F429735

General Info

Members Datasets Scaffolds Average Seq Length
383 239 374 112

Family's Representative Sequence

Representative Sequence 3300049665|Ga0501227_068272|Ga0501227_068272_145_531
Length 128
Sequence LRYHFVHQSIIEFNRLMDTKDIIAALAALAQESRLSTFRLLVQTGPQGLAASKIAEHLDVAPSSLSFHLKELSHAGLVTSRQEGRFVIYSANFETMNDVLTYLTDNCCGGASCAPVSVTTCRPGKATA

Samples

Sample ID Description Type Environment
1 2643221664 Massilia sp. Root418 Isolate Unclassified
2 2738541280 Massilia sp. GV090 Isolate Unclassified
3 2738541300 Massilia sp. GV016 Isolate Unclassified
4 2738543018 Massilia sp. GV045 Isolate Unclassified
5 2738543030 Massilia sp. GV097 Isolate Unclassified
6 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
7 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
8 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
9 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
10 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
221 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0
Isolates 2.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 2.61
Rhizosphere 86.95
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10001635 3300003320 Bacteria 9063
2 rootL2_10352076 3300003322 Bacteria 2633
3 rootH1_10014821 3300003316 Bacteria 1039
4 rootH1_10014821 3300003323 Bacteria 3268
5 rootH1_10160732 3300003323 Bacteria 6407
6 Ga0055526_1000305 3300003771 Bacteria 41039
7 Ga0055526_1085098 3300003771 Unclassified 608
8 Ga0070683_100047519 3300005329 Bacteria 3966
9 Ga0070680_100362781 3300005336 Bacteria 1232
10 Ga0070682_101311600 3300005337 Bacteria 615
11 Ga0070660_100395537 3300005339 Bacteria 1142
12 Ga0070691_10168000 3300005341 Bacteria 1135
13 Ga0070687_100179499 3300005343 Bacteria 1267
14 Ga0070668_100562303 3300005347 Bacteria 994
15 Ga0070667_100306473 3300005367 Bacteria 1431
16 Ga0070714_100500509 3300005435 Bacteria 1159
17 Ga0070713_101896299 3300005436 Bacteria 578
18 Ga0070701_10265870 3300005438 Bacteria 1041
19 Ga0070681_10144581 3300005458 Bacteria 2308
20 Ga0068867_101305102 3300005459 Bacteria 670
21 Ga0070684_100088075 3300005535 Bacteria 2758
22 Ga0068853_100121743 3300005539 Bacteria 2328
23 Ga0070686_101329587 3300005544 Bacteria 601
24 Ga0070665_100042984 3300005548 Bacteria 4543
25 Ga0070704_100095347 3300005549 Bacteria 2228
26 Ga0068855_100017046 3300005563 Bacteria 8738
27 Ga0070664_100021670 3300005564 Bacteria 5298
28 Ga0068857_100069072 3300005577 Bacteria 3146
29 Ga0068856_102365930 3300005614 Bacteria 539
30 Ga0068859_100031814 3300005617 Bacteria 5300
31 Ga0068859_100133085 3300005617 Bacteria 2559
32 Ga0068859_102066585 3300005617 Bacteria 629
33 Ga0068861_100412051 3300005719 Bacteria 1202
34 Ga0068851_10004481 3300005834 Bacteria 6302
35 Ga0068863_100088550 3300005841 Bacteria 2934
36 Ga0068858_100217532 3300005842 Bacteria 1809
37 Ga0068858_100828336 3300005842 Bacteria 903
38 Ga0068860_100018056 3300005843 Bacteria 6868
39 Ga0068860_100763134 3300005843 Bacteria 979
40 Ga0068860_101813035 3300005843 Bacteria 632
41 Ga0075363_100135976 3300006048 Bacteria 1381
42 Ga0075364_10026619 3300006051 Bacteria 3690
43 Ga0075362_10268714 3300006177 Bacteria 842
44 Ga0075367_10060855 3300006178 Bacteria 2252
45 Ga0075369_10030753 3300006186 Bacteria 2263
46 Ga0075366_10019088 3300006195 Bacteria 3962
47 Ga0097621_100394646 3300006237 Bacteria 1238
48 Ga0075370_10134931 3300006353 Bacteria 1441
49 Ga0075434_101282293 3300006871 Bacteria 744
50 Ga0075436_100071336 3300006914 Bacteria 2402
51 Ga0097620_100031809 3300006931 Bacteria 5300
52 Ga0097620_100133092 3300006931 Bacteria 2559
53 Ga0097620_102066334 3300006931 Bacteria 629
54 Ga0075435_100356210 3300007076 Bacteria 1255
55 Ga0105240_10032843 3300009093 Bacteria 6713
56 Ga0105240_10234037 3300009093 Bacteria 2133
57 Ga0105241_10011804 3300009174 Bacteria 6416
58 Ga0105242_11033501 3300009176 Bacteria 831
59 Ga0105237_10131656 3300009545 Bacteria 2496
60 Ga0105238_10002091 3300009551 Bacteria 20161
61 Ga0105239_10004510 3300010375 Bacteria 16609
62 Ga0105239_10976755 3300010375 Bacteria 973
63 Ga0157369_10214338 3300013105 Bacteria 2017
64 Ga0157372_10226155 3300013307 Bacteria 2169
65 Ga0157375_10364277 3300013308 Bacteria 1612
66 Ga0157376_12025219 3300014969 Bacteria 614
67 Ga0182006_1000882 3300015261 Bacteria 20154
68 Ga0163161_10527321 3300017792 Bacteria 965
69 Ga0213872_10020965 3300021361 Bacteria 3010
70 Ga0213872_10065051 3300021361 Bacteria 1646
71 Ga0213872_10211115 3300021361 Unclassified 829
72 Ga0209565_1002643 3300025263 Bacteria 6308
73 Ga0209564_1006716 3300025295 Bacteria 6114
74 Ga0207656_10092089 3300025321 Bacteria 1377
75 Ga0207654_10024755 3300025911 Bacteria 3231
76 Ga0207695_10002944 3300025913 Bacteria 24567
77 Ga0207695_10365976 3300025913 Bacteria 1328
78 Ga0207695_10719382 3300025913 Bacteria 879
79 Ga0207671_10004876 3300025914 Bacteria 12613
80 Ga0207671_10329506 3300025914 Bacteria 1209
81 Ga0207660_10664922 3300025917 Bacteria 849
82 Ga0207662_10133198 3300025918 Bacteria 1569
83 Ga0207657_10298889 3300025919 Bacteria 1275
84 Ga0207694_10000587 3300025924 Bacteria 32890
85 Ga0207694_10316016 3300025924 Bacteria 1288
86 Ga0207650_10560580 3300025925 Bacteria 958
87 Ga0207709_10829785 3300025935 Bacteria 748
88 Ga0207661_10266665 3300025944 Bacteria 1527
89 Ga0207679_10332460 3300025945 Bacteria 1319
90 Ga0207667_10048668 3300025949 Bacteria 4482
91 Ga0207668_10535991 3300025972 Bacteria 1012
92 Ga0207640_10116870 3300025981 Bacteria 1902
93 Ga0207658_10836323 3300025986 Bacteria 837
