F433225

General Info

Members Datasets Scaffolds Average Seq Length
395 201 395 142

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10050180|Ga0207643_100501802
Length 161
Sequence MPALHPAPPAAGLGMRGRKPPRRVAWIAGMLSLLASALAWAALAPIELSSRDELFEIPKGTWARRMVGDKVEILPSTIRLTLGINDVLLIRNQDDVPQTFGPTIMMPGQSFRLPFERPASYQFVCTAHASGQLTIDVEAEPTTPWARIHWRARHWWENRKK

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
146 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
152 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 3.54
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10038858 3300003322 Bacteria 1349
2 rootL2_10038859 3300003322 Unclassified 1370
3 Ga0065707_10134002 3300005295 Bacteria 1872
4 Ga0070658_10624814 3300005327 Unclassified 934
5 Ga0070676_10107170 3300005328 Unclassified 1735
6 Ga0070676_10402262 3300005328 Bacteria 953
7 Ga0070690_100049796 3300005330 Bacteria 2672
8 Ga0070690_100914478 3300005330 Bacteria 687
9 Ga0070670_101093493 3300005331 Bacteria 727
10 Ga0070677_10041466 3300005333 Bacteria 1817
11 Ga0068869_100981370 3300005334 Archaea 735
12 Ga0070666_10059129 3300005335 Bacteria 2592
13 Ga0070682_100095699 3300005337 Bacteria 1950
14 Ga0070682_100283406 3300005337 Bacteria 1209
15 Ga0070682_100303366 3300005337 Bacteria 1173
16 Ga0070682_100383501 3300005337 Bacteria 1058
17 Ga0070682_100774395 3300005337 Bacteria 777
18 Ga0070682_101015826 3300005337 Unclassified 689
19 Ga0070682_101563649 3300005337 Unclassified 569
20 Ga0070689_100238810 3300005340 Unclassified 1496
21 Ga0070689_101664904 3300005340 Unclassified 580
22 Ga0070661_101028916 3300005344 Unclassified 684
23 Ga0070661_101199074 3300005344 Bacteria 635
24 Ga0070668_100145400 3300005347 Bacteria 1913
25 Ga0070668_100175510 3300005347 Bacteria 1747
26 Ga0070668_100176743 3300005347 Bacteria 1741
27 Ga0070675_100010209 3300005354 Bacteria 7325
28 Ga0070675_100053133 3300005354 Bacteria 3332
29 Ga0070675_100148604 3300005354 Bacteria 2008
30 Ga0070675_100719086 3300005354 Unclassified 910
31 Ga0070671_100319932 3300005355 Bacteria 1322
32 Ga0070671_101046803 3300005355 Unclassified 716
33 Ga0070671_101074622 3300005355 Unclassified 706
34 Ga0070674_100057210 3300005356 Bacteria 2706
35 Ga0070674_100237743 3300005356 Bacteria 1424
36 Ga0070673_100338664 3300005364 Unclassified 1332
37 Ga0070673_100541450 3300005364 Bacteria 1057
38 Ga0070688_100169326 3300005365 Bacteria 1506
39 Ga0070688_100210565 3300005365 Unclassified 1365
40 Ga0070659_100438283 3300005366 Unclassified 1107
41 Ga0070667_100013359 3300005367 Bacteria 6786
42 Ga0070667_100324996 3300005367 Unclassified 1389
43 Ga0070667_100542803 3300005367 Bacteria 1068
44 Ga0070713_100633144 3300005436 Unclassified 1018
45 Ga0070710_10075555 3300005437 Bacteria 1953
46 Ga0070701_10097515 3300005438 Unclassified 1622
47 Ga0070701_10300845 3300005438 Bacteria 986
48 Ga0070700_100078129 3300005441 Bacteria 2130
49 Ga0070700_100382919 3300005441 Bacteria 1053
50 Ga0070663_100177429 3300005455 Bacteria 1650
51 Ga0070678_100103578 3300005456 Bacteria 2211
52 Ga0070678_100435430 3300005456 Bacteria 1146
53 Ga0070662_100949303 3300005457 Bacteria 735
54 Ga0068867_100077879 3300005459 Bacteria 2492
55 Ga0068867_100077923 3300005459 Bacteria 2492
56 Ga0068867_100492911 3300005459 Bacteria 1052
57 Ga0068867_100975380 3300005459 Unclassified 767
58 Ga0070685_10159344 3300005466 Bacteria 1437
59 Ga0070685_10199855 3300005466 Bacteria 1299
60 Ga0070679_100208380 3300005530 Bacteria 1919
61 Ga0068853_100028936 3300005539 Bacteria 4664
62 Ga0068853_100137928 3300005539 Bacteria 2188
63 Ga0068853_101009538 3300005539 Bacteria 801
64 Ga0068853_102302780 3300005539 Bacteria 522
65 Ga0070672_100002828 3300005543 Bacteria 11118
66 Ga0070672_100016112 3300005543 Bacteria 5346
67 Ga0070672_100022151 3300005543 Bacteria 4661
68 Ga0070672_100040474 3300005543 Bacteria 3576
69 Ga0070686_100037255 3300005544 Bacteria 3016
70 Ga0070686_100171372 3300005544 Bacteria 1535
71 Ga0070686_100755995 3300005544 Bacteria 780
72 Ga0070665_100003603 3300005548 Bacteria 16402
73 Ga0070665_100080452 3300005548 Bacteria 3264
74 Ga0070665_100473676 3300005548 Bacteria 1263
75 Ga0070665_101925066 3300005548 Bacteria 597
76 Ga0070665_102152309 3300005548 Bacteria 562
77 Ga0070704_101946721 3300005549 Unclassified 545
78 Ga0068855_100476277 3300005563 Bacteria 1359
79 Ga0070664_100010472 3300005564 Bacteria 7516
80 Ga0070664_101446162 3300005564 Archaea 650
81 Ga0068857_100129481 3300005577 Bacteria 2275
82 Ga0068856_100545913 3300005614 Bacteria 1180
83 Ga0068856_101103135 3300005614 Bacteria 811
84 Ga0070702_100451966 3300005615 Bacteria 932
85 Ga0068859_100000151 3300005617 Bacteria 66183
86 Ga0068859_100459198 3300005617 Bacteria 1370
87 Ga0068859_100466303 3300005617 Bacteria 1359
88 Ga0068864_100172524 3300005618 Bacteria 1973
89 Ga0068864_100334450 3300005618 Unclassified 1426
90 Ga0068866_10143840 3300005718 Bacteria 1372
91 Ga0068866_10378304 3300005718 Bacteria 907
92 Ga0068861_100145244 3300005719 Bacteria 1941
93 Ga0068861_100963533 3300005719 Unclassified 812
94 Ga0068870_10016937 3300005840 Bacteria 3495
95 Ga0068870_10017728 3300005840 Bacteria 3425
96 Ga0068870_10245332 3300005840 Bacteria 1108
97 Ga0068863_100014402 3300005841 Bacteria 7616
98 Ga0068863_100055877 3300005841 Bacteria 3738
99 Ga0068863_100216891 3300005841 Bacteria 1843
100 Ga0068863_100337651 3300005841 Bacteria 1465
101 Ga0068863_100978085 3300005841 Archaea 848
102 Ga0068863_100978086 3300005841 Unclassified 848
103 Ga0068863_101062268 3300005841 Bacteria 814
104 Ga0068858_100647681 3300005842 Bacteria 1026
