ga0466972_0033466	3300044658	Bacteria	2521
296	Ga0466972_0087207	3300044658	Bacteria	1483
297	Ga0466965_0209449	3300044683	Bacteria	1036
298	Ga0466968_0008164	3300044735	Bacteria	4003
299	Ga0466970_0030289	3300044765	Bacteria	2853
300	Ga0466957_0038061	3300044842	Bacteria	2897
301	Ga0466960_0028712	3300044901	Bacteria	2547
302	Ga0466958_0242830	3300045836	Bacteria	1151
303	Ga0466967_0282019	3300045976	Bacteria	1594
304	Ga0495617_028742	3300046452	Bacteria	1869
305	Ga0495638_0000097	3300046460	Bacteria	141017
306	Ga0495638_0000388	3300046460	Bacteria	54286
307	Ga0495583_0000252	3300046506	Bacteria	88617
308	Ga0495632_0036482	3300046519	Bacteria	2500
309	Ga0495648_0000308	3300046524	Bacteria	54286
310	Ga0495663_0267116	3300046525	Bacteria	610
311	Ga0495654_0002162	3300046530	Bacteria	12812
312	Ga0495654_0204774	3300046530	Bacteria	842
313	Ga0495622_0071665	3300046557	Bacteria	1599
314	Ga0495633_0013089	3300046558	Bacteria	4386
315	Ga0495668_0004479	3300046616	Bacteria	9899
316	Ga0495668_0054988	3300046616	Bacteria	2198
317	Ga0495623_0097454	3300046679	Bacteria	1796
318	Ga0495670_0001796	3300046691	Bacteria	10535
319	Ga0495671_0000011	3300046692	Bacteria	365582
320	Ga0495673_0000013	3300047469	Bacteria	612902
321	Ga0495686_0000600	3300047472	Bacteria	50240
322	Ga0495686_0001038	3300047472	Bacteria	33340
323	Ga0495686_0478189	3300047472	Bacteria	659
324	Ga0496100_0004354	3300048903	Bacteria	7497
325	Ga0496101_0003296	3300048904	Bacteria	10044
326	Ga0496102_0022699	3300048905	Bacteria	5561
327	Ga0496102_0052927	3300048905	Bacteria	3700
328	Ga0496103_0000788	3300048906	Bacteria	23326
329	Ga0496103_0010484	3300048906	Bacteria	5485
330	Ga0496103_0915416	3300048906	Bacteria	549
331	Ga0496104_0077669	3300048907	Bacteria	3163
332	Ga0496105_0007221	3300048908	Bacteria	8579
333	Ga0496105_0065920	3300048908	Bacteria	2989
334	Ga0496107_0001984	3300048910	Bacteria	13030
335	Ga0496107_0034230	3300048910	Bacteria	3638
336	Ga0496108_0009981	3300048911	Bacteria	7695
337	Ga0496109_0049473	3300048912	Bacteria	3826
338	Ga0496110_0003761	3300048913	Bacteria	11691
339	Ga0496110_0175203	3300048913	Bacteria	1947
340	Ga0496111_0002605	3300048914	Bacteria	10918
341	Ga0496111_0176978	3300048914	Bacteria	1586
342	Ga0496112_0383313	3300048915	Bacteria	1347
343	Ga0496113_0001095	3300048916	Bacteria	14658
344	Ga0496113_0649400	3300048916	Bacteria	844
345	Ga0496116_0033612	3300048919	Bacteria	3636
346	Ga0496117_0032474	3300048920	Bacteria	3965
347	Ga0496118_0033498	3300048921	Bacteria	4213
348	Ga0496118_0313063	3300048921	Bacteria	855
349	Ga0496119_0051965	3300048922	Bacteria	2514
350	Ga0496121_0151451	3300048924	Bacteria	1706
351	Ga0496123_0036795	3300048926	Bacteria	3463
352	Ga0496123_0197463	3300048926	Bacteria	1035
353	Ga0496124_0000354	3300048927	Bacteria	83817
354	Ga0496124_0001620	3300048927	Bacteria	32262
355	Ga0496125_0023673	3300048928	Bacteria	5663
356	Ga0496126_0108609	3300048929	Bacteria	2419
357	Ga0495678_113016	3300049459	Bacteria	923
358	Ga0501290_002714	3300049513	Bacteria	2270
359	Ga0501293_005651	3300049516	Bacteria	1006
360	Ga0501300_010242	3300049523	Bacteria	1367
361	Ga0501034_0001454	3300049571	Bacteria	31350
362	Ga0501037_0488306	3300049573	Bacteria	836
363	Ga0501039_0946047	3300049575	Bacteria	670
364	Ga0501223_006424	3300049663	Bacteria	2431
365	Ga0501257_000041	3300049686	Bacteria	36608
366	Ga0501262_056082	3300049759	Bacteria	620
367	Ga0501280_002333	3300049776	Bacteria	3201
368	Ga0501035_0673937	3300049822	Bacteria	836
369	nmdc:mga09592_581981_c1	3300050508	Bacteria	960
370	nmdc:mga0n895_49358_c1	3300050512	Bacteria	4122
371	nmdc:mga0rr50_32040_c1	3300050513	Bacteria	3740
372	nmdc:mga08x19_121884_c1	3300050514	Bacteria	1749
373	nmdc:mga08x19_62_c1	3300050514	Bacteria	114601
374	Ga0500643_001588	3300053087	Bacteria	12854
375	Ga0500643_001702	3300053087	Bacteria	12217
376	Ga0500643_001704	3300053087	Bacteria	12216
377	Ga0500592_000806	3300053116	Bacteria	5139
378	Ga0500592_001986	3300053116	Bacteria	3292
379	Ga0500594_0002307	3300053118	Bacteria	4138
380	Ga0500658_0001454	3300053134	Bacteria	9468