94 Ga0207703_10014574 3300026035 Bacteria 6134
95 Ga0207639_10165181 3300026041 Bacteria 1869
96 Ga0207639_10552647 3300026041 Bacteria 1057
97 Ga0207641_10137456 3300026088 Bacteria 2201
98 Ga0207674_10090930 3300026116 Bacteria 3043
99 Ga0207674_10961185 3300026116 Bacteria 823
100 Ga0207675_100931443 3300026118 Bacteria 886
101 Ga0209813_10135879 3300027866 Bacteria 869
102 Ga0268264_10044887 3300028381 Bacteria 3668
103 Ga0268264_10942948 3300028381 Bacteria 868
104 Ga0268264_12149448 3300028381 Bacteria 566
105 Ga0307515_10263676 3300028794 Bacteria 1455
106 Ga0265327_10001699 3300031251 Bacteria 26311
107 Ga0265316_10002392 3300031344 Bacteria 19536
108 Ga0307408_100089386 3300031548 Bacteria 2322
109 Ga0316579_10000081 3300031691 Bacteria 24570
110 Ga0307416_100572015 3300032002 Bacteria 1206
111 Ga0307414_10916890 3300032004 Bacteria 804
112 Ga0316583_10004124 3300032133 Bacteria 5167
113 Ga0316583_10005320 3300032133 Bacteria 4617
114 Ga0316574_0280887 3300035398 Unclassified 1060
115 Ga0316582_0025931 3300036647 Bacteria 3524
116 Ga0373925_0118693 3300037068 Bacteria 2051
117 Ga0395899_0001384 3300037312 Bacteria 20803
118 Ga0395905_0092175 3300037471 Bacteria 2841
119 Ga0436361_0529390 3300039447 Bacteria 14686
120 Ga0436361_0609171 3300039447 Bacteria 3075
121 Ga0436361_0633145 3300039447 Unclassified 1932
122 Ga0436361_0814946 3300039447 Bacteria 9965
123 Ga0451577_0466229 3300042876 Bacteria 1147
124 Ga0466961_0028416 3300044693 Bacteria 3596
125 Ga0451576_0632185 3300045051 Bacteria 1125
126 Ga0495617_002083 3300046452 Bacteria 8285
127 Ga0495617_060478 3300046452 Bacteria 1253
128 Ga0495592_0082332 3300046454 Bacteria 2326
129 Ga0495592_0384845 3300046454 Bacteria 892
130 Ga0495603_0011201 3300046455 Bacteria 5434
131 Ga0495603_0020650 3300046455 Bacteria 3990
132 Ga0495591_050773 3300046458 Bacteria 1134
133 Ga0495629_0002005 3300046459 Bacteria 15820
134 Ga0495629_0014028 3300046459 Bacteria 5774
135 Ga0495629_0015571 3300046459 Bacteria 5459
136 Ga0495638_0016030 3300046460 Bacteria 5022
137 Ga0495638_0316224 3300046460 Bacteria 836
138 Ga0495638_0592725 3300046460 Bacteria 545
139 Ga0495641_0006856 3300046461 Bacteria 7283
140 Ga0495651_0833893 3300046462 Bacteria 567
141 Ga0495653_0012847 3300046463 Bacteria 6836
142 Ga0495653_0014743 3300046463 Bacteria 6374
143 Ga0495653_0216877 3300046463 Bacteria 1289
144 Ga0495650_0002170 3300046471 Bacteria 16595
145 Ga0495650_0004207 3300046471 Bacteria 9970
146 Ga0495580_0000069 3300046472 Bacteria 62719
147 Ga0495580_0000083 3300046472 Bacteria 60283
148 Ga0495580_0011619 3300046472 Bacteria 6811
149 Ga0495580_0352690 3300046472 Bacteria 996
150 Ga0495580_0430951 3300046472 Bacteria 886
151 Ga0495582_0001197 3300046473 Bacteria 14603
152 Ga0495582_0285199 3300046473 Bacteria 948
153 Ga0495582_0745071 3300046473 Bacteria 567
154 Ga0495605_0315761 3300046474 Bacteria 659
155 Ga0495639_0032499 3300046475 Bacteria 2327
156 Ga0495662_0020955 3300046476 Bacteria 3162
157 Ga0495662_0033678 3300046476 Bacteria 2475
158 Ga0495664_0000132 3300046477 Bacteria 37870
159 Ga0495664_0019479 3300046477 Bacteria 3901
160 Ga0495584_0000501 3300046491 Bacteria 26833
161 Ga0495584_0020062 3300046491 Bacteria 3395
162 Ga0495585_0010171 3300046492 Bacteria 5617
163 Ga0495585_0069934 3300046492 Bacteria 1915
164 Ga0495594_0212402 3300046499 Bacteria 1103
165 Ga0495594_0784059 3300046499 Bacteria 537
166 Ga0495596_0090984 3300046500 Bacteria 1184
167 Ga0495607_0016464 3300046501 Bacteria 4770
168 Ga0495607_0055101 3300046501 Bacteria 2288
169 Ga0495607_0063016 3300046501 Bacteria 2099
170 Ga0495607_0218890 3300046501 Bacteria 932
171 Ga0495583_0000185 3300046506 Bacteria 105958
172 Ga0495583_0278702 3300046506 Bacteria 667
173 Ga0495606_0005897 3300046507 Bacteria 11523
174 Ga0495606_0006450 3300046507 Bacteria 10818
175 Ga0495606_0011140 3300046507 Bacteria 7369
176 Ga0495606_0077505 3300046507 Bacteria 2075
177 Ga0495606_0267234 3300046507 Bacteria 941
178 Ga0495608_0149643 3300046511 Bacteria 1488
179 Ga0495610_0008180 3300046512 Bacteria 6817
180 Ga0495610_0056840 3300046512 Bacteria 1880
181 Ga0495610_0080683 3300046512 Bacteria 1495
182 Ga0495610_0329603 3300046512 Bacteria 580
183 Ga0495616_0024404 3300046513 Bacteria 3243
184 Ga0495616_0069790 3300046513 Bacteria 1702
185 Ga0495616_0112541 3300046513 Bacteria 1263
186 Ga0495616_0147716 3300046513 Bacteria 1065
187 Ga0495616_0414805 3300046513 Bacteria 551
188 Ga0495618_0010828 3300046514 Bacteria 5522
189 Ga0495628_0015147 3300046516 Bacteria 6441
190 Ga0495628_0028195 3300046516 Bacteria 4564
191 Ga0495630_0009300 3300046517 Bacteria 7066
192 Ga0495630_0046550 3300046517 Bacteria 3242
193 Ga0495630_0832387 3300046517 Bacteria 704
194 Ga0495644_0000163 3300046523 Bacteria 31558
195 Ga0495644_0000578 3300046523 Bacteria 15353
196 Ga0495644_0216883 3300046523 Bacteria 739
197 Ga0495648_0001891 3300046524 Bacteria 20009
198 Ga0495648_0007830 3300046524 Bacteria 8501
199 Ga0495648_0034626 3300046524 Bacteria 3284
200 Ga0495648_0243472 3300046524 Bacteria 872
201 Ga0495648_0489123 3300046524 Bacteria 530
202 Ga0495666_0008656 3300046526 Bacteria 5096
203 Ga0495666_0462832 3300046526 Bacteria 568
204 Ga0495642_0005477 3300046528 Bacteria 4875
205 Ga0495642_0051166 3300046528 Bacteria 1699
206 Ga0495652_0051494 3300046529 Bacteria 3516
207 Ga0495652_0509069 3300046529 Bacteria 833
208 Ga0495652_0753145 3300046529 Bacteria 652
209 Ga0495654_0014381 3300046530 Bacteria 4211
210 Ga0495654_0075050 3300046530 Bacteria 1596