105 Ga0068862_100002773 3300005844 Bacteria 15346
106 Ga0068862_100091248 3300005844 Bacteria 2653
107 Ga0068862_100184353 3300005844 Bacteria 1875
108 Ga0068862_100407201 3300005844 Bacteria 1273
109 Ga0068862_100829517 3300005844 Bacteria 905
110 Ga0070715_10278664 3300006163 Bacteria 885
111 Ga0097621_100014235 3300006237 Bacteria 5949
112 Ga0097621_100030587 3300006237 Bacteria 4263
113 Ga0097621_100109970 3300006237 Bacteria 2328
114 Ga0097621_100404465 3300006237 Unclassified 1223
115 Ga0068871_100009012 3300006358 Bacteria 7207
116 Ga0068871_100013573 3300006358 Bacteria 6048
117 Ga0068871_100031654 3300006358 Bacteria 4173
118 Ga0068871_100063774 3300006358 Bacteria 3014
119 Ga0068871_100346232 3300006358 Bacteria 1313
120 Ga0075428_101077690 3300006844 Bacteria 849
121 Ga0075430_101235875 3300006846 Unclassified 615
122 Ga0068865_100106730 3300006881 Bacteria 2059
123 Ga0068865_100119367 3300006881 Bacteria 1958
124 Ga0068865_100129906 3300006881 Bacteria 1886
125 Ga0068865_100674708 3300006881 Bacteria 881
126 Ga0068865_100833187 3300006881 Archaea 798
127 Ga0097620_100000151 3300006931 Bacteria 66183
128 Ga0097620_100459183 3300006931 Bacteria 1370
129 Ga0097620_100466307 3300006931 Bacteria 1359
130 Ga0075435_100357569 3300007076 Bacteria 1252
131 Ga0105240_10873524 3300009093 Bacteria 969
132 Ga0111539_10028444 3300009094 Bacteria 6819
133 Ga0105247_10163057 3300009101 Bacteria 1477
134 Ga0105243_10433554 3300009148 Bacteria 1229
135 Ga0105243_10873004 3300009148 Bacteria 893
136 Ga0105241_10135604 3300009174 Bacteria 1998
137 Ga0105242_10314452 3300009176 Bacteria 1434
138 Ga0105242_10920552 3300009176 Bacteria 876
139 Ga0105242_11295680 3300009176 Unclassified 752
140 Ga0105248_10035518 3300009177 Bacteria 5576
141 Ga0105248_11599179 3300009177 Unclassified 738
142 Ga0105238_11042880 3300009551 Bacteria 839
143 Ga0105249_10729841 3300009553 Bacteria 1052
144 Ga0105239_10448154 3300010375 Bacteria 1464
145 Ga0105239_12181485 3300010375 Unclassified 644
146 Ga0157370_11004025 3300013104 Bacteria 755
147 Ga0157370_11411945 3300013104 Bacteria 626
148 Ga0157374_10078646 3300013296 Bacteria 3124
149 Ga0157374_10108756 3300013296 Bacteria 2665
150 Ga0163162_10010583 3300013306 Bacteria 8972
151 Ga0163162_10087788 3300013306 Bacteria 3189
152 Ga0163162_10368166 3300013306 Bacteria 1570
153 Ga0157372_10386870 3300013307 Bacteria 1630
154 Ga0157375_10004701 3300013308 Bacteria 11887
155 Ga0157375_10012567 3300013308 Bacteria 7514
156 Ga0157375_10586544 3300013308 Unclassified 1275
157 Ga0157375_11374903 3300013308 Bacteria 831
158 Ga0157375_12668711 3300013308 Bacteria 597
159 Ga0163163_10089615 3300014325 Bacteria 3088
160 Ga0163163_10281309 3300014325 Bacteria 1715
161 Ga0163163_11088310 3300014325 Bacteria 862
162 Ga0163163_11133006 3300014325 Bacteria 845
163 Ga0163163_11359334 3300014325 Unclassified 772
164 Ga0163163_12203333 3300014325 Unclassified 610
165 Ga0157380_10030003 3300014326 Bacteria 4161
166 Ga0157380_10101698 3300014326 Bacteria 2395
167 Ga0157380_10484798 3300014326 Unclassified 1197
168 Ga0157380_10635021 3300014326 Bacteria 1062
169 Ga0157380_10792996 3300014326 Bacteria 963
170 Ga0157380_12746274 3300014326 Bacteria 559
171 Ga0157377_11541488 3300014745 Unclassified 530
172 Ga0157379_10273645 3300014968 Bacteria 1536
173 Ga0157379_10670780 3300014968 Bacteria 972
174 Ga0157379_11343500 3300014968 Bacteria 691
175 Ga0157376_10010196 3300014969 Bacteria 6861
176 Ga0157376_10084887 3300014969 Bacteria 2727
177 Ga0157376_10119201 3300014969 Bacteria 2336
178 Ga0157376_10215171 3300014969 Bacteria 1776
179 Ga0157376_10281678 3300014969 Bacteria 1566
180 Ga0157376_10615018 3300014969 Bacteria 1083
181 Ga0157376_12267213 3300014969 Bacteria 582
182 Ga0163161_10398295 3300017792 Bacteria 1103
183 Ga0163161_10560184 3300017792 Bacteria 938
184 Ga0163161_10776203 3300017792 Bacteria 803
185 Ga0163161_11152298 3300017792 Unclassified 668
186 Ga0207697_10266291 3300025315 Unclassified 759
187 Ga0207682_10005978 3300025893 Bacteria 4923
188 Ga0207642_10044762 3300025899 Bacteria 1961
189 Ga0207680_10030679 3300025903 Bacteria 3036
190 Ga0207680_10111179 3300025903 Bacteria 1777
191 Ga0207685_10077393 3300025905 Bacteria 1366
192 Ga0207645_10273400 3300025907 Bacteria 1121
193 Ga0207645_10734718 3300025907 Unclassified 671
194 Ga0207643_10003576 3300025908 Bacteria 8370
195 Ga0207643_10016401 3300025908 Bacteria 4041
196 Ga0207643_10050180 3300025908 Bacteria 2366
197 Ga0207695_11425980 3300025913 Bacteria 573
198 Ga0207662_10385174 3300025918 Bacteria 948
199 Ga0207649_11061335 3300025920 Unclassified 638
200 Ga0207681_10108235 3300025923 Bacteria 2017
201 Ga0207681_10807179 3300025923 Bacteria 784
202 Ga0207694_10874725 3300025924 Bacteria 760
203 Ga0207650_10201532 3300025925 Bacteria 1594
204 Ga0207650_10509842 3300025925 Bacteria 1006
205 Ga0207659_10116984 3300025926 Bacteria 2036
206 Ga0207659_10185790 3300025926 Bacteria 1650
207 Ga0207659_10265534 3300025926 Unclassified 1398
208 Ga0207644_10206137 3300025931 Bacteria 1553
209 Ga0207644_11365263 3300025931 Unclassified 595
210 Ga0207644_11469082 3300025931 Unclassified 572
211 Ga0207690_11071289 3300025932 Archaea 671
212 Ga0207706_10251910 3300025933 Bacteria 1542
213 Ga0207686_10161098 3300025934 Bacteria 1572
214 Ga0207686_10952353 3300025934 Unclassified 695
215 Ga0207670_11245483 3300025936 Unclassified 630
216 Ga0207669_10040884 3300025937 Bacteria 2693
217 Ga0207669_10145187 3300025937 Bacteria 1653
218 Ga0207704_10106185 3300025938 Bacteria 1886
219 Ga0207704_10598884 3300025938 Bacteria 902