381	Ga0500658_0074738	3300053134	Bacteria	1437
382	Ga0500604_0011955	3300053151	Bacteria	2339
383	Ga0500604_0043677	3300053151	Bacteria	1362
384	Ga0500627_0000115	3300053158	Bacteria	25685
385	Ga0500627_0008572	3300053158	Bacteria	3640
386	Ga0500627_0020635	3300053158	Bacteria	2645
387	Ga0500627_0261935	3300053158	Bacteria	763
388	Ga0500596_024779	3300053735	Bacteria	914
389	Ga0466962_0204719	3300061719	Bacteria	965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300045976	Ga0466967_0282019	Ga0466967_0282019_134_661	127
2	3300035089	Ga0373944_0153296	Ga0373944_0153296_19_540	130
3	3300035170	Ga0373943_0027114	Ga0373943_0027114_1453_1974	130
4	3300035171	Ga0373946_0065754	Ga0373946_0065754_383_904	130
5	3300035692	Ga0373935_0018767	Ga0373935_0018767_3033_3554	130
6	3300035695	Ga0373927_0071028	Ga0373927_0071028_1132_1653	130
7	3300035725	Ga0373947_0042524	Ga0373947_0042524_39_560	130
8	3300037068	Ga0373925_0004938	Ga0373925_0004938_7094_7615	130
9	3300044842	Ga0466957_0038061	Ga0466957_0038061_1126_1647	130
10	3300045836	Ga0466958_0242830	Ga0466958_0242830_99_620	130
11	3300048927	Ga0496124_0000354	Ga0496124_0000354_70768_71253	132
12	3300031824	Ga0307413_10329982	Ga0307413_103299822	133
13	3300031911	Ga0307412_10000433	Ga0307412_1000043322	133
14	3300048926	Ga0496123_0197463	Ga0496123_0197463_35_541	133
15	3300005340	Ga0070689_100161168	Ga0070689_1001611681	134
16	3300013306	Ga0163162_10205121	Ga0163162_102051213	134
17	3300034817	Ga0373948_0032511	Ga0373948_0032511_471_989	134
18	3300035112	Ga0373932_0286404	Ga0373932_0286404_62_577	134
19	3300035114	Ga0373939_0022647	Ga0373939_0022647_213_731	134
20	3300035691	Ga0373931_0004731	Ga0373931_0004731_5644_6162	134
21	3300013297	Ga0157378_10369347	Ga0157378_103693473	136
22	3300041452	Ga0451793_0043240	Ga0451793_0043240_69_554	137
23	3300053087	Ga0500643_001704	Ga0500643_001704_1149_1565	138
24	3300046460	Ga0495638_0000388	Ga0495638_0000388_45949_46443	139
25	3300046524	Ga0495648_0000308	Ga0495648_0000308_7844_8338	139
26	3300048915	Ga0496112_0383313	Ga0496112_0383313_201_722	141
27	3300049573	Ga0501037_0488306	Ga0501037_0488306_28_510	141
28	3300049822	Ga0501035_0673937	Ga0501035_0673937_63_545	141
29	3300041404	Ga0439436_0051358	Ga0439436_0051358_11_448	142
30	3300005985	Ga0081539_10072820	Ga0081539_100728202	143
31	3300014326	Ga0157380_10002112	Ga0157380_100021128	143
32	3300032004	Ga0307414_10006362	Ga0307414_100063623	143
33	3300049571	Ga0501034_0001454	Ga0501034_0001454_23504_23965	143
34	3300049575	Ga0501039_0946047	Ga0501039_0946047_150_611	143
35	3300035121	Ga0373960_0167451	Ga0373960_0167451_30_479	144
36	3300049516	Ga0501293_005651	Ga0501293_005651_482_922	144
37	3300049776	Ga0501280_002333	Ga0501280_002333_346_786	144
38	3300005564	Ga0070664_100855998	Ga0070664_1008559981	146
39	3300006358	Ga0068871_100559984	Ga0068871_1005599842	146
40	3300037466	Ga0395898_1904410	Ga0395898_1904410_26_484	147
41	3300005341	Ga0070691_10000082	Ga0070691_1000008225	149
42	3300005434	Ga0070709_10000238	Ga0070709_1000023840	149
43	3300005434	Ga0070709_10062345	Ga0070709_100623453	149
44	3300005435	Ga0070714_100031391	Ga0070714_1000313914	149
45	3300005436	Ga0070713_100000011	Ga0070713_10000001182	149
46	3300005437	Ga0070710_10160155	Ga0070710_101601553	149
47	3300005439	Ga0070711_100103191	Ga0070711_1001031913	149
48	3300005439	Ga0070711_100414096	Ga0070711_1004140962	149
49	3300005440	Ga0070705_100386918	Ga0070705_1003869182	149
50	3300005518	Ga0070699_100660773	Ga0070699_1006607732	149
51	3300005539	Ga0068853_100007449	Ga0068853_10000744910	149
52	3300005545	Ga0070695_100155517	Ga0070695_1001555172	149
53	3300005547	Ga0070693_100155792	Ga0070693_1001557922	149
54	3300005563	Ga0068855_100348908	Ga0068855_1003489082	149
55	3300005577	Ga0068857_100005182	Ga0068857_10000518213	149
56	3300005578	Ga0068854_100447106	Ga0068854_1004471062	149
57	3300005614	Ga0068856_100000964	Ga0068856_10000096417	149
58	3300005614	Ga0068856_100003424	Ga0068856_1000034244	149
59	3300005616	Ga0068852_100005817	Ga0068852_1000058174	149
60	3300005842	Ga0068858_100138308	Ga0068858_1001383084	149