211 Ga0495654_0146476 3300046530 Bacteria 1048
212 Ga0495665_0000238 3300046531 Bacteria 27643
213 Ga0495665_0011389 3300046531 Bacteria 4813
214 Ga0495665_0130291 3300046531 Bacteria 1316
215 Ga0495665_0559444 3300046531 Bacteria 573
216 Ga0495640_0009755 3300046533 Bacteria 7458
217 Ga0495586_0007344 3300046535 Bacteria 5880
218 Ga0495586_0324583 3300046535 Bacteria 883
219 Ga0495587_0006408 3300046536 Bacteria 7677
220 Ga0495609_0004671 3300046538 Bacteria 7424
221 Ga0495597_0005778 3300046542 Bacteria 6492
222 Ga0495597_0180808 3300046542 Bacteria 852
223 Ga0495645_0000648 3300046543 Bacteria 23976
224 Ga0495645_0011445 3300046543 Bacteria 6243
225 Ga0495633_0002048 3300046558 Bacteria 14532
226 Ga0495633_0019181 3300046558 Bacteria 3459
227 Ga0495633_0027384 3300046558 Bacteria 2787
228 Ga0495667_0344678 3300046559 Bacteria 941
229 Ga0495656_0032052 3300046615 Bacteria 2136
230 Ga0495656_0081083 3300046615 Bacteria 1464
231 Ga0495656_0147533 3300046615 Bacteria 1133
232 Ga0495668_0000101 3300046616 Bacteria 137289
233 Ga0495634_0003652 3300046642 Bacteria 12272
234 Ga0495634_0127625 3300046642 Bacteria 1624
235 Ga0495611_0016040 3300046648 Bacteria 3203
236 Ga0495611_0043722 3300046648 Bacteria 2003
237 Ga0495625_0001069 3300046660 Bacteria 35654
238 Ga0495625_0069820 3300046660 Bacteria 2467
239 Ga0495625_0069876 3300046660 Bacteria 2466
240 Ga0495635_0008465 3300046663 Bacteria 7185
241 Ga0495635_0008984 3300046663 Bacteria 6974
242 Ga0495659_0000074 3300046664 Bacteria 42753
243 Ga0495659_0001563 3300046664 Bacteria 7710
244 Ga0495661_0014180 3300046665 Bacteria 5339
245 Ga0495661_0059878 3300046665 Bacteria 2264
246 Ga0495661_0308741 3300046665 Bacteria 789
247 Ga0495588_0039520 3300046674 Bacteria 2404
248 Ga0495588_0045726 3300046674 Bacteria 2245
249 Ga0495599_0036292 3300046678 Bacteria 3095
250 Ga0495599_0176040 3300046678 Bacteria 1319
251 Ga0495623_0006312 3300046679 Bacteria 7707
252 Ga0495623_0102908 3300046679 Bacteria 1738
253 Ga0495646_0000864 3300046680 Bacteria 17168
254 Ga0495646_0006937 3300046680 Bacteria 7188
255 Ga0495669_0448113 3300046684 Bacteria 627
256 Ga0495669_0659491 3300046684 Bacteria 509
257 Ga0495613_0003379 3300046689 Bacteria 11927
258 Ga0495624_0002390 3300046690 Bacteria 14246
259 Ga0495624_0040753 3300046690 Bacteria 2973
260 Ga0495670_0032000 3300046691 Bacteria 2614
261 Ga0495671_0000493 3300046692 Bacteria 30406
262 Ga0495671_0053823 3300046692 Bacteria 1996
263 Ga0495671_0059139 3300046692 Bacteria 1895
264 Ga0495671_0090946 3300046692 Bacteria 1493
265 Ga0495649_0127768 3300046694 Bacteria 1342
266 Ga0495589_0137901 3300046794 Bacteria 1169
267 Ga0495589_0446071 3300046794 Bacteria 592
268 Ga0495589_0584158 3300046794 Bacteria 509
269 Ga0495660_0002079 3300046810 Bacteria 12978
270 Ga0495581_0010796 3300047315 Bacteria 5283
271 Ga0495581_0145267 3300047315 Bacteria 1384
272 Ga0495604_0015629 3300047317 Bacteria 6060
273 Ga0495604_0017207 3300047317 Bacteria 5784
274 Ga0495636_0000415 3300047318 Bacteria 15830
275 Ga0495674_0032570 3300047319 Bacteria 4727
276 Ga0495674_0053452 3300047319 Bacteria 3550
277 Ga0495674_0313555 3300047319 Bacteria 1279
278 Ga0495674_0340235 3300047319 Bacteria 1219
279 Ga0495672_0000026 3300047320 Bacteria 340319
280 Ga0495672_0041488 3300047320 Bacteria 2782
281 Ga0495672_0070937 3300047320 Bacteria 1972
282 Ga0495672_0106500 3300047320 Bacteria 1511
283 Ga0495676_0021067 3300047321 Bacteria 5705
284 Ga0495676_0801923 3300047321 Bacteria 606
285 Ga0495680_0000740 3300047322 Bacteria 36610
286 Ga0495680_0006326 3300047322 Bacteria 11022
287 Ga0495680_0246056 3300047322 Bacteria 1269
288 Ga0495683_0020554 3300047323 Bacteria 3404
289 Ga0495683_0082429 3300047323 Bacteria 1567
290 Ga0495683_0427799 3300047323 Bacteria 546
291 Ga0495683_0428013 3300047323 Bacteria 546
292 Ga0495687_010285 3300047443 Bacteria 5138
293 Ga0495675_0010485 3300047444 Bacteria 5792
294 Ga0495675_0090267 3300047444 Bacteria 1923
295 Ga0495675_0533082 3300047444 Bacteria 671
296 Ga0495677_0003811 3300047445 Bacteria 5832
297 Ga0495677_0005236 3300047445 Bacteria 4931
298 Ga0495677_0091992 3300047445 Bacteria 1143
299 Ga0495679_002284 3300047446 Bacteria 9891
300 Ga0495679_069983 3300047446 Bacteria 1012
301 Ga0495685_000036 3300047447 Bacteria 55288
302 Ga0495673_0000304 3300047469 Bacteria 65575
303 Ga0495673_0060031 3300047469 Bacteria 1632
304 Ga0495681_0177834 3300047470 Bacteria 876
305 Ga0495684_0016956 3300047471 Bacteria 5612
306 Ga0495686_0001489 3300047472 Bacteria 25384
307 Ga0495686_0025396 3300047472 Bacteria 3884
308 Ga0495686_0105086 3300047472 Bacteria 1699
309 Ga0495593_0000984 3300047673 Bacteria 16724
310 Ga0495593_0007578 3300047673 Bacteria 6339
311 Ga0495593_0052210 3300047673 Bacteria 2161
312 Ga0495602_0010204 3300048088 Bacteria 9747
313 Ga0495602_0027304 3300048088 Bacteria 5487
314 Ga0495614_0005702 3300048089 Bacteria 5612
315 Ga0495614_0660544 3300048089 Bacteria 504
316 Ga0495626_0002059 3300048091 Bacteria 14686
317 Ga0495626_0203486 3300048091 Bacteria 811
318 Ga0496100_0909423 3300048903 Bacteria 691
319 Ga0496101_0385156 3300048904 Bacteria 1103
320 Ga0496102_0569764 3300048905 Bacteria 1055
321 Ga0496104_0304435 3300048907 Bacteria 1506
322 Ga0496106_1320972 3300048909 Bacteria 559
323 Ga0496107_0272631 3300048910 Bacteria 1259
324 Ga0496108_1103521 3300048911 Bacteria 674
325 Ga0496110_0522086 3300048913 Bacteria 1080
326 Ga0496114_0049425 3300048917 Bacteria 3499
327 Ga0496115_0324261 3300048918 Bacteria 1259