220 Ga0207704_11007501 3300025938 Archaea 705
221 Ga0207704_11839233 3300025938 Unclassified 521
222 Ga0207691_10005747 3300025940 Bacteria 12000
223 Ga0207691_10037020 3300025940 Bacteria 4520
224 Ga0207691_10044915 3300025940 Bacteria 4065
225 Ga0207691_10046396 3300025940 Bacteria 3993
226 Ga0207691_10181896 3300025940 Bacteria 1836
227 Ga0207691_10377311 3300025940 Bacteria 1211
228 Ga0207691_11015639 3300025940 Unclassified 692
229 Ga0207711_10465374 3300025941 Unclassified 1177
230 Ga0207689_10101624 3300025942 Bacteria 2362
231 Ga0207689_10107327 3300025942 Bacteria 2295
232 Ga0207689_11249753 3300025942 Unclassified 625
233 Ga0207679_10550068 3300025945 Bacteria 1035
234 Ga0207679_11026158 3300025945 Unclassified 756
235 Ga0207667_10922685 3300025949 Bacteria 864
236 Ga0207651_10626801 3300025960 Unclassified 942
237 Ga0207712_10051011 3300025961 Bacteria 2891
238 Ga0207712_10487510 3300025961 Bacteria 1052
239 Ga0207668_10037273 3300025972 Bacteria 3253
240 Ga0207668_10189188 3300025972 Bacteria 1630
241 Ga0207668_10192992 3300025972 Bacteria 1615
242 Ga0207658_10143168 3300025986 Bacteria 1938
243 Ga0207658_10506257 3300025986 Bacteria 1076
244 Ga0207658_10604501 3300025986 Bacteria 985
245 Ga0207677_11907382 3300026023 Unclassified 552
246 Ga0207703_10483768 3300026035 Bacteria 1160
247 Ga0207639_10116592 3300026041 Bacteria 2187
248 Ga0207639_10123194 3300026041 Bacteria 2134
249 Ga0207639_10354380 3300026041 Bacteria 1311
250 Ga0207639_10440291 3300026041 Bacteria 1181
251 Ga0207639_10609133 3300026041 Bacteria 1008
252 Ga0207678_10165557 3300026067 Bacteria 1888
253 Ga0207678_10179626 3300026067 Bacteria 1807
254 Ga0207678_10188453 3300026067 Bacteria 1762
255 Ga0207708_10040804 3300026075 Bacteria 3539
256 Ga0207708_10086901 3300026075 Bacteria 2407
257 Ga0207708_10469200 3300026075 Bacteria 1051
258 Ga0207702_10135474 3300026078 Bacteria 2222
259 Ga0207641_10094874 3300026088 Bacteria 2617
260 Ga0207641_10268707 3300026088 Bacteria 1599
261 Ga0207641_10288753 3300026088 Bacteria 1545
262 Ga0207641_10339393 3300026088 Bacteria 1429
263 Ga0207648_10013121 3300026089 Bacteria 7724
264 Ga0207648_10015790 3300026089 Bacteria 6924
265 Ga0207648_10084328 3300026089 Bacteria 2771
266 Ga0207648_10703620 3300026089 Bacteria 936
267 Ga0207648_10790536 3300026089 Unclassified 883
268 Ga0207676_10011285 3300026095 Bacteria 6384
269 Ga0207676_10177679 3300026095 Bacteria 1861
270 Ga0207674_10534639 3300026116 Bacteria 1132
271 Ga0207675_100252335 3300026118 Bacteria 1708
272 Ga0207675_100380954 3300026118 Unclassified 1387
273 Ga0207675_100751889 3300026118 Bacteria 986
274 Ga0207675_100995258 3300026118 Bacteria 857
275 Ga0207683_10069401 3300026121 Bacteria 3112
276 Ga0207683_10140605 3300026121 Unclassified 2175
277 Ga0207683_10446874 3300026121 Bacteria 1191
278 Ga0268266_10004864 3300028379 Bacteria 12745
279 Ga0268266_10057649 3300028379 Bacteria 3343
280 Ga0268266_10771640 3300028379 Bacteria 928
281 Ga0268266_11343514 3300028379 Bacteria 690
282 Ga0268266_11695725 3300028379 Bacteria 607
283 Ga0268265_10000554 3300028380 Bacteria 38099
284 Ga0268265_10083441 3300028380 Bacteria 2530
285 Ga0268265_10238042 3300028380 Bacteria 1604
286 Ga0268265_10624064 3300028380 Unclassified 1033
287 Ga0268264_10007846 3300028381 Bacteria 8885
288 Ga0268264_10289321 3300028381 Bacteria 1538
289 Ga0268264_10414699 3300028381 Unclassified 1297
290 Ga0268264_10526578 3300028381 Bacteria 1156
291 Ga0307515_10272329 3300028794 Bacteria 1412
292 Ga0307513_10036586 3300031456 Bacteria 5473
293 Ga0307513_10060565 3300031456 Bacteria 4013
294 Ga0307513_10197230 3300031456 Bacteria 1858
295 Ga0307509_10031569 3300031507 Bacteria 5849
296 Ga0307509_10049953 3300031507 Bacteria 4481
297 Ga0307408_100036171 3300031548 Bacteria 3470
298 Ga0307408_100049655 3300031548 Bacteria 3014
299 Ga0307408_100354505 3300031548 Bacteria 1246
300 Ga0307408_101544131 3300031548 Unclassified 629
301 Ga0307405_11194156 3300031731 Bacteria 658
302 Ga0307413_10006142 3300031824 Bacteria 5452
303 Ga0307413_10046651 3300031824 Bacteria 2578
304 Ga0307413_11202761 3300031824 Unclassified 659
305 Ga0307406_10010098 3300031901 Bacteria 5318
306 Ga0307406_10298997 3300031901 Bacteria 1236
307 Ga0307407_10118587 3300031903 Bacteria 1673
308 Ga0307407_10420033 3300031903 Bacteria 963
309 Ga0307409_100061382 3300031995 Bacteria 2937
310 Ga0307409_100198581 3300031995 Bacteria 1792
311 Ga0307416_100325315 3300032002 Bacteria 1542
312 Ga0307416_100525506 3300032002 Bacteria 1252
313 Ga0307414_10425517 3300032004 Unclassified 1159
314 Ga0307411_10000884 3300032005 Bacteria 11352
315 Ga0307411_10035580 3300032005 Bacteria 3111
316 Ga0307411_10169734 3300032005 Bacteria 1644
317 Ga0307415_100056983 3300032126 Bacteria 2683
318 Ga0307415_100117423 3300032126 Bacteria 1987
319 Ga0307415_100292034 3300032126 Bacteria 1346
320 Ga0373944_0027849 3300035089 Bacteria 1679
321 Ga0373936_0095382 3300035113 Bacteria 1251
322 Ga0373954_0362231 3300035118 Bacteria 716
323 Ga0373946_0708352 3300035171 Unclassified 527
324 Ga0373955_0961925 3300035172 Unclassified 526
325 Ga0373935_0902283 3300035692 Bacteria 655
326 Ga0373937_0359152 3300036401 Bacteria 1380
327 Ga0373937_1150480 3300036401 Unclassified 724
328 Ga0373925_1447707 3300037068 Unclassified 562
329 Ga0451789_0848012 3300041443 Bacteria 1528
330 Ga0451797_0256080 3300041453 Unclassified 762
331 Ga0451795_0828306 3300041456 Unclassified 741
332 Ga0451795_1270429 3300041456 Bacteria 909
333 Ga0451798_0428982 3300041458 Bacteria 3406
334 Ga0451800_1138260 3300041459 Bacteria 1421
335 Ga0451802_0440653 3300041460 Bacteria 1021
