F428515

General Info

Members Datasets Scaffolds Average Seq Length
379 216 334 167

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939651529|2939656818
Length 188
Sequence IGSILNVNDLQPEMDIPMSKMHGSVAPKERINIKYVPATGDQQAEVELPLKLLVTGDFLGRSDTSSLEERRPVRIDKDSFNAVLAEAEVGLQMAVPSTLSADSDNDLNVHLHFRSINDFGPDAIARQVPELNKLLQLREALVALKGPMGNVPAFRKHLQSLLSDEATRQRLAQELDLVLDATNTVTDA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
5 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
6 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
7 2643221594 Achromobacter sp. Root170 Isolate Unclassified
8 2643221621 Achromobacter sp. Root83 Isolate Unclassified
9 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
10 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
11 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
12 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
13 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
14 2818991452 Burkholderia cepacia 561 Isolate Unclassified
15 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
16 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
17 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
18 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
19 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
20 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
21 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
22 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
23 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
24 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
25 2928170801 Burkholderia sp. 572 Isolate Unclassified
26 2928963466 Dyella japonica 1073 Isolate Unclassified
27 2932406140 Serratia sp. 2723 Isolate Rhizosphere
28 2939577877 Serratia sp. 509 Isolate Rhizosphere
29 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
30 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
31 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
32 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
33 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
34 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
35 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
36 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
37 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
38 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
41 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
42 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
43 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
58 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
94 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
95 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
108 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
109 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
110 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
122 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
123 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
124 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
132 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
133 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
134 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
135 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
136 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