328 Ga0496121_0372090 3300048924 Bacteria 945
329 Ga0496123_0336122 3300048926 Bacteria 707
330 Ga0496125_0208817 3300048928 Bacteria 1270
331 Ga0496126_0078414 3300048929 Bacteria 2927
332 Ga0496126_1196154 3300048929 Unclassified 559
333 Ga0495678_001775 3300049459 Bacteria 15966
334 Ga0495678_013722 3300049459 Bacteria 3793
335 Ga0495682_0000206 3300049460 Bacteria 47410
336 Ga0495682_0000271 3300049460 Bacteria 40623
337 Ga0495682_0000923 3300049460 Bacteria 17837
338 Ga0495682_0086321 3300049460 Bacteria 1127
339 Ga0501031_0011456 3300049568 Bacteria 5777
340 Ga0501032_0042141 3300049569 Bacteria 3098
341 Ga0501032_0988539 3300049569 Bacteria 529
342 Ga0501033_0045940 3300049570 Bacteria 3248
343 Ga0501033_0064704 3300049570 Bacteria 2691
344 Ga0501034_0003326 3300049571 Bacteria 18347
345 Ga0501034_0028660 3300049571 Bacteria 5665
346 Ga0501036_0285123 3300049572 Bacteria 1382
347 Ga0501036_0598638 3300049572 Bacteria 914
348 Ga0501037_0869135 3300049573 Bacteria 592
349 Ga0501039_0739416 3300049575 Bacteria 768
350 Ga0501039_1301303 3300049575 Bacteria 561
351 Ga0501043_0210689 3300049579 Bacteria 1506
352 Ga0501047_0244452 3300049581 Bacteria 1644
353 Ga0501207_020494 3300049654 Bacteria 1056
354 Ga0501227_068272 3300049665 Bacteria 920
355 Ga0501079_0785326 3300049741 Bacteria 750
356 Ga0501079_0804588 3300049741 Bacteria 740
357 Ga0501080_0015372 3300049742 Bacteria 7055
358 Ga0501035_0092439 3300049822 Bacteria 2662
359 Ga0501044_0002599 3300049823 Bacteria 20523
360 Ga0501044_0105330 3300049823 Bacteria 2833
361 nmdc:mga03683_166379_c1 3300050489 Bacteria 1001
362 nmdc:mga03n38_12793_c1 3300050490 Bacteria 3169
363 nmdc:mga00v17_56001_c1 3300050491 Bacteria 2410
364 nmdc:mga0yw44_59048_c1 3300050492 Bacteria 2346
365 nmdc:mga0k408_16018_c1 3300050493 Bacteria 4152
366 nmdc:mga06z11_60758_c1 3300050494 Bacteria 1969
367 nmdc:mga04h51_158848_c1 3300050495 Bacteria 869
368 nmdc:mga07m45_81094_c1 3300050496 Bacteria 1853
369 nmdc:mga0n895_132868_c1 3300050512 Bacteria 2514
370 nmdc:mga0rr50_22211_c1 3300050513 Bacteria 4350
371 nmdc:mga08x19_204926_c1 3300050514 Bacteria 1353
372 nmdc:mga0sz30_52015_c1 3300050516 Bacteria 1739
373 Ga0500559_0241324 3300053136 Bacteria 852
374 Ga0500586_008253 3300053145 Bacteria 2828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10032843 Ga0105240_100328434 97
2 3300009545 Ga0105237_10131656 Ga0105237_101316564 97
3 3300025913 Ga0207695_10365976 Ga0207695_103659762 97
4 3300003771 Ga0055526_1000305 Ga0055526_100030523 99
5 3300005341 Ga0070691_10168000 Ga0070691_101680002 99
6 3300006048 Ga0075363_100135976 Ga0075363_1001359763 99
7 3300006051 Ga0075364_10026619 Ga0075364_100266195 99
8 3300006177 Ga0075362_10268714 Ga0075362_102687142 99
9 3300006178 Ga0075367_10060855 Ga0075367_100608554 99
10 3300006186 Ga0075369_10030753 Ga0075369_100307532 99
11 3300006195 Ga0075366_10019088 Ga0075366_100190886 99
12 3300006353 Ga0075370_10134931 Ga0075370_101349312 99
13 3300006871 Ga0075434_101282293 Ga0075434_1012822932 99
14 3300006914 Ga0075436_100071336 Ga0075436_1000713365 99
15 3300007076 Ga0075435_100356210 Ga0075435_1003562103 99
16 3300025914 Ga0207671_10329506 Ga0207671_103295062 99
17 3300027866 Ga0209813_10135879 Ga0209813_101358792 99
18 3300050489 nmdc:mga03683_166379_c1 nmdc:mga03683_166379_c1_234_605 99
19 3300050490 nmdc:mga03n38_12793_c1 nmdc:mga03n38_12793_c1_2391_2762 99
20 3300050491 nmdc:mga00v17_56001_c1 nmdc:mga00v17_56001_c1_1259_1630 99
21 3300050492 nmdc:mga0yw44_59048_c1 nmdc:mga0yw44_59048_c1_1483_1854 99
22 3300050493 nmdc:mga0k408_16018_c1 nmdc:mga0k408_16018_c1_3402_3773 99
23 3300050494 nmdc:mga06z11_60758_c1 nmdc:mga06z11_60758_c1_137_508 99
24 3300050495 nmdc:mga04h51_158848_c1 nmdc:mga04h51_158848_c1_184_555 99
25 3300050496 nmdc:mga07m45_81094_c1 nmdc:mga07m45_81094_c1_1075_1446 99
26 3300050512 nmdc:mga0n895_132868_c1 nmdc:mga0n895_132868_c1_201_530 99
27 3300050513 nmdc:mga0rr50_22211_c1 nmdc:mga0rr50_22211_c1_2314_2643 99
28 3300050514 nmdc:mga08x19_204926_c1 nmdc:mga08x19_204926_c1_546_875 99
29 3300050516 nmdc:mga0sz30_52015_c1 nmdc:mga0sz30_52015_c1_1068_1439 99
30 iso_pu_bacteria 2738541280 2738738574 99
31 iso_pu_bacteria 2738541300 2738842620 99
32 iso_pu_bacteria 2738543018 2739273367 99
33 iso_pu_bacteria 2738543030 2739342411 99
34 3300003322 rootL2_10352076 rootL2_103520764 100
35 3300003323 rootH1_10160732 rootH1_101607327 100
36 3300005329 Ga0070683_100047519 Ga0070683_1000475195 100
37 3300005336 Ga0070680_100362781 Ga0070680_1003627812 100
38 3300005339 Ga0070660_100395537 Ga0070660_1003955372 100
39 3300005343 Ga0070687_100179499 Ga0070687_1001794993 100
40 3300005435 Ga0070714_100500509 Ga0070714_1005005092 100
41 3300005436 Ga0070713_101896299 Ga0070713_1018962992 100
42 3300005438 Ga0070701_10265870 Ga0070701_102658701 100
43 3300005458 Ga0070681_10144581 Ga0070681_101445812 100
44 3300005459 Ga0068867_101305102 Ga0068867_1013051021 100
45 3300005535 Ga0070684_100088075 Ga0070684_1000880754 100
46 3300005539 Ga0068853_100121743 Ga0068853_1001217434 100
47 3300005544 Ga0070686_101329587 Ga0070686_1013295872 100
48 3300005549 Ga0070704_100095347 Ga0070704_1000953473 100
49 3300005614 Ga0068856_102365930 Ga0068856_1023659301 100
50 3300005617 Ga0068859_100133085 Ga0068859_1001330854 100
51 3300005719 Ga0068861_100412051 Ga0068861_1004120512 100
52 3300005842 Ga0068858_100828336 Ga0068858_1008283362 100
53 3300005843 Ga0068860_100763134 Ga0068860_1007631343 100