61	3300006173	Ga0070716_100025826	Ga0070716_1000258264	149
62	3300006175	Ga0070712_100000014	Ga0070712_10000001481	149
63	3300006871	Ga0075434_100069363	Ga0075434_1000693634	149
64	3300006914	Ga0075436_100000047	Ga0075436_10000004748	149
65	3300006914	Ga0075436_100031385	Ga0075436_1000313853	149
66	3300009093	Ga0105240_10000355	Ga0105240_1000035540	149
67	3300009098	Ga0105245_11484915	Ga0105245_114849151	149
68	3300009174	Ga0105241_10028509	Ga0105241_100285094	149
69	3300009545	Ga0105237_10008237	Ga0105237_1000823713	149
70	3300009551	Ga0105238_10011985	Ga0105238_100119859	149
71	3300010375	Ga0105239_10072584	Ga0105239_100725843	149
72	3300013100	Ga0157373_10003903	Ga0157373_100039034	149
73	3300013104	Ga0157370_10000280	Ga0157370_1000028017	149
74	3300013105	Ga0157369_10004867	Ga0157369_1000486713	149
75	3300013296	Ga0157374_10028010	Ga0157374_100280103	149
76	3300013297	Ga0157378_10985069	Ga0157378_109850692	149
77	3300013307	Ga0157372_10008076	Ga0157372_100080764	149
78	3300014325	Ga0163163_10077061	Ga0163163_100770614	149
79	3300014968	Ga0157379_10001288	Ga0157379_100012883	149
80	3300014969	Ga0157376_11644970	Ga0157376_116449702	149
81	3300025906	Ga0207699_10000233	Ga0207699_100002333	149
82	3300025906	Ga0207699_10050030	Ga0207699_100500303	149
83	3300025911	Ga0207654_10028143	Ga0207654_100281433	149
84	3300025913	Ga0207695_10016906	Ga0207695_100169068	149
85	3300025914	Ga0207671_10074643	Ga0207671_100746431	149
86	3300025915	Ga0207693_10000018	Ga0207693_1000001834	149
87	3300025916	Ga0207663_10075064	Ga0207663_100750643	149
88	3300025924	Ga0207694_10021944	Ga0207694_100219445	149
89	3300025927	Ga0207687_10498378	Ga0207687_104983781	149
90	3300025928	Ga0207700_10000005	Ga0207700_1000000547	149
91	3300025929	Ga0207664_10014515	Ga0207664_100145154	149
92	3300025949	Ga0207667_10007703	Ga0207667_1000770313	149
93	3300025981	Ga0207640_10543904	Ga0207640_105439042	149
94	3300026035	Ga0207703_10142848	Ga0207703_101428483	149
95	3300026078	Ga0207702_10000173	Ga0207702_100001735	149
96	3300026078	Ga0207702_10001080	Ga0207702_1000108019	149
97	3300026116	Ga0207674_10000112	Ga0207674_1000011238	149
98	3300026142	Ga0207698_10007028	Ga0207698_100070288	149
99	3300035111	Ga0373923_0026149	Ga0373923_0026149_721_1191	149
100	3300035121	Ga0373960_0064719	Ga0373960_0064719_304_774	149
101	3300035172	Ga0373955_0118921	Ga0373955_0118921_938_1408	149
102	3300035241	Ga0373961_0052734	Ga0373961_0052734_129_599	149
103	3300035691	Ga0373931_0025071	Ga0373931_0025071_2295_2765	149
104	3300035691	Ga0373931_0525813	Ga0373931_0525813_151_621	149
105	3300036401	Ga0373937_0006814	Ga0373937_0006814_4199_4669	149
106	3300037068	Ga0373925_0050470	Ga0373925_0050470_2140_2610	149
107	3300041413	Ga0439465_0002948	Ga0439465_0002948_849_1331	149
108	3300042122	Ga0450920_051270	Ga0450920_051270_171_653	149
109	3300042156	Ga0439446_0026382	Ga0439446_0026382_853_1335	149
110	3300046679	Ga0495623_0097454	Ga0495623_0097454_168_638	149
111	3300050512	nmdc:mga0n895_49358_c1	nmdc:mga0n895_49358_c1_673_1143	149
112	3300050513	nmdc:mga0rr50_32040_c1	nmdc:mga0rr50_32040_c1_369_839	149
113	3300050514	nmdc:mga08x19_121884_c1	nmdc:mga08x19_121884_c1_1238_1708	149
114	3300050514	nmdc:mga08x19_62_c1	nmdc:mga08x19_62_c1_74685_75155	149
115	3300053134	Ga0500658_0001454	Ga0500658_0001454_3919_4428	149
116	3300005563	Ga0068855_100026889	Ga0068855_1000268899	150
117	3300025939	Ga0207665_10187854	Ga0207665_101878542	150
118	3300025949	Ga0207667_10044656	Ga0207667_100446563	150
119	3300026142	Ga0207698_10412971	Ga0207698_104129712	150
120	3300032004	Ga0307414_10050595	Ga0307414_100505954	150
121	3300046460	Ga0495638_0000097	Ga0495638_0000097_63776_64285	150
122	iso_pu_bacteria	2643221563	2643833074	150
123	iso_pu_bacteria	2643221608	2644053131	150
124	3300048928	Ga0496125_0023673	Ga0496125_0023673_262_732	152
125	3300003781	Ga0055536_1010706	Ga0055536_10107062	153
126	3300005338	Ga0068868_100000162	Ga0068868_10000016235	153
127	3300005339	Ga0070660_100001623	Ga0070660_10000162316	153
128	3300005354	Ga0070675_100022520	Ga0070675_1000225203	153