336 Ga0451807_0455525 3300041486 Bacteria 1850
337 Ga0451807_1994860 3300041486 Bacteria 1082
338 Ga0451833_1096462 3300041491 Unclassified 661
339 Ga0451845_0416300 3300041501 Bacteria 696
340 Ga0451843_1327590 3300041509 Unclassified 506
341 Ga0451843_1606178 3300041509 Bacteria 1401
342 Ga0451853_0417456 3300041512 Bacteria 1676
343 Ga0451853_0599778 3300041512 Unclassified 875
344 Ga0450916_037151 3300042530 Bacteria 730
345 Ga0495603_0321770 3300046455 Bacteria 888
346 Ga0495590_0096899 3300046457 Unclassified 1046
347 Ga0495629_0545412 3300046459 Bacteria 779
348 Ga0495638_0028670 3300046460 Bacteria 3592
349 Ga0495582_0173096 3300046473 Bacteria 1229
350 Ga0495605_0309684 3300046474 Bacteria 667
351 Ga0495616_0000837 3300046513 Bacteria 22426
352 Ga0495620_0054957 3300046515 Bacteria 1680
353 Ga0495632_0104477 3300046519 Bacteria 1333
354 Ga0495587_0190374 3300046536 Bacteria 1162
355 Ga0495625_0004587 3300046660 Bacteria 12991
356 Ga0495625_0154756 3300046660 Bacteria 1539
357 Ga0495635_0220392 3300046663 Unclassified 1283
358 Ga0495657_0083911 3300046675 Bacteria 2056
359 Ga0495647_0060473 3300046681 Bacteria 1494
360 Ga0495658_0027863 3300046683 Bacteria 3044
361 Ga0495670_0501806 3300046691 Bacteria 659
362 Ga0495670_0507514 3300046691 Unclassified 655
363 Ga0495649_0001712 3300046694 Bacteria 16270
364 Ga0495649_0063551 3300046694 Bacteria 1983
365 Ga0495649_0099329 3300046694 Bacteria 1548
366 Ga0495589_0436235 3300046794 Unclassified 600
367 Ga0495600_0422882 3300046809 Unclassified 827
368 Ga0495680_0256551 3300047322 Bacteria 1238
369 Ga0495686_0094731 3300047472 Bacteria 1809
370 Ga0495686_0131234 3300047472 Bacteria 1485
371 Ga0495615_0129467 3300048090 Bacteria 737
372 Ga0496102_0086488 3300048905 Bacteria 2895
373 Ga0496103_0248519 3300048906 Bacteria 1144
374 Ga0496104_0131415 3300048907 Bacteria 2405
375 Ga0496110_0481951 3300048913 Bacteria 1130
376 Ga0496114_0083478 3300048917 Bacteria 2703
377 Ga0496117_0287670 3300048920 Bacteria 877
378 Ga0496118_0007082 3300048921 Bacteria 12045
379 Ga0495682_0361028 3300049460 Unclassified 512
380 Ga0501031_0719203 3300049568 Bacteria 641
381 Ga0501032_0520835 3300049569 Unclassified 759
382 Ga0501034_0150550 3300049571 Bacteria 2303
383 Ga0501036_0466371 3300049572 Bacteria 1052
384 Ga0501037_0207137 3300049573 Bacteria 1384
385 Ga0501042_0102262 3300049578 Bacteria 2061
386 Ga0501068_0109966 3300049584 Bacteria 1713
387 Ga0501070_0815601 3300049586 Bacteria 732
388 Ga0501071_0812206 3300049587 Bacteria 721
389 Ga0501073_0103726 3300049589 Bacteria 1974
390 Ga0501079_0512754 3300049741 Bacteria 943
391 nmdc:mga0qj67_1117538_c1 3300050509 Unclassified 615
392 nmdc:mga0rr50_374377_c1 3300050513 Bacteria 1200
393 Ga0495601_0406114 3300053077 Bacteria 883
394 Ga0500611_054260 3300053727 Bacteria 928
395 Ga0530510_0770859 3300061734 Bacteria 734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_11411945 Ga0157370_114119451 118
2 3300005614 Ga0068856_100545913 Ga0068856_1005459132 125
3 3300005841 Ga0068863_100055877 Ga0068863_1000558772 127
4 3300006237 Ga0097621_100014235 Ga0097621_1000142354 127
5 3300006358 Ga0068871_100009012 Ga0068871_1000090125 127
6 3300013296 Ga0157374_10108756 Ga0157374_101087563 127
7 3300013306 Ga0163162_10010583 Ga0163162_100105835 128
8 3300014969 Ga0157376_10084887 Ga0157376_100848872 128
9 3300025940 Ga0207691_10377311 Ga0207691_103773112 129
10 3300025931 Ga0207644_11469082 Ga0207644_114690822 131
11 3300046794 Ga0495589_0436235 Ga0495589_0436235_18_413 131
12 3300050509 nmdc:mga0qj67_1117538_c1 nmdc:mga0qj67_1117538_c1_164_559 131
13 3300049571 Ga0501034_0150550 Ga0501034_0150550_1115_1570 132
14 3300005549 Ga0070704_101946721 Ga0070704_1019467211 133
15 3300031731 Ga0307405_11194156 Ga0307405_111941562 133
16 3300049460 Ga0495682_0361028 Ga0495682_0361028_10_414 133
17 3300013308 Ga0157375_12668711 Ga0157375_126687112 134
18 3300014325 Ga0163163_10089615 Ga0163163_100896152 134
19 3300014326 Ga0157380_10101698 Ga0157380_101016982 134
20 3300014326 Ga0157380_10792996 Ga0157380_107929962 134
21 3300031507 Ga0307509_10031569 Ga0307509_100315694 134
22 3300046515 Ga0495620_0054957 Ga0495620_0054957_216_620 134
23 3300048090 Ga0495615_0129467 Ga0495615_0129467_193_597 134
24 3300005295 Ga0065707_10134002 Ga0065707_101340023 135
25 3300035172 Ga0373955_0961925 Ga0373955_0961925_96_509 135
26 3300005719 Ga0068861_100963533 Ga0068861_1009635332 136
27 3300007076 Ga0075435_100357569 Ga0075435_1003575691 136
28 3300009551 Ga0105238_11042880 Ga0105238_110428802 136
29 3300025924 Ga0207694_10874725 Ga0207694_108747251 136
30 3300050513 nmdc:mga0rr50_374377_c1 nmdc:mga0rr50_374377_c1_722_1153 136
31 3300009094 Ga0111539_10028444 Ga0111539_100284441 137
32 3300028381 Ga0268264_10007846 Ga0268264_100078462 137
33 3300031824 Ga0307413_11202761 Ga0307413_112027612 137
34 3300032002 Ga0307416_100525506 Ga0307416_1005255062 137
35 3300032005 Ga0307411_10169734 Ga0307411_101697343 137
36 3300032126 Ga0307415_100292034 Ga0307415_1002920342 137
37 3300041509 Ga0451843_1327590 Ga0451843_1327590_11_493 137
38 3300046675 Ga0495657_0083911 Ga0495657_0083911_948_1370 137
39 3300046691 Ga0495670_0507514 Ga0495670_0507514_19_474 137
40 3300005328 Ga0070676_10107170 Ga0070676_101071702 138
41 3300005330 Ga0070690_100049796 Ga0070690_1000497963 138
42 3300005331 Ga0070670_101093493 Ga0070670_1010934932 138
43 3300005333 Ga0070677_10041466 Ga0070677_100414663 138
44 3300005334 Ga0068869_100981370 Ga0068869_1009813702 138
45 3300005337 Ga0070682_100095699 Ga0070682_1000956993 138