54 3300006931 Ga0097620_100133092 Ga0097620_1001330923 100
55 3300009174 Ga0105241_10011804 Ga0105241_100118046 100
56 3300009176 Ga0105242_11033501 Ga0105242_110335012 100
57 3300010375 Ga0105239_10976755 Ga0105239_109767552 100
58 3300013307 Ga0157372_10226155 Ga0157372_102261553 100
59 3300025911 Ga0207654_10024755 Ga0207654_100247554 100
60 3300025917 Ga0207660_10664922 Ga0207660_106649222 100
61 3300025918 Ga0207662_10133198 Ga0207662_101331982 100
62 3300025919 Ga0207657_10298889 Ga0207657_102988892 100
63 3300025924 Ga0207694_10316016 Ga0207694_103160161 100
64 3300025935 Ga0207709_10829785 Ga0207709_108297852 100
65 3300025944 Ga0207661_10266665 Ga0207661_102666652 100
66 3300025945 Ga0207679_10332460 Ga0207679_103324602 100
67 3300026041 Ga0207639_10165181 Ga0207639_101651814 100
68 3300026118 Ga0207675_100931443 Ga0207675_1009314432 100
69 3300028381 Ga0268264_10942948 Ga0268264_109429482 100
70 3300032004 Ga0307414_10916890 Ga0307414_109168902 100
71 3300037068 Ga0373925_0118693 Ga0373925_0118693_699_1043 100
72 3300049568 Ga0501031_0011456 Ga0501031_0011456_4480_4812 100
73 3300049569 Ga0501032_0988539 Ga0501032_0988539_104_436 100
74 3300049570 Ga0501033_0064704 Ga0501033_0064704_2039_2371 100
75 3300049571 Ga0501034_0028660 Ga0501034_0028660_930_1262 100
76 3300049572 Ga0501036_0598638 Ga0501036_0598638_496_828 100
77 3300049573 Ga0501037_0869135 Ga0501037_0869135_160_492 100
78 3300049575 Ga0501039_0739416 Ga0501039_0739416_135_467 100
79 3300049579 Ga0501043_0210689 Ga0501043_0210689_207_539 100
80 3300049581 Ga0501047_0244452 Ga0501047_0244452_578_910 100
81 3300049822 Ga0501035_0092439 Ga0501035_0092439_148_480 100
82 3300049823 Ga0501044_0105330 Ga0501044_0105330_1912_2244 100
83 iso_pu_bacteria 2904439833 2904444589 100
84 iso_pu_bacteria 2904601388 2904605117 100
85 iso_pu_bacteria 2919046199 2919049101 100
86 iso_pu_bacteria 2923510766 2923513150 100
87 3300005347 Ga0070668_100562303 Ga0070668_1005623032 101
88 3300005367 Ga0070667_100306473 Ga0070667_1003064731 101
89 3300005548 Ga0070665_100042984 Ga0070665_1000429841 101
90 3300005564 Ga0070664_100021670 Ga0070664_1000216707 101
91 3300005617 Ga0068859_102066585 Ga0068859_1020665852 101
92 3300005843 Ga0068860_101813035 Ga0068860_1018130351 101
93 3300006931 Ga0097620_102066334 Ga0097620_1020663342 101
94 3300025925 Ga0207650_10560580 Ga0207650_105605802 101
95 3300025972 Ga0207668_10535991 Ga0207668_105359912 101
96 3300026041 Ga0207639_10552647 Ga0207639_105526472 101
97 3300026116 Ga0207674_10961185 Ga0207674_109611852 101
98 3300028381 Ga0268264_12149448 Ga0268264_121494482 101
99 3300031691 Ga0316579_10000081 Ga0316579_100000818 101
100 3300032133 Ga0316583_10004124 Ga0316583_100041246 101
101 3300032133 Ga0316583_10005320 Ga0316583_100053203 101
102 3300036647 Ga0316582_0025931 Ga0316582_0025931_1717_2058 101
103 3300042876 Ga0451577_0466229 Ga0451577_0466229_577_1050 101
104 3300049569 Ga0501032_0042141 Ga0501032_0042141_2089_2439 101
105 3300049570 Ga0501033_0045940 Ga0501033_0045940_1997_2347 101
106 3300049571 Ga0501034_0003326 Ga0501034_0003326_11045_11395 101
107 3300049572 Ga0501036_0285123 Ga0501036_0285123_473_823 101
108 3300049575 Ga0501039_1301303 Ga0501039_1301303_155_505 101
109 3300049741 Ga0501079_0785326 Ga0501079_0785326_106_456 101
110 3300049741 Ga0501079_0804588 Ga0501079_0804588_222_575 101
111 3300049742 Ga0501080_0015372 Ga0501080_0015372_1499_1849 101
112 3300049823 Ga0501044_0002599 Ga0501044_0002599_12843_13193 101
113 iso_pu_bacteria 2643221664 2644358990 101
114 3300003323 rootH1_10014821 rootH1_100148215 102
115 3300039447 Ga0436361_0814946 Ga0436361_0814946_5026_5355 102
116 3300046512 Ga0495610_0329603 Ga0495610_0329603_184_501 102
117 3300047323 Ga0495683_0428013 Ga0495683_0428013_112_429 102
118 3300005337 Ga0070682_101311600 Ga0070682_1013116002 103
119 3300021361 Ga0213872_10065051 Ga0213872_100650512 103
120 3300028794 Ga0307515_10263676 Ga0307515_102636762 103
121 3300032002 Ga0307416_100572015 Ga0307416_1005720152 103
122 3300037312 Ga0395899_0001384 Ga0395899_0001384_8843_9175 103
123 3300037471 Ga0395905_0092175 Ga0395905_0092175_1111_1446 103
124 3300039447 Ga0436361_0529390 Ga0436361_0529390_2498_2815 103
125 3300046507 Ga0495606_0005897 Ga0495606_0005897_4340_4663 103
126 3300046507 Ga0495606_0006450 Ga0495606_0006450_7970_8293 103
127 3300046507 Ga0495606_0011140 Ga0495606_0011140_6900_7223 103
128 3300046512 Ga0495610_0008180 Ga0495610_0008180_1834_2157 103
129 3300046512 Ga0495610_0056840 Ga0495610_0056840_1161_1484 103
130 3300046524 Ga0495648_0489123 Ga0495648_0489123_69_392 103
131 3300046530 Ga0495654_0014381 Ga0495654_0014381_1454_1777 103
132 3300046542 Ga0495597_0005778 Ga0495597_0005778_4634_4957 103
133 3300046542 Ga0495597_0180808 Ga0495597_0180808_63_386 103
134 3300046558 Ga0495633_0002048 Ga0495633_0002048_6588_6911 103
135 3300046660 Ga0495625_0001069 Ga0495625_0001069_21043_21366 103
136 3300046664 Ga0495659_0000074 Ga0495659_0000074_23770_24093 103
137 3300046692 Ga0495671_0000493 Ga0495671_0000493_17580_17903 103
138 3300046794 Ga0495589_0584158 Ga0495589_0584158_66_389 103
139 3300047320 Ga0495672_0000026 Ga0495672_0000026_173343_173666 103
140 3300048091 Ga0495626_0002059 Ga0495626_0002059_5901_6356 103
141 3300048926 Ga0496123_0336122 Ga0496123_0336122_318_638 103
142 3300049654 Ga0501207_020494 Ga0501207_020494_493_834 103
143 3300053136 Ga0500559_0241324 Ga0500559_0241324_326_649 103
144 3300053145 Ga0500586_008253 Ga0500586_008253_1658_1981 103