129	3300005364	Ga0070673_100670426	Ga0070673_1006704262	153
130	3300005366	Ga0070659_100000022	Ga0070659_10000002252	153
131	3300005441	Ga0070700_100344220	Ga0070700_1003442201	153
132	3300009098	Ga0105245_10072879	Ga0105245_100728793	153
133	3300009098	Ga0105245_10265011	Ga0105245_102650112	153
134	3300025304	Ga0209257_1001814	Ga0209257_100181420	153
135	3300025907	Ga0207645_10102290	Ga0207645_101022902	153
136	3300025919	Ga0207657_10000790	Ga0207657_1000079029	153
137	3300025926	Ga0207659_10201581	Ga0207659_102015813	153
138	3300025927	Ga0207687_10092778	Ga0207687_100927782	153
139	3300025932	Ga0207690_10000003	Ga0207690_10000003697	153
140	3300026023	Ga0207677_10000154	Ga0207677_1000015436	153
141	3300027876	Ga0209974_10024148	Ga0209974_100241483	153
142	3300028786	Ga0307517_10150311	Ga0307517_101503112	153
143	3300032004	Ga0307414_10000107	Ga0307414_1000010765	153
144	3300032004	Ga0307414_10132154	Ga0307414_101321542	153
145	3300046530	Ga0495654_0204774	Ga0495654_0204774_168_647	153
146	3300047472	Ga0495686_0001038	Ga0495686_0001038_1757_2221	153
147	3300048929	Ga0496126_0108609	Ga0496126_0108609_1310_1792	153
148	3300049759	Ga0501262_056082	Ga0501262_056082_91_573	153
149	3300053116	Ga0500592_001986	Ga0500592_001986_1064_1543	153
150	3300053134	Ga0500658_0074738	Ga0500658_0074738_477_959	153
151	3300053158	Ga0500627_0008572	Ga0500627_0008572_1981_2460	153
152	3300053158	Ga0500627_0020635	Ga0500627_0020635_1810_2292	153
153	3300047472	Ga0495686_0000600	Ga0495686_0000600_15614_16096	154
154	3300053735	Ga0500596_024779	Ga0500596_024779_61_537	154
155	iso_pu_bacteria	2990265787	2990267870	154
156	iso_pu_bacteria	2993693658	2993697112	154
157	3300005262	Ga0065165_1040526	Ga0065165_10405262	155
158	3300005328	Ga0070676_10449750	Ga0070676_104497502	155
159	3300005330	Ga0070690_100028084	Ga0070690_1000280842	155
160	3300005335	Ga0070666_10410314	Ga0070666_104103142	155
161	3300005344	Ga0070661_100306108	Ga0070661_1003061082	155
162	3300005354	Ga0070675_100377853	Ga0070675_1003778532	155
163	3300005355	Ga0070671_100007827	Ga0070671_1000078277	155
164	3300005356	Ga0070674_100027278	Ga0070674_1000272782	155
165	3300005364	Ga0070673_100014748	Ga0070673_1000147483	155
166	3300005366	Ga0070659_100193173	Ga0070659_1001931733	155
167	3300005456	Ga0070678_100059215	Ga0070678_1000592153	155
168	3300005543	Ga0070672_100009120	Ga0070672_1000091207	155
169	3300005544	Ga0070686_100038761	Ga0070686_1000387612	155
170	3300005616	Ga0068852_100006345	Ga0068852_1000063458	155
171	3300005718	Ga0068866_10004832	Ga0068866_100048325	155
172	3300005841	Ga0068863_100005004	Ga0068863_1000050047	155
173	3300005842	Ga0068858_100082795	Ga0068858_1000827953	155
174	3300005843	Ga0068860_100069822	Ga0068860_1000698222	155
175	3300005937	Ga0081455_10000100	Ga0081455_100001007	155
176	3300006358	Ga0068871_100060412	Ga0068871_1000604123	155
177	3300006881	Ga0068865_100852338	Ga0068865_1008523382	155
178	3300009148	Ga0105243_10310432	Ga0105243_103104322	155
179	3300009174	Ga0105241_10134107	Ga0105241_101341074	155
180	3300009176	Ga0105242_10025554	Ga0105242_100255542	155
181	3300009551	Ga0105238_10048182	Ga0105238_100481822	155
182	3300013105	Ga0157369_10054572	Ga0157369_100545722	155
183	3300013308	Ga0157375_12004981	Ga0157375_120049812	155
184	3300025899	Ga0207642_10095611	Ga0207642_100956112	155
185	3300025903	Ga0207680_10013590	Ga0207680_100135903	155
186	3300025907	Ga0207645_10495365	Ga0207645_104953651	155
187	3300025909	Ga0207705_10695683	Ga0207705_106956831	155
188	3300025919	Ga0207657_10073681	Ga0207657_100736814	155
189	3300025920	Ga0207649_10049434	Ga0207649_100494342	155
190	3300025924	Ga0207694_10429361	Ga0207694_104293612	155
191	3300025931	Ga0207644_10003132	Ga0207644_100031326	155
192	3300025933	Ga0207706_10006178	Ga0207706_1000617810	155
193	3300025934	Ga0207686_10255067	Ga0207686_102550672	155
194	3300025935	Ga0207709_10124670	Ga0207709_101246702	155
195	3300025937	Ga0207669_10256862	Ga0207669_102568622	155
196	3300025938	Ga0207704_10007995	Ga0207704_100079954	155
197	3300025940	Ga0207691_10007876	Ga0207691_100078766	155