137 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
143 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
203 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
204 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
205 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
209 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
210 8052494512 Pseudomonas putida LD6 Isolate Unclassified
211 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
212 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
213 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
214 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
215 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
216 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.96
Metatranscriptomes 3.17
Isolates 11.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.82
Nodule 2.37
Rhizoplane 2.11
Rhizosphere 57.52
Stem 0
Stem Tuber 0.26
Unclassified 26.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2363866 2162886007 Bacteria 1584
2 SwRhRL2b_contig_637118 2162886007 Bacteria 11081
3 JGI25159J45721_1000668 3300002987 Bacteria 15163
4 Ga0006770J48903_1030430 3300003305 Bacteria 2128
5 JGI25160J50197_1000034 3300003354 Bacteria 169670
6 JGI25161J50226_1000019 3300003374 Bacteria 169670
7 Ga0007416J51690_1078951 3300003577 Bacteria 690
8 Ga0055532_1000263 3300003758 Bacteria 34467
9 Ga0055527_1000239 3300003760 Bacteria 34467
10 Ga0055535_1000509 3300003761 Bacteria 34467
11 Ga0055542_1005645 3300003762 Bacteria 2790
12 Ga0055529_1002192 3300003763 Bacteria 4037
13 Ga0055536_1000262 3300003781 Bacteria 41063
14 Ga0055536_1046553 3300003781 Bacteria 984
15 Ga0055534_1010850 3300003784 Bacteria 1882
16 Ga0055543_1000018 3300004625 Bacteria 169708
17 Ga0065165_1000973 3300005262 Bacteria 35700
18 Ga0065704_10003258 3300005289 Bacteria 4210
19 Ga0065704_10070378 3300005289 Bacteria 28017
20 Ga0065704_10070623 3300005289 Bacteria 18985
21 Ga0065704_10088162 3300005289 Bacteria 2962
22 Ga0070699_100124960 3300005518 Bacteria 2264
23 Ga0075364_10002483 3300006051 Bacteria 10326
24 Ga0075364_10040248 3300006051 Bacteria 3031
25 Ga0075364_10181784 3300006051 Bacteria 1423
26 Ga0075364_10213058 3300006051 Bacteria 1310
27 Ga0075432_10011127 3300006058 Bacteria 3055
28 Ga0075432_10116407 3300006058 Bacteria 1000
29 Ga0075362_10041080 3300006177 Bacteria 2038
30 Ga0075436_101237614 3300006914 Bacteria 564
31 Ga0099823_1000001 3300006944 Bacteria 216833
32 Ga0099823_1000011 3300006944 Bacteria 96376
33 Ga0079104_1000838 3300006946 Bacteria 25551
34 Ga0105251_10001670 3300009011 Bacteria 18715
35 Ga0105251_10011850 3300009011 Bacteria 4956
36 Ga0105251_10027315 3300009011 Bacteria 2896
37 Ga0105251_10065159 3300009011 Bacteria 1705
38 Ga0105251_10074331 3300009011 Bacteria 1578
39 Ga0105251_10092360 3300009011 Bacteria 1389
40 Ga0105244_10000111 3300009036 Bacteria 85195
41 Ga0105244_10000387 3300009036 Bacteria 40889
42 Ga0105244_10000838 3300009036 Bacteria 26029
43 Ga0105244_10007943 3300009036 Bacteria 6684
44 Ga0105244_10008258 3300009036 Bacteria 6518
45 Ga0105244_10025727 3300009036 Bacteria 3193
46 Ga0105244_10064833 3300009036 Bacteria 1831
47 Ga0105244_10113006 3300009036 Bacteria 1320
48 Ga0105244_10147023 3300009036 Bacteria 1131
49 Ga0105244_10148566 3300009036 Bacteria 1123
50 Ga0105250_10001932 3300009092 Bacteria 10766