145 3300005563 Ga0068855_100017046 Ga0068855_1000170467 104
146 3300005577 Ga0068857_100069072 Ga0068857_1000690722 104
147 3300005834 Ga0068851_10004481 Ga0068851_100044812 104
148 3300009551 Ga0105238_10002091 Ga0105238_100020913 104
149 3300010375 Ga0105239_10004510 Ga0105239_100045107 104
150 3300015261 Ga0182006_1000882 Ga0182006_100088218 104
151 3300021361 Ga0213872_10020965 Ga0213872_100209651 104
152 3300021361 Ga0213872_10211115 Ga0213872_102111151 104
153 3300025321 Ga0207656_10092089 Ga0207656_100920892 104
154 3300025913 Ga0207695_10002944 Ga0207695_1000294423 104
155 3300025914 Ga0207671_10004876 Ga0207671_1000487614 104
156 3300025924 Ga0207694_10000587 Ga0207694_100005873 104
157 3300025949 Ga0207667_10048668 Ga0207667_100486684 104
158 3300025981 Ga0207640_10116870 Ga0207640_101168702 104
159 3300026116 Ga0207674_10090930 Ga0207674_100909303 104
160 3300031548 Ga0307408_100089386 Ga0307408_1000893863 104
161 3300039447 Ga0436361_0609171 Ga0436361_0609171_247_582 104
162 3300039447 Ga0436361_0633145 Ga0436361_0633145_196_531 104
163 3300048924 Ga0496121_0372090 Ga0496121_0372090_50_385 104
164 iso_pu_bacteria 2904615490 2904615699 104
165 3300003771 Ga0055526_1085098 Ga0055526_10850981 105
166 3300009093 Ga0105240_10234037 Ga0105240_102340373 105
167 3300013105 Ga0157369_10214338 Ga0157369_102143382 105
168 3300014969 Ga0157376_12025219 Ga0157376_120252191 105
169 3300025263 Ga0209565_1002643 Ga0209565_10026434 105
170 3300025295 Ga0209564_1006716 Ga0209564_10067165 105
171 3300025913 Ga0207695_10719382 Ga0207695_107193822 105
172 3300031251 Ga0265327_10001699 Ga0265327_1000169915 105
173 3300031344 Ga0265316_10002392 Ga0265316_1000239210 105
174 3300035398 Ga0316574_0280887 Ga0316574_0280887_165_488 105
175 3300044693 Ga0466961_0028416 Ga0466961_0028416_769_1116 105
176 3300045051 Ga0451576_0632185 Ga0451576_0632185_556_930 105
177 3300046452 Ga0495617_002083 Ga0495617_002083_7518_7841 105
178 3300046452 Ga0495617_060478 Ga0495617_060478_445_768 105
179 3300046454 Ga0495592_0384845 Ga0495592_0384845_379_711 105
180 3300046455 Ga0495603_0020650 Ga0495603_0020650_2037_2369 105
181 3300046458 Ga0495591_050773 Ga0495591_050773_608_940 105
182 3300046459 Ga0495629_0002005 Ga0495629_0002005_469_801 105
183 3300046459 Ga0495629_0015571 Ga0495629_0015571_4242_4574 105
184 3300046460 Ga0495638_0016030 Ga0495638_0016030_1177_1500 105
185 3300046460 Ga0495638_0592725 Ga0495638_0592725_68_391 105
186 3300046463 Ga0495653_0012847 Ga0495653_0012847_6422_6754 105
187 3300046463 Ga0495653_0216877 Ga0495653_0216877_858_1190 105
188 3300046471 Ga0495650_0004207 Ga0495650_0004207_572_904 105
189 3300046472 Ga0495580_0011619 Ga0495580_0011619_6052_6384 105
190 3300046473 Ga0495582_0285199 Ga0495582_0285199_78_410 105
191 3300046473 Ga0495582_0745071 Ga0495582_0745071_223_555 105
192 3300046474 Ga0495605_0315761 Ga0495605_0315761_295_618 105
193 3300046475 Ga0495639_0032499 Ga0495639_0032499_1339_1671 105
194 3300046476 Ga0495662_0020955 Ga0495662_0020955_201_533 105
195 3300046477 Ga0495664_0019479 Ga0495664_0019479_1148_1480 105
196 3300046491 Ga0495584_0000501 Ga0495584_0000501_8235_8558 105
197 3300046491 Ga0495584_0020062 Ga0495584_0020062_1362_1685 105
198 3300046492 Ga0495585_0010171 Ga0495585_0010171_4562_4885 105
199 3300046492 Ga0495585_0069934 Ga0495585_0069934_1230_1553 105
200 3300046499 Ga0495594_0784059 Ga0495594_0784059_191_523 105
201 3300046500 Ga0495596_0090984 Ga0495596_0090984_526_858 105
202 3300046501 Ga0495607_0016464 Ga0495607_0016464_2706_3029 105
203 3300046501 Ga0495607_0055101 Ga0495607_0055101_1145_1468 105
204 3300046501 Ga0495607_0063016 Ga0495607_0063016_38_361 105
205 3300046501 Ga0495607_0218890 Ga0495607_0218890_157_489 105
206 3300046506 Ga0495583_0000185 Ga0495583_0000185_52361_52684 105
207 3300046506 Ga0495583_0278702 Ga0495583_0278702_67_399 105
208 3300046507 Ga0495606_0267234 Ga0495606_0267234_426_758 105
209 3300046511 Ga0495608_0149643 Ga0495608_0149643_763_1095 105
210 3300046512 Ga0495610_0080683 Ga0495610_0080683_84_407 105
211 3300046513 Ga0495616_0024404 Ga0495616_0024404_1795_2118 105
212 3300046513 Ga0495616_0069790 Ga0495616_0069790_1126_1449 105
213 3300046513 Ga0495616_0112541 Ga0495616_0112541_748_1104 105
214 3300046513 Ga0495616_0147716 Ga0495616_0147716_493_816 105
215 3300046513 Ga0495616_0414805 Ga0495616_0414805_137_469 105
216 3300046516 Ga0495628_0028195 Ga0495628_0028195_3113_3445 105
217 3300046517 Ga0495630_0009300 Ga0495630_0009300_2299_2631 105
218 3300046517 Ga0495630_0832387 Ga0495630_0832387_152_484 105
219 3300046523 Ga0495644_0000163 Ga0495644_0000163_23222_23545 105
220 3300046523 Ga0495644_0000578 Ga0495644_0000578_7984_8307 105
221 3300046523 Ga0495644_0216883 Ga0495644_0216883_204_536 105
222 3300046524 Ga0495648_0001891 Ga0495648_0001891_5157_5480 105
223 3300046526 Ga0495666_0462832 Ga0495666_0462832_126_458 105
224 3300046528 Ga0495642_0005477 Ga0495642_0005477_1975_2307 105
225 3300046528 Ga0495642_0051166 Ga0495642_0051166_125_466 105
226 3300046529 Ga0495652_0051494 Ga0495652_0051494_1996_2328 105
227 3300046529 Ga0495652_0753145 Ga0495652_0753145_304_636 105
228 3300046530 Ga0495654_0075050 Ga0495654_0075050_556_888 105
229 3300046531 Ga0495665_0000238 Ga0495665_0000238_23489_23821 105
230 3300046531 Ga0495665_0130291 Ga0495665_0130291_65_397 105
231 3300046531 Ga0495665_0559444 Ga0495665_0559444_156_488 105
232 3300046535 Ga0495586_0324583 Ga0495586_0324583_133_465 105
233 3300046538 Ga0495609_0004671 Ga0495609_0004671_4959_5282 105