46 3300005337 Ga0070682_100383501 Ga0070682_1003835011 138
47 3300005337 Ga0070682_101563649 Ga0070682_1015636491 138
48 3300005340 Ga0070689_101664904 Ga0070689_1016649041 138
49 3300005347 Ga0070668_100175510 Ga0070668_1001755101 138
50 3300005347 Ga0070668_100176743 Ga0070668_1001767432 138
51 3300005354 Ga0070675_100148604 Ga0070675_1001486042 138
52 3300005355 Ga0070671_101074622 Ga0070671_1010746222 138
53 3300005356 Ga0070674_100057210 Ga0070674_1000572103 138
54 3300005364 Ga0070673_100338664 Ga0070673_1003386642 138
55 3300005365 Ga0070688_100169326 Ga0070688_1001693263 138
56 3300005367 Ga0070667_100013359 Ga0070667_1000133592 138
57 3300005456 Ga0070678_100103578 Ga0070678_1001035782 138
58 3300005459 Ga0068867_100077879 Ga0068867_1000778792 138
59 3300005530 Ga0070679_100208380 Ga0070679_1002083802 138
60 3300005539 Ga0068853_100028936 Ga0068853_1000289364 138
61 3300005539 Ga0068853_102302780 Ga0068853_1023027801 138
62 3300005543 Ga0070672_100016112 Ga0070672_1000161123 138
63 3300005543 Ga0070672_100022151 Ga0070672_1000221517 138
64 3300005544 Ga0070686_100171372 Ga0070686_1001713722 138
65 3300005548 Ga0070665_100473676 Ga0070665_1004736762 138
66 3300005548 Ga0070665_101925066 Ga0070665_1019250661 138
67 3300005563 Ga0068855_100476277 Ga0068855_1004762772 138
68 3300005577 Ga0068857_100129481 Ga0068857_1001294813 138
69 3300005614 Ga0068856_101103135 Ga0068856_1011031352 138
70 3300005617 Ga0068859_100000151 Ga0068859_10000015119 138
71 3300005618 Ga0068864_100334450 Ga0068864_1003344503 138
72 3300005718 Ga0068866_10378304 Ga0068866_103783042 138
73 3300005840 Ga0068870_10016937 Ga0068870_100169374 138
74 3300005841 Ga0068863_100014402 Ga0068863_1000144023 138
75 3300005841 Ga0068863_100337651 Ga0068863_1003376512 138
76 3300005841 Ga0068863_100978085 Ga0068863_1009780852 138
77 3300005841 Ga0068863_100978086 Ga0068863_1009780862 138
78 3300005842 Ga0068858_100647681 Ga0068858_1006476812 138
79 3300005844 Ga0068862_100002773 Ga0068862_1000027732 138
80 3300006237 Ga0097621_100030587 Ga0097621_1000305873 138
81 3300006237 Ga0097621_100109970 Ga0097621_1001099703 138
82 3300006358 Ga0068871_100031654 Ga0068871_1000316543 138
83 3300006358 Ga0068871_100346232 Ga0068871_1003462322 138
84 3300006846 Ga0075430_101235875 Ga0075430_1012358752 138
85 3300006881 Ga0068865_100119367 Ga0068865_1001193671 138
86 3300006881 Ga0068865_100129906 Ga0068865_1001299062 138
87 3300006881 Ga0068865_100674708 Ga0068865_1006747082 138
88 3300006931 Ga0097620_100000151 Ga0097620_10000015119 138
89 3300009093 Ga0105240_10873524 Ga0105240_108735242 138
90 3300009101 Ga0105247_10163057 Ga0105247_101630573 138
91 3300009174 Ga0105241_10135604 Ga0105241_101356042 138
92 3300009176 Ga0105242_10314452 Ga0105242_103144522 138
93 3300009176 Ga0105242_10920552 Ga0105242_109205522 138
94 3300009176 Ga0105242_11295680 Ga0105242_112956802 138
95 3300009177 Ga0105248_11599179 Ga0105248_115991792 138
96 3300009553 Ga0105249_10729841 Ga0105249_107298412 138
97 3300010375 Ga0105239_10448154 Ga0105239_104481543 138
98 3300010375 Ga0105239_12181485 Ga0105239_121814852 138
99 3300013104 Ga0157370_11004025 Ga0157370_110040252 138
100 3300013296 Ga0157374_10078646 Ga0157374_100786463 138
101 3300013306 Ga0163162_10368166 Ga0163162_103681662 138
102 3300013307 Ga0157372_10386870 Ga0157372_103868702 138
103 3300013308 Ga0157375_10012567 Ga0157375_100125677 138
104 3300013308 Ga0157375_11374903 Ga0157375_113749032 138
105 3300014325 Ga0163163_10281309 Ga0163163_102813092 138
106 3300014325 Ga0163163_11088310 Ga0163163_110883102 138
107 3300014325 Ga0163163_11359334 Ga0163163_113593342 138
108 3300014325 Ga0163163_12203333 Ga0163163_122033331 138
109 3300014968 Ga0157379_10670780 Ga0157379_106707802 138
110 3300014968 Ga0157379_11343500 Ga0157379_113435002 138
111 3300014969 Ga0157376_10010196 Ga0157376_100101965 138
112 3300014969 Ga0157376_10615018 Ga0157376_106150182 138
113 3300014969 Ga0157376_12267213 Ga0157376_122672132 138
114 3300017792 Ga0163161_10398295 Ga0163161_103982952 138
115 3300017792 Ga0163161_11152298 Ga0163161_111522982 138
116 3300025315 Ga0207697_10266291 Ga0207697_102662911 138
117 3300025893 Ga0207682_10005978 Ga0207682_100059783 138
118 3300025903 Ga0207680_10111179 Ga0207680_101111793 138
119 3300025907 Ga0207645_10273400 Ga0207645_102734002 138
120 3300025908 Ga0207643_10016401 Ga0207643_100164014 138
121 3300025913 Ga0207695_11425980 Ga0207695_114259801 138
122 3300025923 Ga0207681_10807179 Ga0207681_108071792 138
123 3300025925 Ga0207650_10509842 Ga0207650_105098422 138
124 3300025934 Ga0207686_10161098 Ga0207686_101610982 138
125 3300025936 Ga0207670_11245483 Ga0207670_112454832 138
126 3300025937 Ga0207669_10145187 Ga0207669_101451873 138
127 3300025938 Ga0207704_10106185 Ga0207704_101061852 138
128 3300025938 Ga0207704_11839233 Ga0207704_118392331 138
129 3300025940 Ga0207691_10044915 Ga0207691_100449154 138
130 3300025940 Ga0207691_10181896 Ga0207691_101818963 138
131 3300025940 Ga0207691_11015639 Ga0207691_110156392 138
132 3300025941 Ga0207711_10465374 Ga0207711_104653742 138
133 3300025942 Ga0207689_10107327 Ga0207689_101073273 138
134 3300025942 Ga0207689_11249753 Ga0207689_112497531 138
135 3300025949 Ga0207667_10922685 Ga0207667_109226852 138
136 3300025961 Ga0207712_10487510 Ga0207712_104875102 138
137 3300025972 Ga0207668_10037273 Ga0207668_100372733 138
138 3300025972 Ga0207668_10192992 Ga0207668_101929923 138
139 3300025986 Ga0207658_10143168 Ga0207658_101431682 138
140 3300025986 Ga0207658_10506257 Ga0207658_105062572 138
141 3300026035 Ga0207703_10483768 Ga0207703_104837682 138