51 Ga0105250_10002511 3300009092 Bacteria 9194
52 Ga0105250_10026863 3300009092 Bacteria 2319
53 Ga0105250_10113670 3300009092 Bacteria 1110
54 Ga0111539_12292324 3300009094 Bacteria 626
55 Ga0105243_10003844 3300009148 Bacteria 12001
56 Ga0105243_10011222 3300009148 Bacteria 6777
57 Ga0105246_10076282 3300011119 Bacteria 2375
58 Ga0157373_10066478 3300013100 Bacteria 2551
59 Ga0157371_10001140 3300013102 Bacteria 28616
60 Ga0157370_10034729 3300013104 Bacteria 4906
61 Ga0163162_10048376 3300013306 Bacteria 4260
62 Ga0157372_10014333 3300013307 Bacteria 8476
63 Ga0182006_1000396 3300015261 Bacteria 35562
64 Ga0182006_1027644 3300015261 Bacteria 2313
65 Ga0182007_10027741 3300015262 Bacteria 1950
66 Ga0182005_1028265 3300015265 Bacteria 1529
67 Ga0163161_10861149 3300017792 Bacteria 765
68 Ga0213872_10035000 3300021361 Bacteria 2297
69 Ga0209566_100469 3300025225 Bacteria 29021
70 Ga0209674_101668 3300025226 Bacteria 5527
71 Ga0209672_100026 3300025228 Bacteria 348998
72 Ga0209147_100033 3300025229 Bacteria 348998
73 Ga0209258_100051 3300025242 Bacteria 348998
74 Ga0209148_1000499 3300025254 Bacteria 40017
75 Ga0209455_1000410 3300025272 Bacteria 34602
76 Ga0209130_1000077 3300025284 Bacteria 169722
77 Ga0209675_1002080 3300025291 Bacteria 10638
78 Ga0209676_1000050 3300025292 Bacteria 398350
79 Ga0209676_1000682 3300025292 Bacteria 47999
80 Ga0209676_1004343 3300025292 Bacteria 7947
81 Ga0209050_1005015 3300025298 Bacteria 8599
82 Ga0207426_1000054 3300025302 Bacteria 384435
83 Ga0209051_1009458 3300025303 Bacteria 5020
84 Ga0207696_1000081 3300025711 Bacteria 198887
85 Ga0207696_1000921 3300025711 Bacteria 18169
86 Ga0207696_1002404 3300025711 Bacteria 9194
87 Ga0207696_1002560 3300025711 Bacteria 8851
88 Ga0207696_1007619 3300025711 Bacteria 4222
89 Ga0207696_1024096 3300025711 Bacteria 1911
90 Ga0207655_1000020 3300025728 Bacteria 524503
91 Ga0207655_1000039 3300025728 Bacteria 341249
92 Ga0207655_1000255 3300025728 Bacteria 85204
93 Ga0207655_1002053 3300025728 Bacteria 16936
94 Ga0207655_1004788 3300025728 Bacteria 9434
95 Ga0207655_1005777 3300025728 Bacteria 8336
96 Ga0207655_1030187 3300025728 Bacteria 2525
97 Ga0207655_1032660 3300025728 Bacteria 2374
98 Ga0207655_1049161 3300025728 Bacteria 1724
99 Ga0207655_1127119 3300025728 Bacteria 836
100 Ga0207655_1133472 3300025728 Bacteria 806
101 Ga0207713_1000849 3300025735 Bacteria 28074
102 Ga0207713_1001457 3300025735 Bacteria 18849
103 Ga0207713_1011067 3300025735 Bacteria 4938
104 Ga0207713_1013149 3300025735 Bacteria 4380
105 Ga0207713_1023979 3300025735 Bacteria 2856
106 Ga0207713_1026808 3300025735 Bacteria 2631
107 Ga0207649_10708690 3300025920 Bacteria 781
108 Ga0207709_10073109 3300025935 Bacteria 2183
109 Ga0209281_1001279 3300027111 Bacteria 16162
110 Ga0209281_1001328 3300027111 Bacteria 15566
111 Ga0209389_1000007 3300027296 Bacteria 227459
112 Ga0209389_1000067 3300027296 Bacteria 100075
113 Ga0209371_1001847 3300027312 Bacteria 13050
114 Ga0207428_10297369 3300027907 Bacteria 1195
115 Ga0207428_10394255 3300027907 Bacteria 1014
116 Ga0207428_10394672 3300027907 Bacteria 1014
117 Ga0268256_1001617 3300030500 Bacteria 13050
118 Ga0307513_10061729 3300031456 Bacteria 3966
119 Ga0307408_100000615 3300031548 Bacteria 30385
120 Ga0316575_10038981 3300031665 Unclassified 1875
121 Ga0316579_10043164 3300031691 Bacteria 2097