234 3300046543 Ga0495645_0000648 Ga0495645_0000648_507_839 105
235 3300046558 Ga0495633_0019181 Ga0495633_0019181_2631_2954 105
236 3300046558 Ga0495633_0027384 Ga0495633_0027384_2164_2487 105
237 3300046559 Ga0495667_0344678 Ga0495667_0344678_160_492 105
238 3300046615 Ga0495656_0032052 Ga0495656_0032052_994_1326 105
239 3300046615 Ga0495656_0081083 Ga0495656_0081083_948_1271 105
240 3300046615 Ga0495656_0147533 Ga0495656_0147533_498_821 105
241 3300046616 Ga0495668_0000101 Ga0495668_0000101_129085_129417 105
242 3300046642 Ga0495634_0127625 Ga0495634_0127625_293_625 105
243 3300046648 Ga0495611_0016040 Ga0495611_0016040_1042_1365 105
244 3300046660 Ga0495625_0069820 Ga0495625_0069820_1856_2179 105
245 3300046660 Ga0495625_0069876 Ga0495625_0069876_1855_2178 105
246 3300046663 Ga0495635_0008984 Ga0495635_0008984_441_773 105
247 3300046664 Ga0495659_0001563 Ga0495659_0001563_5611_5934 105
248 3300046665 Ga0495661_0059878 Ga0495661_0059878_1014_1337 105
249 3300046665 Ga0495661_0308741 Ga0495661_0308741_250_573 105
250 3300046674 Ga0495588_0039520 Ga0495588_0039520_1232_1564 105
251 3300046678 Ga0495599_0176040 Ga0495599_0176040_626_958 105
252 3300046679 Ga0495623_0006312 Ga0495623_0006312_6844_7176 105
253 3300046680 Ga0495646_0000864 Ga0495646_0000864_12611_12943 105
254 3300046690 Ga0495624_0040753 Ga0495624_0040753_234_566 105
255 3300046691 Ga0495670_0032000 Ga0495670_0032000_1813_2136 105
256 3300046692 Ga0495671_0053823 Ga0495671_0053823_289_612 105
257 3300046692 Ga0495671_0059139 Ga0495671_0059139_1237_1560 105
258 3300046692 Ga0495671_0090946 Ga0495671_0090946_882_1205 105
259 3300046794 Ga0495589_0137901 Ga0495589_0137901_418_750 105
260 3300046794 Ga0495589_0446071 Ga0495589_0446071_210_533 105
261 3300046810 Ga0495660_0002079 Ga0495660_0002079_3042_3383 105
262 3300047315 Ga0495581_0145267 Ga0495581_0145267_545_877 105
263 3300047317 Ga0495604_0017207 Ga0495604_0017207_4125_4457 105
264 3300047318 Ga0495636_0000415 Ga0495636_0000415_2981_3304 105
265 3300047319 Ga0495674_0032570 Ga0495674_0032570_1559_1891 105
266 3300047319 Ga0495674_0053452 Ga0495674_0053452_2184_2564 105
267 3300047320 Ga0495672_0041488 Ga0495672_0041488_971_1294 105
268 3300047320 Ga0495672_0070937 Ga0495672_0070937_1372_1695 105
269 3300047320 Ga0495672_0106500 Ga0495672_0106500_561_884 105
270 3300047321 Ga0495676_0801923 Ga0495676_0801923_231_563 105
271 3300047322 Ga0495680_0006326 Ga0495680_0006326_3825_4157 105
272 3300047322 Ga0495680_0246056 Ga0495680_0246056_463_795 105
273 3300047323 Ga0495683_0020554 Ga0495683_0020554_2793_3116 105
274 3300047323 Ga0495683_0427799 Ga0495683_0427799_92_424 105
275 3300047443 Ga0495687_010285 Ga0495687_010285_3409_3732 105
276 3300047444 Ga0495675_0090267 Ga0495675_0090267_398_730 105
277 3300047444 Ga0495675_0533082 Ga0495675_0533082_30_362 105
278 3300047445 Ga0495677_0003811 Ga0495677_0003811_1538_1861 105
279 3300047445 Ga0495677_0005236 Ga0495677_0005236_2723_3046 105
280 3300047445 Ga0495677_0091992 Ga0495677_0091992_653_976 105
281 3300047447 Ga0495685_000036 Ga0495685_000036_5097_5420 105
282 3300047469 Ga0495673_0060031 Ga0495673_0060031_196_519 105
283 3300047470 Ga0495681_0177834 Ga0495681_0177834_91_423 105
284 3300047472 Ga0495686_0001489 Ga0495686_0001489_15612_15944 105
285 3300047472 Ga0495686_0025396 Ga0495686_0025396_2655_2978 105
286 3300047472 Ga0495686_0105086 Ga0495686_0105086_1322_1663 105
287 3300047673 Ga0495593_0007578 Ga0495593_0007578_4553_4885 105
288 3300047673 Ga0495593_0052210 Ga0495593_0052210_1538_1870 105
289 3300048088 Ga0495602_0010204 Ga0495602_0010204_4998_5330 105
290 3300048089 Ga0495614_0660544 Ga0495614_0660544_48_380 105
291 3300048091 Ga0495626_0203486 Ga0495626_0203486_285_641 105
292 3300048903 Ga0496100_0909423 Ga0496100_0909423_227_559 105
293 3300048904 Ga0496101_0385156 Ga0496101_0385156_652_984 105
294 3300048905 Ga0496102_0569764 Ga0496102_0569764_687_1019 105
295 3300048907 Ga0496104_0304435 Ga0496104_0304435_466_798 105
296 3300048909 Ga0496106_1320972 Ga0496106_1320972_166_498 105
297 3300048910 Ga0496107_0272631 Ga0496107_0272631_809_1141 105
298 3300048911 Ga0496108_1103521 Ga0496108_1103521_239_571 105
299 3300048913 Ga0496110_0522086 Ga0496110_0522086_276_608 105
300 3300048917 Ga0496114_0049425 Ga0496114_0049425_1562_1894 105
301 3300048918 Ga0496115_0324261 Ga0496115_0324261_464_796 105
302 3300048928 Ga0496125_0208817 Ga0496125_0208817_916_1248 105
303 3300048929 Ga0496126_0078414 Ga0496126_0078414_521_853 105
304 3300048929 Ga0496126_1196154 Ga0496126_1196154_210_539 105
305 3300049459 Ga0495678_001775 Ga0495678_001775_12195_12518 105
306 3300049459 Ga0495678_013722 Ga0495678_013722_2374_2706 105
307 3300049460 Ga0495682_0000206 Ga0495682_0000206_45095_45418 105
308 3300049460 Ga0495682_0000923 Ga0495682_0000923_10641_10964 105
309 3300049460 Ga0495682_0086321 Ga0495682_0086321_66_389 105
310 3300049665 Ga0501227_068272 Ga0501227_068272_145_531 105
311 3300005617 Ga0068859_100031814 Ga0068859_1000318144 106
312 3300005841 Ga0068863_100088550 Ga0068863_1000885502 106
313 3300005842 Ga0068858_100217532 Ga0068858_1002175322 106
314 3300005843 Ga0068860_100018056 Ga0068860_1000180566 106
315 3300006237 Ga0097621_100394646 Ga0097621_1003946462 106
316 3300006931 Ga0097620_100031809 Ga0097620_1000318094 106
317 3300013308 Ga0157375_10364277 Ga0157375_103642772 106
318 3300017792 Ga0163161_10527321 Ga0163161_105273211 106
319 3300025986 Ga0207658_10836323 Ga0207658_108363232 106
320 3300026035 Ga0207703_10014574 Ga0207703_100145742 106