142 3300026041 Ga0207639_10123194 Ga0207639_101231942 138
143 3300026041 Ga0207639_10609133 Ga0207639_106091332 138
144 3300026067 Ga0207678_10179626 Ga0207678_101796262 138
145 3300026078 Ga0207702_10135474 Ga0207702_101354741 138
146 3300026088 Ga0207641_10268707 Ga0207641_102687073 138
147 3300026088 Ga0207641_10288753 Ga0207641_102887532 138
148 3300026088 Ga0207641_10339393 Ga0207641_103393932 138
149 3300026089 Ga0207648_10013121 Ga0207648_100131214 138
150 3300026095 Ga0207676_10011285 Ga0207676_100112852 138
151 3300026095 Ga0207676_10177679 Ga0207676_101776792 138
152 3300026116 Ga0207674_10534639 Ga0207674_105346392 138
153 3300026118 Ga0207675_100995258 Ga0207675_1009952581 138
154 3300026121 Ga0207683_10069401 Ga0207683_100694013 138
155 3300026121 Ga0207683_10140605 Ga0207683_101406053 138
156 3300028380 Ga0268265_10000554 Ga0268265_100005549 138
157 3300028380 Ga0268265_10083441 Ga0268265_100834413 138
158 3300028381 Ga0268264_10289321 Ga0268264_102893212 138
159 3300041453 Ga0451797_0256080 Ga0451797_0256080_253_681 138
160 3300041456 Ga0451795_1270429 Ga0451795_1270429_32_460 138
161 3300041460 Ga0451802_0440653 Ga0451802_0440653_552_980 138
162 3300041501 Ga0451845_0416300 Ga0451845_0416300_267_683 138
163 3300041509 Ga0451843_1606178 Ga0451843_1606178_246_674 138
164 3300046691 Ga0495670_0501806 Ga0495670_0501806_57_479 138
165 3300046694 Ga0495649_0099329 Ga0495649_0099329_898_1323 138
166 3300048905 Ga0496102_0086488 Ga0496102_0086488_1953_2378 138
167 3300048906 Ga0496103_0248519 Ga0496103_0248519_157_582 138
168 3300048913 Ga0496110_0481951 Ga0496110_0481951_143_565 138
169 3300048920 Ga0496117_0287670 Ga0496117_0287670_55_480 138
170 3300048921 Ga0496118_0007082 Ga0496118_0007082_8642_9067 138
171 3300049568 Ga0501031_0719203 Ga0501031_0719203_64_483 138
172 3300049569 Ga0501032_0520835 Ga0501032_0520835_136_555 138
173 3300049572 Ga0501036_0466371 Ga0501036_0466371_42_461 138
174 3300049573 Ga0501037_0207137 Ga0501037_0207137_180_599 138
175 3300049584 Ga0501068_0109966 Ga0501068_0109966_1142_1561 138
176 3300049586 Ga0501070_0815601 Ga0501070_0815601_273_692 138
177 3300049587 Ga0501071_0812206 Ga0501071_0812206_220_639 138
178 3300049589 Ga0501073_0103726 Ga0501073_0103726_1325_1744 138
179 3300049741 Ga0501079_0512754 Ga0501079_0512754_148_567 138
180 3300061734 Ga0530510_0770859 Ga0530510_0770859_85_504 138
181 3300005330 Ga0070690_100914478 Ga0070690_1009144782 139
182 3300005615 Ga0070702_100451966 Ga0070702_1004519662 139
183 3300009148 Ga0105243_10873004 Ga0105243_108730042 139
184 3300014326 Ga0157380_10484798 Ga0157380_104847982 139
185 3300014326 Ga0157380_10635021 Ga0157380_106350212 139
186 3300035089 Ga0373944_0027849 Ga0373944_0027849_72_500 139
187 3300035113 Ga0373936_0095382 Ga0373936_0095382_505_933 139
188 3300035118 Ga0373954_0362231 Ga0373954_0362231_96_524 139
189 3300035171 Ga0373946_0708352 Ga0373946_0708352_54_482 139
190 3300035692 Ga0373935_0902283 Ga0373935_0902283_186_614 139
191 3300036401 Ga0373937_0359152 Ga0373937_0359152_284_712 139
192 3300037068 Ga0373925_1447707 Ga0373925_1447707_42_470 139
193 3300046455 Ga0495603_0321770 Ga0495603_0321770_309_737 139
194 3300046459 Ga0495629_0545412 Ga0495629_0545412_70_498 139
195 3300046473 Ga0495582_0173096 Ga0495582_0173096_400_828 139
196 3300046536 Ga0495587_0190374 Ga0495587_0190374_368_796 139
197 3300046663 Ga0495635_0220392 Ga0495635_0220392_627_1055 139
198 3300046681 Ga0495647_0060473 Ga0495647_0060473_673_1101 139
199 3300046683 Ga0495658_0027863 Ga0495658_0027863_907_1335 139
200 3300046809 Ga0495600_0422882 Ga0495600_0422882_73_501 139
201 3300047322 Ga0495680_0256551 Ga0495680_0256551_468_896 139
202 3300049578 Ga0501042_0102262 Ga0501042_0102262_1515_1937 139
203 3300053077 Ga0495601_0406114 Ga0495601_0406114_347_775 139
204 3300005327 Ga0070658_10624814 Ga0070658_106248141 140
205 3300005328 Ga0070676_10402262 Ga0070676_104022621 140
206 3300005335 Ga0070666_10059129 Ga0070666_100591292 140
207 3300005337 Ga0070682_101015826 Ga0070682_1010158262 140
208 3300005344 Ga0070661_101199074 Ga0070661_1011990741 140
209 3300005355 Ga0070671_100319932 Ga0070671_1003199321 140
210 3300005355 Ga0070671_101046803 Ga0070671_1010468032 140
211 3300005367 Ga0070667_100324996 Ga0070667_1003249962 140
212 3300005436 Ga0070713_100633144 Ga0070713_1006331442 140
213 3300005459 Ga0068867_100077923 Ga0068867_1000779234 140
214 3300005539 Ga0068853_100137928 Ga0068853_1001379282 140
215 3300005548 Ga0070665_100080452 Ga0070665_1000804521 140
216 3300005840 Ga0068870_10245332 Ga0068870_102453322 140
217 3300005841 Ga0068863_101062268 Ga0068863_1010622682 140
218 3300006358 Ga0068871_100063774 Ga0068871_1000637743 140
219 3300006844 Ga0075428_101077690 Ga0075428_1010776901 140
220 3300009177 Ga0105248_10035518 Ga0105248_100355185 140
221 3300013306 Ga0163162_10087788 Ga0163162_100877883 140
222 3300013308 Ga0157375_10586544 Ga0157375_105865442 140
223 3300014968 Ga0157379_10273645 Ga0157379_102736451 140
224 3300014969 Ga0157376_10215171 Ga0157376_102151712 140
225 3300017792 Ga0163161_10776203 Ga0163161_107762032 140
226 3300025903 Ga0207680_10030679 Ga0207680_100306794 140
227 3300025907 Ga0207645_10734718 Ga0207645_107347182 140
228 3300025908 Ga0207643_10050180 Ga0207643_100501802 140
229 3300025920 Ga0207649_11061335 Ga0207649_110613352 140
230 3300025931 Ga0207644_10206137 Ga0207644_102061372 140
231 3300025931 Ga0207644_11365263 Ga0207644_113652631 140
232 3300025934 Ga0207686_10952353 Ga0207686_109523532 140
233 3300025961 Ga0207712_10051011 Ga0207712_100510113 140
234 3300025986 Ga0207658_10604501 Ga0207658_106045012 140