122 Ga0316576_10000065 3300031727 Bacteria 34719
123 Ga0316576_10027779 3300031727 Bacteria 3979
124 Ga0316576_10086399 3300031727 Bacteria 2333
125 Ga0316576_10663138 3300031727 Bacteria 758
126 Ga0316578_10125315 3300031728 Bacteria 1544
127 Ga0316577_10040823 3300031733 Bacteria 2595
128 Ga0307412_10007153 3300031911 Bacteria 6335
129 Ga0307414_10055178 3300032004 Bacteria 2781
130 Ga0316583_10001029 3300032133 Bacteria 9024
131 Ga0316585_10049799 3300032137 Bacteria 1344
132 Ga0316580_10008539 3300032139 Bacteria 3069
133 Ga0316593_10005804 3300032168 Bacteria 3290
134 Ga0307507_10087079 3300033179 Bacteria 2703
135 Ga0316592_1002385 3300033524 Bacteria 3240
136 Ga0316586_1081983 3300033527 Bacteria 603
137 Ga0316588_1003922 3300033528 Bacteria 2766
138 Ga0316588_1023194 3300033528 Unclassified 1422
139 Ga0316588_1078593 3300033528 Unclassified 815
140 Ga0316588_1090414 3300033528 Unclassified 762
141 Ga0316587_1019411 3300033529 Bacteria 1149
142 Ga0316596_1001848 3300033541 Bacteria 4409
143 Ga0373951_0126419 3300035091 Unclassified 700
144 Ga0373961_0072068 3300035241 Bacteria 1070
145 Ga0316582_0125034 3300036647 Bacteria 1724
146 Ga0316582_0262880 3300036647 Bacteria 1183
147 Ga0316584_0019843 3300036712 Bacteria 4863
148 Ga0400484_37643 3300038725 Bacteria 25962
149 Ga0400484_40498 3300038725 Bacteria 17902
150 Ga0400488_42673 3300038741 Bacteria 6531
151 Ga0400483_141510 3300039062 Bacteria 1026
152 Ga0400483_172652 3300039062 Bacteria 1496
153 Ga0400483_177389 3300039062 Bacteria 31903
154 Ga0400489_59486 3300039093 Bacteria 3484
155 Ga0436365_1530296 3300039437 Bacteria 2377
156 Ga0436361_0175939 3300039447 Bacteria 2804
157 Ga0436363_0368356 3300039450 Unclassified 920
158 Ga0439438_003635 3300041405 Bacteria 6176
159 Ga0451853_2103703 3300041512 Bacteria 1547
160 Ga0439432_002023 3300042006 Bacteria 7675
161 Ga0439432_018788 3300042006 Bacteria 2306
162 Ga0439452_000011 3300042010 Bacteria 428451
163 Ga0439452_012219 3300042010 Bacteria 2449
164 Ga0439456_000212 3300042013 Bacteria 16088
165 Ga0439463_006813 3300042016 Bacteria 2823
166 Ga0450903_006855 3300042138 Bacteria 1885
167 Ga0450905_000056 3300042142 Bacteria 10056
168 Ga0450905_005292 3300042142 Bacteria 1732
169 Ga0450907_012088 3300042146 Bacteria 1435
170 Ga0450901_000268 3300042533 Bacteria 6313
171 Ga0451577_0219619 3300042876 Bacteria 1718
172 Ga0451577_0347795 3300042876 Bacteria 1345
173 Ga0453684_0005634 3300044712 Bacteria 24617
174 Ga0453684_0246756 3300044712 Bacteria 2052
175 Ga0495627_130045 3300046453 Bacteria 708
176 Ga0495592_0238135 3300046454 Bacteria 1209
177 Ga0495590_0000347 3300046457 Bacteria 23924
178 Ga0495591_004080 3300046458 Bacteria 7274
179 Ga0495591_006315 3300046458 Bacteria 5265
180 Ga0495638_0001046 3300046460 Bacteria 27352
181 Ga0495638_0002398 3300046460 Bacteria 15345
182 Ga0495653_0004833 3300046463 Bacteria 10924
183 Ga0495605_0002058 3300046474 Bacteria 12687
184 Ga0495605_0180043 3300046474 Bacteria 930
185 Ga0495664_0064484 3300046477 Bacteria 2183
186 Ga0495585_0005854 3300046492 Bacteria 7708
187 Ga0495596_0042541 3300046500 Bacteria 1790
188 Ga0495607_0003538 3300046501 Bacteria 11896
189 Ga0495607_0063776 3300046501 Bacteria 2083
190 Ga0495606_0002126 3300046507 Bacteria 23955
191 Ga0495606_0004687 3300046507 Bacteria 13513