198	3300025941	Ga0207711_10015796	Ga0207711_100157963	155
199	3300025960	Ga0207651_10001472	Ga0207651_100014727	155
200	3300026023	Ga0207677_10045368	Ga0207677_100453682	155
201	3300026035	Ga0207703_10069636	Ga0207703_100696363	155
202	3300026078	Ga0207702_10019757	Ga0207702_100197576	155
203	3300026088	Ga0207641_10023493	Ga0207641_100234935	155
204	3300026089	Ga0207648_10007110	Ga0207648_100071108	155
205	3300026095	Ga0207676_10442561	Ga0207676_104425612	155
206	3300026121	Ga0207683_10005286	Ga0207683_100052867	155
207	3300026142	Ga0207698_10056097	Ga0207698_100560972	155
208	3300028381	Ga0268264_10421459	Ga0268264_104214592	155
209	3300044658	Ga0466972_0033466	Ga0466972_0033466_915_1436	155
210	3300044901	Ga0466960_0028712	Ga0466960_0028712_276_797	155
211	3300046452	Ga0495617_028742	Ga0495617_028742_442_930	155
212	3300046525	Ga0495663_0267116	Ga0495663_0267116_61_531	155
213	3300046530	Ga0495654_0002162	Ga0495654_0002162_3180_3650	155
214	3300046557	Ga0495622_0071665	Ga0495622_0071665_620_1108	155
215	3300046616	Ga0495668_0004479	Ga0495668_0004479_3487_3957	155
216	3300046616	Ga0495668_0054988	Ga0495668_0054988_967_1437	155
217	3300046691	Ga0495670_0001796	Ga0495670_0001796_3026_3514	155
218	3300048903	Ga0496100_0004354	Ga0496100_0004354_641_1162	155
219	3300048904	Ga0496101_0003296	Ga0496101_0003296_5100_5621	155
220	3300048905	Ga0496102_0052927	Ga0496102_0052927_2821_3342	155
221	3300048906	Ga0496103_0010484	Ga0496103_0010484_2797_3318	155
222	3300048907	Ga0496104_0077669	Ga0496104_0077669_1960_2481	155
223	3300048908	Ga0496105_0007221	Ga0496105_0007221_4291_4812	155
224	3300048910	Ga0496107_0001984	Ga0496107_0001984_1535_2056	155
225	3300048911	Ga0496108_0009981	Ga0496108_0009981_951_1472	155
226	3300048912	Ga0496109_0049473	Ga0496109_0049473_571_1092	155
227	3300048913	Ga0496110_0003761	Ga0496110_0003761_3988_4509	155
228	3300048914	Ga0496111_0002605	Ga0496111_0002605_5869_6390	155
229	3300048916	Ga0496113_0001095	Ga0496113_0001095_7573_8094	155
230	3300049459	Ga0495678_113016	Ga0495678_113016_363_833	155
231	3300053116	Ga0500592_000806	Ga0500592_000806_968_1438	155
232	3300053118	Ga0500594_0002307	Ga0500594_0002307_1287_1775	155
233	3300053151	Ga0500604_0011955	Ga0500604_0011955_832_1302	155
234	3300053151	Ga0500604_0043677	Ga0500604_0043677_306_776	155
235	3300053158	Ga0500627_0000115	Ga0500627_0000115_16588_17058	155
236	3300053158	Ga0500627_0261935	Ga0500627_0261935_10_480	155
237	3300001904	JGI24736J21556_1000052	JGI24736J21556_100005217	156
238	3300001915	JGI24741J21665_1007715	JGI24741J21665_10077152	156
239	3300001979	JGI24740J21852_10003160	JGI24740J21852_100031602	156
240	3300001989	JGI24739J22299_10005509	JGI24739J22299_100055095	156
241	3300001990	JGI24737J22298_10001775	JGI24737J22298_100017755	156
242	3300002067	JGI24735J21928_10001993	JGI24735J21928_100019932	156
243	3300002070	JGI24750J21931_1000230	JGI24750J21931_100023010	156
244	3300002074	JGI24748J21848_1000034	JGI24748J21848_100003437	156
245	3300002075	JGI24738J21930_10000375	JGI24738J21930_1000037511	156
246	3300002076	JGI24749J21850_1000652	JGI24749J21850_10006526	156
247	3300002239	JGI24034J26672_10000018	JGI24034J26672_1000001843	156
248	3300002244	JGI24742J22300_10000919	JGI24742J22300_100009192	156
249	3300002459	JGI24751J29686_10003746	JGI24751J29686_100037462	156
250	3300005295	Ga0065707_10082427	Ga0065707_1008242716	156
251	3300005327	Ga0070658_10023949	Ga0070658_100239496	156
252	3300005330	Ga0070690_100000008	Ga0070690_10000000844	156
253	3300005331	Ga0070670_100064015	Ga0070670_1000640155	156
254	3300005335	Ga0070666_10000032	Ga0070666_1000003279	156
255	3300005336	Ga0070680_100806345	Ga0070680_1008063451	156
256	3300005337	Ga0070682_100034306	Ga0070682_1000343062	156
257	3300005340	Ga0070689_100003709	Ga0070689_1000037092	156
258	3300005344	Ga0070661_100149774	Ga0070661_1001497743	156
259	3300005353	Ga0070669_100000211	Ga0070669_10000021151	156
260	3300005355	Ga0070671_100010137	Ga0070671_10001013710	156
261	3300005365	Ga0070688_100029160	Ga0070688_1000291603	156