235 3300026023 Ga0207677_11907382 Ga0207677_119073821 140
236 3300026041 Ga0207639_10354380 Ga0207639_103543802 140
237 3300026041 Ga0207639_10440291 Ga0207639_104402912 140
238 3300026089 Ga0207648_10084328 Ga0207648_100843284 140
239 3300028379 Ga0268266_10057649 Ga0268266_100576494 140
240 3300028379 Ga0268266_10771640 Ga0268266_107716402 140
241 3300031824 Ga0307413_10006142 Ga0307413_100061424 140
242 3300031903 Ga0307407_10420033 Ga0307407_104200332 140
243 3300031995 Ga0307409_100198581 Ga0307409_1001985813 140
244 3300032004 Ga0307414_10425517 Ga0307414_104255172 140
245 3300032005 Ga0307411_10035580 Ga0307411_100355803 140
246 3300036401 Ga0373937_1150480 Ga0373937_1150480_106_537 140
247 3300041491 Ga0451833_1096462 Ga0451833_1096462_13_438 140
248 3300041512 Ga0451853_0599778 Ga0451853_0599778_62_487 140
249 3300003322 rootL2_10038859 rootL2_100388592 141
250 3300005347 Ga0070668_100145400 Ga0070668_1001454002 141
251 3300005354 Ga0070675_100010209 Ga0070675_1000102098 141
252 3300005356 Ga0070674_100237743 Ga0070674_1002377432 141
253 3300005441 Ga0070700_100382919 Ga0070700_1003829192 141
254 3300005456 Ga0070678_100435430 Ga0070678_1004354302 141
255 3300005457 Ga0070662_100949303 Ga0070662_1009493031 141
256 3300005466 Ga0070685_10199855 Ga0070685_101998552 141
257 3300005543 Ga0070672_100040474 Ga0070672_1000404742 141
258 3300005548 Ga0070665_102152309 Ga0070665_1021523091 141
259 3300005618 Ga0068864_100172524 Ga0068864_1001725243 141
260 3300005718 Ga0068866_10143840 Ga0068866_101438402 141
261 3300005840 Ga0068870_10017728 Ga0068870_100177284 141
262 3300005844 Ga0068862_100829517 Ga0068862_1008295172 141
263 3300009148 Ga0105243_10433554 Ga0105243_104335542 141
264 3300014326 Ga0157380_10030003 Ga0157380_100300034 141
265 3300017792 Ga0163161_10560184 Ga0163161_105601842 141
266 3300025899 Ga0207642_10044762 Ga0207642_100447622 141
267 3300025908 Ga0207643_10003576 Ga0207643_1000357610 141
268 3300025918 Ga0207662_10385174 Ga0207662_103851742 141
269 3300025923 Ga0207681_10108235 Ga0207681_101082353 141
270 3300025925 Ga0207650_10201532 Ga0207650_102015323 141
271 3300025926 Ga0207659_10185790 Ga0207659_101857903 141
272 3300025933 Ga0207706_10251910 Ga0207706_102519102 141
273 3300025937 Ga0207669_10040884 Ga0207669_100408843 141
274 3300025940 Ga0207691_10037020 Ga0207691_100370204 141
275 3300025972 Ga0207668_10189188 Ga0207668_101891883 141
276 3300026075 Ga0207708_10040804 Ga0207708_100408044 141
277 3300026089 Ga0207648_10015790 Ga0207648_100157904 141
278 3300026118 Ga0207675_100751889 Ga0207675_1007518892 141
279 3300026121 Ga0207683_10446874 Ga0207683_104468742 141
280 3300028379 Ga0268266_11695725 Ga0268266_116957251 141
281 3300031548 Ga0307408_101544131 Ga0307408_1015441312 141
282 3300042530 Ga0450916_037151 Ga0450916_037151_206_637 141
283 3300046457 Ga0495590_0096899 Ga0495590_0096899_598_1029 141
284 3300046460 Ga0495638_0028670 Ga0495638_0028670_434_862 141
285 3300046513 Ga0495616_0000837 Ga0495616_0000837_21708_22136 141
286 3300046660 Ga0495625_0004587 Ga0495625_0004587_8920_9351 141
287 3300046660 Ga0495625_0154756 Ga0495625_0154756_398_826 141
288 3300047472 Ga0495686_0094731 Ga0495686_0094731_151_582 141
289 3300047472 Ga0495686_0131234 Ga0495686_0131234_1005_1433 141
290 3300053727 Ga0500611_054260 Ga0500611_054260_297_725 141
291 3300003322 rootL2_10038858 rootL2_100388582 142
292 3300005337 Ga0070682_100283406 Ga0070682_1002834061 142
293 3300005337 Ga0070682_100303366 Ga0070682_1003033662 142
294 3300005337 Ga0070682_100774395 Ga0070682_1007743952 142
295 3300005340 Ga0070689_100238810 Ga0070689_1002388102 142
296 3300005344 Ga0070661_101028916 Ga0070661_1010289162 142
297 3300005354 Ga0070675_100053133 Ga0070675_1000531333 142
298 3300005354 Ga0070675_100719086 Ga0070675_1007190862 142
299 3300005364 Ga0070673_100541450 Ga0070673_1005414502 142
300 3300005365 Ga0070688_100210565 Ga0070688_1002105652 142
301 3300005366 Ga0070659_100438283 Ga0070659_1004382831 142
302 3300005367 Ga0070667_100542803 Ga0070667_1005428032 142
303 3300005437 Ga0070710_10075555 Ga0070710_100755553 142
304 3300005438 Ga0070701_10097515 Ga0070701_100975152 142
305 3300005438 Ga0070701_10300845 Ga0070701_103008452 142
306 3300005441 Ga0070700_100078129 Ga0070700_1000781293 142
307 3300005455 Ga0070663_100177429 Ga0070663_1001774293 142
308 3300005459 Ga0068867_100492911 Ga0068867_1004929112 142
309 3300005459 Ga0068867_100975380 Ga0068867_1009753801 142
310 3300005466 Ga0070685_10159344 Ga0070685_101593442 142
311 3300005539 Ga0068853_101009538 Ga0068853_1010095382 142
312 3300005543 Ga0070672_100002828 Ga0070672_1000028282 142
313 3300005544 Ga0070686_100037255 Ga0070686_1000372554 142
314 3300005544 Ga0070686_100755995 Ga0070686_1007559952 142
315 3300005548 Ga0070665_100003603 Ga0070665_1000036034 142
316 3300005564 Ga0070664_100010472 Ga0070664_1000104729 142
317 3300005564 Ga0070664_101446162 Ga0070664_1014461622 142
318 3300005617 Ga0068859_100459198 Ga0068859_1004591983 142
319 3300005617 Ga0068859_100466303 Ga0068859_1004663032 142
320 3300005719 Ga0068861_100145244 Ga0068861_1001452442 142
321 3300005841 Ga0068863_100216891 Ga0068863_1002168913 142
322 3300005844 Ga0068862_100091248 Ga0068862_1000912482 142
323 3300005844 Ga0068862_100184353 Ga0068862_1001843532 142
324 3300005844 Ga0068862_100407201 Ga0068862_1004072012 142
325 3300006163 Ga0070715_10278664 Ga0070715_102786642 142
326 3300006237 Ga0097621_100404465 Ga0097621_1004044652 142
327 3300006358 Ga0068871_100013573 Ga0068871_1000135734 142
328 3300006881 Ga0068865_100106730 Ga0068865_1001067303 142