192 Ga0495610_0001528 3300046512 Bacteria 20385
193 Ga0495620_0000104 3300046515 Bacteria 67620
194 Ga0495620_0000807 3300046515 Bacteria 19267
195 Ga0495620_0025265 3300046515 Bacteria 2813
196 Ga0495628_0064095 3300046516 Bacteria 2878
197 Ga0495631_0042597 3300046518 Bacteria 2006
198 Ga0495632_0000213 3300046519 Bacteria 58845
199 Ga0495632_0000861 3300046519 Bacteria 26713
200 Ga0495632_0001181 3300046519 Bacteria 22228
201 Ga0495632_0228247 3300046519 Bacteria 840
202 Ga0495637_0000520 3300046520 Bacteria 27986
203 Ga0495637_0000664 3300046520 Bacteria 23957
204 Ga0495643_0001157 3300046522 Bacteria 25855
205 Ga0495643_0005071 3300046522 Bacteria 9012
206 Ga0495648_0000178 3300046524 Bacteria 73793
207 Ga0495648_0001759 3300046524 Bacteria 20912
208 Ga0495648_0039538 3300046524 Bacteria 3001
209 Ga0495654_0000720 3300046530 Bacteria 25881
210 Ga0495654_0002013 3300046530 Bacteria 13376
211 Ga0495654_0002067 3300046530 Bacteria 13175
212 Ga0495654_0005863 3300046530 Bacteria 7065
213 Ga0495609_0000499 3300046538 Bacteria 31481
214 Ga0495597_0000905 3300046542 Bacteria 23015
215 Ga0495597_0001292 3300046542 Bacteria 18433
216 Ga0495597_0010473 3300046542 Bacteria 4530
217 Ga0495633_0109869 3300046558 Bacteria 1278
218 Ga0495625_0580542 3300046660 Bacteria 675
219 Ga0495661_0000528 3300046665 Bacteria 39498
220 Ga0495661_0001923 3300046665 Bacteria 16526
221 Ga0495671_0017662 3300046692 Bacteria 3795
222 Ga0495671_0022159 3300046692 Bacteria 3331
223 Ga0495649_0000399 3300046694 Bacteria 37612
224 Ga0495649_0000530 3300046694 Bacteria 32394
225 Ga0495649_0001780 3300046694 Bacteria 15888
226 Ga0495649_0004423 3300046694 Bacteria 9184
227 Ga0495660_0000966 3300046810 Bacteria 21003
228 Ga0495660_0002324 3300046810 Bacteria 12186
229 Ga0495674_0074696 3300047319 Bacteria 2918
230 Ga0495672_0044731 3300047320 Bacteria 2654
231 Ga0495683_0062022 3300047323 Bacteria 1851
232 Ga0495675_0249186 3300047444 Bacteria 1067
233 Ga0495679_006114 3300047446 Bacteria 5243
234 Ga0495673_0002845 3300047469 Bacteria 11778
235 Ga0495681_0085601 3300047470 Bacteria 1400
236 Ga0495684_0050561 3300047471 Bacteria 3173
237 Ga0495686_0004484 3300047472 Bacteria 11480
238 Ga0495686_0217858 3300047472 Bacteria 1087
239 Ga0495602_0143547 3300048088 Bacteria 1887
240 Ga0495626_0000871 3300048091 Bacteria 26834
241 Ga0495626_0001700 3300048091 Bacteria 16903
242 Ga0496104_0000153 3300048907 Bacteria 63666
243 Ga0496105_0000383 3300048908 Bacteria 29032
244 Ga0496110_0009812 3300048913 Bacteria 7755
245 Ga0496114_0003610 3300048917 Bacteria 11891
246 Ga0496116_0002018 3300048919 Bacteria 21788
247 Ga0496116_0002407 3300048919 Bacteria 19710
248 Ga0496116_0012691 3300048919 Bacteria 6855
249 Ga0496116_0074823 3300048919 Bacteria 2128
250 Ga0496116_0089012 3300048919 Bacteria 1884
251 Ga0496116_0453289 3300048919 Bacteria 548
252 Ga0496117_0000133 3300048920 Bacteria 161454
253 Ga0496117_0001039 3300048920 Bacteria 42336
254 Ga0496117_0001487 3300048920 Bacteria 33597
255 Ga0496117_0007465 3300048920 Bacteria 10669
256 Ga0496117_0055017 3300048920 Bacteria 2783
257 Ga0496117_0223058 3300048920 Bacteria 1047
258 Ga0496118_0002404 3300048921 Bacteria 25276
259 Ga0496118_0003735 3300048921 Bacteria 18839
260 Ga0496118_0006193 3300048921 Bacteria 13258
261 Ga0496118_0008427 3300048921 Bacteria 10658
262 Ga0496118_0021646 3300048921 Bacteria 5651