262	3300005366	Ga0070659_100075727	Ga0070659_1000757275	156
263	3300005367	Ga0070667_100000174	Ga0070667_10000017449	156
264	3300005367	Ga0070667_100013233	Ga0070667_1000132333	156
265	3300005455	Ga0070663_100045783	Ga0070663_1000457832	156
266	3300005455	Ga0070663_100518954	Ga0070663_1005189542	156
267	3300005457	Ga0070662_100065344	Ga0070662_1000653441	156
268	3300005457	Ga0070662_100159125	Ga0070662_1001591252	156
269	3300005458	Ga0070681_10324873	Ga0070681_103248732	156
270	3300005466	Ga0070685_10000046	Ga0070685_1000004618	156
271	3300005530	Ga0070679_100912222	Ga0070679_1009122222	156
272	3300005539	Ga0068853_100107441	Ga0068853_1001074415	156
273	3300005544	Ga0070686_100000030	Ga0070686_10000003081	156
274	3300005548	Ga0070665_100000056	Ga0070665_100000056151	156
275	3300005563	Ga0068855_100455943	Ga0068855_1004559432	156
276	3300005564	Ga0070664_100123448	Ga0070664_1001234484	156
277	3300005577	Ga0068857_100073890	Ga0068857_1000738902	156
278	3300005577	Ga0068857_101702385	Ga0068857_1017023852	156
279	3300005578	Ga0068854_100350332	Ga0068854_1003503321	156
280	3300005616	Ga0068852_101103897	Ga0068852_1011038971	156
281	3300005617	Ga0068859_100003975	Ga0068859_1000039759	156
282	3300005617	Ga0068859_101601715	Ga0068859_1016017152	156
283	3300005618	Ga0068864_100002649	Ga0068864_10000264917	156
284	3300005834	Ga0068851_10283834	Ga0068851_102838341	156
285	3300005841	Ga0068863_100000065	Ga0068863_10000006546	156
286	3300005841	Ga0068863_100186877	Ga0068863_1001868774	156
287	3300005842	Ga0068858_100004454	Ga0068858_1000044542	156
288	3300005843	Ga0068860_100000125	Ga0068860_10000012561	156
289	3300005843	Ga0068860_100000132	Ga0068860_10000013248	156
290	3300005844	Ga0068862_100000356	Ga0068862_10000035646	156
291	3300005985	Ga0081539_10006046	Ga0081539_1000604611	156
292	3300006880	Ga0075429_100839356	Ga0075429_1008393562	156
293	3300006931	Ga0097620_100003975	Ga0097620_1000039759	156
294	3300006931	Ga0097620_101601691	Ga0097620_1016016912	156
295	3300009011	Ga0105251_10334723	Ga0105251_103347231	156
296	3300009545	Ga0105237_10169571	Ga0105237_101695712	156
297	3300009551	Ga0105238_10174577	Ga0105238_101745774	156
298	3300009553	Ga0105249_10000109	Ga0105249_1000010947	156
299	3300013100	Ga0157373_10031878	Ga0157373_100318785	156
300	3300013102	Ga0157371_10118561	Ga0157371_101185612	156
301	3300013104	Ga0157370_10043038	Ga0157370_100430385	156
302	3300013105	Ga0157369_10131948	Ga0157369_101319483	156
303	3300013307	Ga0157372_10334299	Ga0157372_103342991	156
304	3300014325	Ga0163163_10007312	Ga0163163_100073126	156
305	3300014326	Ga0157380_10000599	Ga0157380_1000059913	156
306	3300017792	Ga0163161_10000084	Ga0163161_1000008470	156
307	3300025223	Ga0207672_1000884	Ga0207672_10008842	156
308	3300025304	Ga0209257_1019121	Ga0209257_10191214	156
309	3300025321	Ga0207656_10128972	Ga0207656_101289722	156
310	3300025903	Ga0207680_10000009	Ga0207680_10000009370	156
311	3300025903	Ga0207680_10013885	Ga0207680_100138856	156
312	3300025904	Ga0207647_10003328	Ga0207647_1000332811	156
313	3300025909	Ga0207705_10102930	Ga0207705_101029304	156
314	3300025911	Ga0207654_10008410	Ga0207654_100084108	156
315	3300025913	Ga0207695_10012890	Ga0207695_100128906	156
316	3300025914	Ga0207671_10007095	Ga0207671_100070958	156
317	3300025917	Ga0207660_10594779	Ga0207660_105947791	156
318	3300025919	Ga0207657_10009096	Ga0207657_1000909611	156
319	3300025920	Ga0207649_10171134	Ga0207649_101711343	156
320	3300025923	Ga0207681_10000965	Ga0207681_100009658	156
321	3300025924	Ga0207694_10015428	Ga0207694_100154286	156
322	3300025924	Ga0207694_10136219	Ga0207694_101362192	156
323	3300025925	Ga0207650_10016957	Ga0207650_100169573	156
324	3300025931	Ga0207644_10003709	Ga0207644_1000370912	156
325	3300025933	Ga0207706_10003953	Ga0207706_100039537	156
326	3300025941	Ga0207711_10004290	Ga0207711_1000429012	156
327	3300025941	Ga0207711_10095398	Ga0207711_100953982	156
328	3300025949	Ga0207667_10033129	Ga0207667_100331296	156
329	3300025961	Ga0207712_10000046	Ga0207712_1000004658	156
330	3300025981	Ga0207640_10005766	Ga0207640_100057668	156