321 3300026088 Ga0207641_10137456 Ga0207641_101374562 106
322 3300028381 Ga0268264_10044887 Ga0268264_100448874 106
323 3300003320 rootH2_10001635 rootH2_100016359 108
324 3300046454 Ga0495592_0082332 Ga0495592_0082332_1044_1385 108
325 3300046455 Ga0495603_0011201 Ga0495603_0011201_1772_2113 108
326 3300046459 Ga0495629_0014028 Ga0495629_0014028_1829_2170 108
327 3300046460 Ga0495638_0316224 Ga0495638_0316224_51_392 108
328 3300046461 Ga0495641_0006856 Ga0495641_0006856_4067_4408 108
329 3300046462 Ga0495651_0833893 Ga0495651_0833893_123_464 108
330 3300046463 Ga0495653_0014743 Ga0495653_0014743_4884_5225 108
331 3300046471 Ga0495650_0002170 Ga0495650_0002170_7853_8194 108
332 3300046472 Ga0495580_0000069 Ga0495580_0000069_56949_57290 108
333 3300046472 Ga0495580_0000083 Ga0495580_0000083_24437_24778 108
334 3300046472 Ga0495580_0352690 Ga0495580_0352690_106_447 108
335 3300046472 Ga0495580_0430951 Ga0495580_0430951_207_548 108
336 3300046473 Ga0495582_0001197 Ga0495582_0001197_12406_12747 108
337 3300046476 Ga0495662_0033678 Ga0495662_0033678_453_794 108
338 3300046477 Ga0495664_0000132 Ga0495664_0000132_32741_33082 108
339 3300046499 Ga0495594_0212402 Ga0495594_0212402_445_786 108
340 3300046507 Ga0495606_0077505 Ga0495606_0077505_607_948 108
341 3300046514 Ga0495618_0010828 Ga0495618_0010828_1802_2143 108
342 3300046516 Ga0495628_0015147 Ga0495628_0015147_5641_5982 108
343 3300046517 Ga0495630_0046550 Ga0495630_0046550_2184_2525 108
344 3300046524 Ga0495648_0007830 Ga0495648_0007830_434_775 108
345 3300046524 Ga0495648_0034626 Ga0495648_0034626_2792_3133 108
346 3300046524 Ga0495648_0243472 Ga0495648_0243472_237_578 108
347 3300046526 Ga0495666_0008656 Ga0495666_0008656_1151_1492 108
348 3300046529 Ga0495652_0509069 Ga0495652_0509069_332_673 108
349 3300046530 Ga0495654_0146476 Ga0495654_0146476_517_858 108
350 3300046531 Ga0495665_0011389 Ga0495665_0011389_3322_3663 108
351 3300046533 Ga0495640_0009755 Ga0495640_0009755_5429_5770 108
352 3300046535 Ga0495586_0007344 Ga0495586_0007344_4822_5163 108
353 3300046536 Ga0495587_0006408 Ga0495587_0006408_4815_5156 108
354 3300046543 Ga0495645_0011445 Ga0495645_0011445_3380_3721 108
355 3300046642 Ga0495634_0003652 Ga0495634_0003652_8483_8824 108
356 3300046648 Ga0495611_0043722 Ga0495611_0043722_1512_1853 108
357 3300046663 Ga0495635_0008465 Ga0495635_0008465_1970_2311 108
358 3300046665 Ga0495661_0014180 Ga0495661_0014180_182_523 108
359 3300046674 Ga0495588_0045726 Ga0495588_0045726_957_1298 108
360 3300046678 Ga0495599_0036292 Ga0495599_0036292_459_800 108
361 3300046679 Ga0495623_0102908 Ga0495623_0102908_451_792 108
362 3300046680 Ga0495646_0006937 Ga0495646_0006937_1985_2326 108
363 3300046684 Ga0495669_0448113 Ga0495669_0448113_50_391 108
364 3300046684 Ga0495669_0659491 Ga0495669_0659491_45_386 108
365 3300046689 Ga0495613_0003379 Ga0495613_0003379_8480_8821 108
366 3300046690 Ga0495624_0002390 Ga0495624_0002390_8501_8842 108
367 3300046694 Ga0495649_0127768 Ga0495649_0127768_921_1262 108
368 3300047315 Ga0495581_0010796 Ga0495581_0010796_3902_4243 108
369 3300047317 Ga0495604_0015629 Ga0495604_0015629_4950_5291 108
370 3300047319 Ga0495674_0313555 Ga0495674_0313555_880_1221 108
371 3300047319 Ga0495674_0340235 Ga0495674_0340235_718_1059 108
372 3300047321 Ga0495676_0021067 Ga0495676_0021067_3583_3924 108
373 3300047322 Ga0495680_0000740 Ga0495680_0000740_31455_31796 108
374 3300047323 Ga0495683_0082429 Ga0495683_0082429_307_648 108
375 3300047444 Ga0495675_0010485 Ga0495675_0010485_2050_2391 108
376 3300047446 Ga0495679_002284 Ga0495679_002284_4815_5156 108
377 3300047446 Ga0495679_069983 Ga0495679_069983_151_492 108
378 3300047469 Ga0495673_0000304 Ga0495673_0000304_35511_35852 108
379 3300047471 Ga0495684_0016956 Ga0495684_0016956_4316_4657 108
380 3300047673 Ga0495593_0000984 Ga0495593_0000984_10573_10914 108
381 3300048088 Ga0495602_0027304 Ga0495602_0027304_332_673 108
382 3300048089 Ga0495614_0005702 Ga0495614_0005702_460_801 108
383 3300049460 Ga0495682_0000271 Ga0495682_0000271_35493_35834 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

29

81

0.96

PF01022

HTH_5

Bacterial regulatory protein, arsR family

39

80

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9393 18 75
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9377 1 89
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.9256 15 77
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.918 1 89
2oqg-assembly1.cif.gz_D arsr-like transcriptional regulator from rhodococcus sp. rha1 0.9094 4 93
ID Description Score Start End Superfamily
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9646 33 75 3.30.230.130
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9571 15 75 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9566 15 75 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9562 15 74 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9551 18 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7R6ZWG1-F1-model_v4 Transcriptional regulator 0.9857 1 88 GO:0003700
AF-A0A0N1MUW4-F1-model_v4 ArsR family transcriptional regulator 0.9857 1 95 GO:0003700
AF-A0A496WWI5-F1-model_v4 Transcriptional regulator 0.9852 1 87 GO:0003700
AF-A0A2W7IWC3-F1-model_v4 Protein-tyrosine-phosphatase 0.9842 1 94 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A2S6UF84-F1-model_v4 HTH arsR-type domain-containing protein 0.9828 1 93 GO:0003700

Feature Viewer

pLDDT pTM Quality
91.11 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map