263 Ga0496118_0239953 3300048921 Bacteria 1038
264 Ga0496119_0003155 3300048922 Bacteria 17320
265 Ga0496119_0021182 3300048922 Bacteria 4709
266 Ga0496119_0036433 3300048922 Bacteria 3211
267 Ga0496119_0077441 3300048922 Bacteria 1926
268 Ga0496119_0191923 3300048922 Bacteria 1063
269 Ga0496120_0007616 3300048923 Bacteria 8027
270 Ga0496120_0016501 3300048923 Bacteria 4826
271 Ga0496120_0078553 3300048923 Bacteria 1793
272 Ga0496120_0134426 3300048923 Bacteria 1263
273 Ga0496121_0002003 3300048924 Bacteria 32349
274 Ga0496121_0003168 3300048924 Bacteria 23718
275 Ga0496121_0004507 3300048924 Bacteria 18659
276 Ga0496121_0012013 3300048924 Bacteria 9518
277 Ga0496121_0014941 3300048924 Bacteria 8178
278 Ga0496121_0051498 3300048924 Bacteria 3467
279 Ga0496121_0100104 3300048924 Bacteria 2238
280 Ga0496121_0228321 3300048924 Bacteria 1305
281 Ga0496122_0000010 3300048925 Bacteria 547417
282 Ga0496122_0000016 3300048925 Bacteria 443353
283 Ga0496122_0000350 3300048925 Bacteria 99606
284 Ga0496122_0003761 3300048925 Bacteria 19564
285 Ga0496122_0004827 3300048925 Bacteria 16432
286 Ga0496122_0074057 3300048925 Bacteria 2411
287 Ga0496122_0198863 3300048925 Bacteria 1174
288 Ga0496122_0251976 3300048925 Bacteria 986
289 Ga0496123_0000017 3300048926 Bacteria 415261
290 Ga0496123_0000061 3300048926 Bacteria 220856
291 Ga0496123_0000644 3300048926 Bacteria 58184
292 Ga0496123_0003818 3300048926 Bacteria 16443
293 Ga0496123_0004984 3300048926 Bacteria 13605
294 Ga0496123_0024904 3300048926 Bacteria 4529
295 Ga0496123_0094193 3300048926 Bacteria 1766
296 Ga0496123_0130188 3300048926 Bacteria 1396
297 Ga0496123_0366157 3300048926 Bacteria 666
298 Ga0496124_0000795 3300048927 Bacteria 51427
299 Ga0496124_0001704 3300048927 Bacteria 31059
300 Ga0496124_0003219 3300048927 Bacteria 20170
301 Ga0496124_0003462 3300048927 Bacteria 19287
302 Ga0496124_0005382 3300048927 Bacteria 14450
303 Ga0496124_0035876 3300048927 Bacteria 4333
304 Ga0496124_0077162 3300048927 Bacteria 2748
305 Ga0496124_0128177 3300048927 Bacteria 2019
306 Ga0496125_0000236 3300048928 Bacteria 113354
307 Ga0496125_0001543 3300048928 Bacteria 32956
308 Ga0496125_0003329 3300048928 Bacteria 19625
309 Ga0496125_0012274 3300048928 Bacteria 8518
310 Ga0496125_0012812 3300048928 Bacteria 8289
311 Ga0496125_0032515 3300048928 Bacteria 4633
312 Ga0496125_0213113 3300048928 Bacteria 1252
313 Ga0496126_0000818 3300048929 Bacteria 55553
314 Ga0496126_0019100 3300048929 Bacteria 6760
315 Ga0496126_0034698 3300048929 Bacteria 4735
316 Ga0496126_0054232 3300048929 Bacteria 3632
317 Ga0496126_0082747 3300048929 Bacteria 2835
318 Ga0496126_0147324 3300048929 Bacteria 2020
319 Ga0495682_0000541 3300049460 Bacteria 26120
320 Ga0501034_0232297 3300049571 Bacteria 1793
321 Ga0501043_0014444 3300049579 Bacteria 6180
322 nmdc:mga03683_14775_c1 3300050489 Bacteria 2897
323 nmdc:mga00v17_121908_c1 3300050491 Bacteria 1661
324 nmdc:mga00v17_213741_c1 3300050491 Bacteria 1248
325 nmdc:mga00v17_5839_c1 3300050491 Bacteria 6500
326 nmdc:mga00v17_95019_c1 3300050491 Bacteria 1876
327 nmdc:mga09592_695831_c1 3300050508 Bacteria 865
328 nmdc:mga08y16_1628184_c1 3300050511 Bacteria 603
329 Ga0500618_000801 3300053125 Bacteria 17358
330 Ga0500621_004157 3300053126 Bacteria 4244
331 Ga0500659_0000827 3300053135 Bacteria 19769