331	3300025981	Ga0207640_10077463	Ga0207640_100774632	156
332	3300025986	Ga0207658_10000122	Ga0207658_100001229	156
333	3300025986	Ga0207658_10000784	Ga0207658_1000078418	156
334	3300026035	Ga0207703_10006409	Ga0207703_100064094	156
335	3300026041	Ga0207639_10034142	Ga0207639_100341423	156
336	3300026041	Ga0207639_10053943	Ga0207639_100539435	156
337	3300026067	Ga0207678_10043007	Ga0207678_100430074	156
338	3300026078	Ga0207702_10008430	Ga0207702_100084308	156
339	3300026088	Ga0207641_10000063	Ga0207641_10000063115	156
340	3300026088	Ga0207641_10000956	Ga0207641_100009562	156
341	3300026095	Ga0207676_10008003	Ga0207676_100080032	156
342	3300026095	Ga0207676_11798346	Ga0207676_117983462	156
343	3300026116	Ga0207674_10005308	Ga0207674_100053088	156
344	3300026116	Ga0207674_10351836	Ga0207674_103518362	156
345	3300026118	Ga0207675_100000167	Ga0207675_10000016736	156
346	3300026142	Ga0207698_10113714	Ga0207698_101137142	156
347	3300028379	Ga0268266_10000066	Ga0268266_10000066103	156
348	3300028380	Ga0268265_10000129	Ga0268265_1000012944	156
349	3300028381	Ga0268264_10000130	Ga0268264_1000013077	156
350	3300028381	Ga0268264_10000166	Ga0268264_1000016681	156
351	3300031731	Ga0307405_10064076	Ga0307405_100640762	156
352	3300031901	Ga0307406_10028951	Ga0307406_100289516	156
353	3300031901	Ga0307406_10923357	Ga0307406_109233571	156
354	3300031901	Ga0307406_11195193	Ga0307406_111951932	156
355	3300031911	Ga0307412_10347511	Ga0307412_103475112	156
356	3300032002	Ga0307416_100021407	Ga0307416_1000214073	156
357	3300032002	Ga0307416_101230752	Ga0307416_1012307522	156
358	3300038705	Ga0237819_00490	Ga0237819_00490_12519_13001	156
359	3300044656	Ga0466969_0222273	Ga0466969_0222273_305_832	156
360	3300044658	Ga0466972_0087207	Ga0466972_0087207_85_612	156
361	3300044683	Ga0466965_0209449	Ga0466965_0209449_367_894	156
362	3300044735	Ga0466968_0008164	Ga0466968_0008164_3105_3632	156
363	3300044765	Ga0466970_0030289	Ga0466970_0030289_268_795	156
364	3300046506	Ga0495583_0000252	Ga0495583_0000252_45867_46361	156
365	3300046519	Ga0495632_0036482	Ga0495632_0036482_319_813	156
366	3300046558	Ga0495633_0013089	Ga0495633_0013089_122_616	156
367	3300046692	Ga0495671_0000011	Ga0495671_0000011_42226_42720	156
368	3300047469	Ga0495673_0000013	Ga0495673_0000013_310290_310784	156
369	3300047472	Ga0495686_0478189	Ga0495686_0478189_131_625	156
370	3300048905	Ga0496102_0022699	Ga0496102_0022699_3343_3813	156
371	3300048906	Ga0496103_0000788	Ga0496103_0000788_19910_20380	156
372	3300048906	Ga0496103_0915416	Ga0496103_0915416_38_511	156
373	3300048908	Ga0496105_0065920	Ga0496105_0065920_2255_2725	156
374	3300048910	Ga0496107_0034230	Ga0496107_0034230_1008_1478	156
375	3300048913	Ga0496110_0175203	Ga0496110_0175203_1348_1818	156
376	3300048914	Ga0496111_0176978	Ga0496111_0176978_329_799	156
377	3300048916	Ga0496113_0649400	Ga0496113_0649400_329_799	156
378	3300048919	Ga0496116_0033612	Ga0496116_0033612_1978_2481	156
379	3300048920	Ga0496117_0032474	Ga0496117_0032474_240_710	156
380	3300048921	Ga0496118_0033498	Ga0496118_0033498_3506_3976	156
381	3300048921	Ga0496118_0313063	Ga0496118_0313063_18_488	156
382	3300048922	Ga0496119_0051965	Ga0496119_0051965_990_1460	156
383	3300048924	Ga0496121_0151451	Ga0496121_0151451_623_1093	156
384	3300048926	Ga0496123_0036795	Ga0496123_0036795_2031_2516	156
385	3300048927	Ga0496124_0001620	Ga0496124_0001620_23591_24076	156
386	3300049513	Ga0501290_002714	Ga0501290_002714_170_658	156
387	3300049523	Ga0501300_010242	Ga0501300_010242_823_1311	156
388	3300049663	Ga0501223_006424	Ga0501223_006424_1739_2227	156
389	3300049686	Ga0501257_000041	Ga0501257_000041_30085_30573	156
390	3300050508	nmdc:mga09592_581981_c1	nmdc:mga09592_581981_c1_368_862	156
391	3300053087	Ga0500643_001588	Ga0500643_001588_5479_5955	156
392	3300053087	Ga0500643_001702	Ga0500643_001702_442_933	156
393	3300061719	Ga0466962_0204719	Ga0466962_0204719_361_888	156
394	iso_pu_bacteria	2818991466	2819715603	156
395	iso_pu_bacteria	2879163058	2879163728	156
396	iso_pu_bacteria	2928968154	2928970889	156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02600