329 3300006881 Ga0068865_100833187 Ga0068865_1008331872 142
330 3300006931 Ga0097620_100459183 Ga0097620_1004591833 142
331 3300006931 Ga0097620_100466307 Ga0097620_1004663072 142
332 3300013308 Ga0157375_10004701 Ga0157375_100047012 142
333 3300014325 Ga0163163_11133006 Ga0163163_111330061 142
334 3300014326 Ga0157380_12746274 Ga0157380_127462742 142
335 3300014745 Ga0157377_11541488 Ga0157377_115414881 142
336 3300014969 Ga0157376_10119201 Ga0157376_101192013 142
337 3300014969 Ga0157376_10281678 Ga0157376_102816783 142
338 3300025905 Ga0207685_10077393 Ga0207685_100773933 142
339 3300025926 Ga0207659_10116984 Ga0207659_101169841 142
340 3300025926 Ga0207659_10265534 Ga0207659_102655342 142
341 3300025932 Ga0207690_11071289 Ga0207690_110712892 142
342 3300025938 Ga0207704_10598884 Ga0207704_105988842 142
343 3300025938 Ga0207704_11007501 Ga0207704_110075012 142
344 3300025940 Ga0207691_10005747 Ga0207691_100057473 142
345 3300025940 Ga0207691_10046396 Ga0207691_100463963 142
346 3300025942 Ga0207689_10101624 Ga0207689_101016242 142
347 3300025945 Ga0207679_10550068 Ga0207679_105500682 142
348 3300025945 Ga0207679_11026158 Ga0207679_110261582 142
349 3300025960 Ga0207651_10626801 Ga0207651_106268012 142
350 3300026041 Ga0207639_10116592 Ga0207639_101165923 142
351 3300026067 Ga0207678_10165557 Ga0207678_101655572 142
352 3300026067 Ga0207678_10188453 Ga0207678_101884532 142
353 3300026075 Ga0207708_10086901 Ga0207708_100869013 142
354 3300026075 Ga0207708_10469200 Ga0207708_104692002 142
355 3300026088 Ga0207641_10094874 Ga0207641_100948743 142
356 3300026089 Ga0207648_10703620 Ga0207648_107036202 142
357 3300026089 Ga0207648_10790536 Ga0207648_107905362 142
358 3300026118 Ga0207675_100252335 Ga0207675_1002523352 142
359 3300026118 Ga0207675_100380954 Ga0207675_1003809541 142
360 3300028379 Ga0268266_10004864 Ga0268266_100048643 142
361 3300028379 Ga0268266_11343514 Ga0268266_113435142 142
362 3300028380 Ga0268265_10238042 Ga0268265_102380423 142
363 3300028380 Ga0268265_10624064 Ga0268265_106240642 142
364 3300028381 Ga0268264_10414699 Ga0268264_104146992 142
365 3300028381 Ga0268264_10526578 Ga0268264_105265782 142
366 3300028794 Ga0307515_10272329 Ga0307515_102723292 142
367 3300031456 Ga0307513_10036586 Ga0307513_100365863 142
368 3300031456 Ga0307513_10060565 Ga0307513_100605653 142
369 3300031456 Ga0307513_10197230 Ga0307513_101972303 142
370 3300031507 Ga0307509_10049953 Ga0307509_100499532 142
371 3300031548 Ga0307408_100036171 Ga0307408_1000361713 142
372 3300031548 Ga0307408_100049655 Ga0307408_1000496554 142
373 3300031548 Ga0307408_100354505 Ga0307408_1003545052 142
374 3300031824 Ga0307413_10046651 Ga0307413_100466513 142
375 3300031901 Ga0307406_10010098 Ga0307406_100100983 142
376 3300031901 Ga0307406_10298997 Ga0307406_102989972 142
377 3300031903 Ga0307407_10118587 Ga0307407_101185873 142
378 3300031995 Ga0307409_100061382 Ga0307409_1000613824 142
379 3300032002 Ga0307416_100325315 Ga0307416_1003253153 142
380 3300032005 Ga0307411_10000884 Ga0307411_100008848 142
381 3300032126 Ga0307415_100056983 Ga0307415_1000569832 142
382 3300032126 Ga0307415_100117423 Ga0307415_1001174232 142
383 3300041443 Ga0451789_0848012 Ga0451789_0848012_676_1107 142
384 3300041456 Ga0451795_0828306 Ga0451795_0828306_128_559 142
385 3300041458 Ga0451798_0428982 Ga0451798_0428982_1286_1717 142
386 3300041459 Ga0451800_1138260 Ga0451800_1138260_353_784 142
387 3300041486 Ga0451807_0455525 Ga0451807_0455525_356_787 142
388 3300041486 Ga0451807_1994860 Ga0451807_1994860_76_507 142
389 3300041512 Ga0451853_0417456 Ga0451853_0417456_626_1057 142
390 3300046474 Ga0495605_0309684 Ga0495605_0309684_21_449 142
391 3300046519 Ga0495632_0104477 Ga0495632_0104477_430_858 142
392 3300046694 Ga0495649_0001712 Ga0495649_0001712_3238_3672 142
393 3300046694 Ga0495649_0063551 Ga0495649_0063551_800_1228 142
394 3300048907 Ga0496104_0131415 Ga0496104_0131415_177_614 142
395 3300048917 Ga0496114_0083478 Ga0496114_0083478_740_1177 142

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zqe-assembly1.cif.gz_M plastocyanin bound to psi of chlamydomonas reinhardtii 0.7774 52 119
1z3q-assembly1.cif.gz_A resolution of the structure of the allergenic and antifungal banana fruit thaumatin-like protein at 1.7a 0.7759 68 106
1teg-assembly2.cif.gz_B crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond 0.7743 56 119
2ahn-assembly1.cif.gz_A high resolution structure of a cherry allergen pru av 2 0.774 68 106
1byo-assembly2.cif.gz_B wild-type plastocyanin from silene 0.7707 56 119
ID Description Score Start End Superfamily
af_G5ED60_306_413_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8391 66 95 2.60.200.20
af_A0A1D6NE26_94_204_2.60.110.10 Mainly Beta;Sandwich;Thaumatin;Thaumatin 0.8207 68 106 2.60.110.10
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7095 35 119 2.60.40.420
af_Q9AUW1_29_129_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7061 67 122 2.60.40.420
af_Q19213_18_104_2.60.40.780 Mainly Beta;Sandwich;Immunoglobulin-like;von Hippel-Lindau disease tumour suppressor, 0.7044 68 106 2.60.40.780
ID Description Score Start End GO Terms
AF-A0A534Q553-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9827 9 142
AF-A0A841HT58-F1-model_v4 Plastocyanin 0.9595 1 142
AF-A0A4Y9T3S0-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9577 17 138 GO:0042597
AF-A0A4Q5VC17-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9563 22 138
AF-A0A841HT58-F1-model_v4 Plastocyanin 0.953 1 142

Feature Viewer

pLDDT pTM Quality
90.49 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map