DsbB

Disulfide bond formation protein DsbB

24

171

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8p3u-assembly1.cif.gz_F	homomeric glua1 in tandem with tarp gamma-3, desensitized conformation 2	0.7402	36	154
6qkz-assembly1.cif.gz_J	full length glua1/2-gamma8 complex	0.7162	36	154
8c1p-assembly1.cif.gz_H	active state homomeric glua1 ampa receptor in complex with tarp gamma 3	0.7079	36	154
8c2h-assembly1.cif.gz_F	transmembrane domain of active state homomeric glua1 ampa receptor in tandem with tarp gamma 3	0.7073	36	154
2rld-assembly1.cif.gz_D	crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution	0.7047	5	89

ID	Description	Score	Start	End	Superfamily
2zuqD00	Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like	0.729	1	150	1.20.1550.10
2zuqD00	Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like	0.7117	1	150	1.20.1550.10
2rldD00	Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence	0.7049	5	89	1.20.1440.60
af_A0A0B4LHK8_82_258_1.20.140.150	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;	0.6774	36	154	1.20.140.150
2zuqA00	Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like	0.6758	1	150	1.20.1550.10

ID	Description	Score	Start	End	GO Terms
AF-A0A521T1B5-F1-model_v4	deleted	0.973	1	97
AF-A0A521T1B5-F1-model_v4	deleted	0.9632	1	97
AF-A0A7G6XZX5-F1-model_v4	Disulfide bond formation protein B	0.9573	1	156	GO:0006457 GO:0015035 GO:0016020
AF-A0A1E3LWW8-F1-model_v4	Disulfide bond formation protein	0.9572	20	154	GO:0006457 GO:0015035 GO:0016020
AF-A0A6N0X0Z7-F1-model_v4	Disulfide bond formation protein B	0.9535	3	152	GO:0006457 GO:0015035 GO:0016020

Feature Viewer

pLDDT	pTM	Quality
89.48	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F433450

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02600

DsbB

Disulfide bond formation protein DsbB

24

171

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map