332 Ga0590075_049252 3300059424 Bacteria 1080
333 Ga0590077_065298 3300059426 Bacteria 827
334 Ga0587111_0130411 3300060346 Bacteria 657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 646564506 646813939 156
2 iso_pu_bacteria 2852387548 2852393297 157
3 iso_pu_bacteria 8057575449 8057579444 157
4 3300033527 Ga0316586_1081983 Ga0316586_10819831 158
5 3300035241 Ga0373961_0072068 Ga0373961_0072068_211_705 158
6 iso_pu_bacteria 2565956521 2566035899 159
7 iso_pu_bacteria 2757320392 2757572612 159
8 iso_pu_bacteria 2919155634 2919159495 159
9 iso_pu_bacteria 3007803356 3007803470 159
10 iso_pu_bacteria 3007803356 3007806500 159
11 iso_pu_bacteria 3007872151 3007873838 159
12 iso_pu_bacteria 8021120328 8021122454 159
13 iso_pu_bacteria 8052494512 8052497844 159
14 iso_pu_bacteria 8056115690 8056118128 159
15 3300009094 Ga0111539_12292324 Ga0111539_122923241 160
16 3300021361 Ga0213872_10035000 Ga0213872_100350002 160
17 3300031665 Ga0316575_10038981 Ga0316575_100389812 160
18 3300032139 Ga0316580_10008539 Ga0316580_100085392 160
19 3300039447 Ga0436361_0175939 Ga0436361_0175939_1643_2137 160
20 3300039450 Ga0436363_0368356 Ga0436363_0368356_39_521 160
21 3300042876 Ga0451577_0219619 Ga0451577_0219619_1062_1547 160
22 3300050508 nmdc:mga09592_695831_c1 nmdc:mga09592_695831_c1_132_638 160
23 3300050511 nmdc:mga08y16_1628184_c1 nmdc:mga08y16_1628184_c1_65_571 160
24 iso_pu_bacteria 2599185292 2599907206 160
25 iso_pu_bacteria 2600255318 2601799143 160
26 iso_pu_bacteria 2603880185 2606078042 160
27 iso_pu_bacteria 2603880199 2606129777 160
28 iso_pu_bacteria 2643221594 2643980517 160
29 iso_pu_bacteria 2643221621 2644124771 160
30 iso_pu_bacteria 2713897149 2715756711 160
31 iso_pu_bacteria 2738543004 2739198739 160
32 iso_pu_bacteria 2808606395 2809032166 160
33 iso_pu_bacteria 2814123068 2814694516 160
34 iso_pu_bacteria 2818991452 2819636744 160
35 iso_pu_bacteria 2842832357 2842834960 160
36 iso_pu_bacteria 2878029506 2878032624 160
37 iso_pu_bacteria 2928170801 2928178573 160
38 iso_pu_bacteria 2928963466 2928967967 160
39 iso_pu_bacteria 2947233263 2947237017 160
40 iso_pu_bacteria 2998139840 2998143158 160
41 iso_pu_bacteria 3007419365 3007421779 160
42 iso_pu_bacteria 8056143049 8056146653 160
43 iso_pu_bacteria 8056148874 8056153964 160
44 3300002987 JGI25159J45721_1000668 JGI25159J45721_10006688 161
45 3300003305 Ga0006770J48903_1030430 Ga0006770J48903_10304301 161
46 3300003354 JGI25160J50197_1000034 JGI25160J50197_1000034161 161
47 3300003374 JGI25161J50226_1000019 JGI25161J50226_100001916 161
48 3300003577 Ga0007416J51690_1078951 Ga0007416J51690_10789511 161
49 3300004625 Ga0055543_1000018 Ga0055543_1000018161 161
50 3300005262 Ga0065165_1000973 Ga0065165_100097316 161
51 3300005518 Ga0070699_100124960 Ga0070699_1001249602 161
52 3300025284 Ga0209130_1000077 Ga0209130_1000077155 161
53 3300025302 Ga0207426_1000054 Ga0207426_1000054155 161
54 3300031691 Ga0316579_10043164 Ga0316579_100431641 161
55 3300031727 Ga0316576_10027779 Ga0316576_100277792 161
56 3300031727 Ga0316576_10086399 Ga0316576_100863992 161
57 3300031728 Ga0316578_10125315 Ga0316578_101253152 161
58 3300032133 Ga0316583_10001029 Ga0316583_100010296 161
59 3300032137 Ga0316585_10049799 Ga0316585_100497991 161
60 3300032168 Ga0316593_10005804 Ga0316593_100058042 161
61 3300033524 Ga0316592_1002385 Ga0316592_10023852 161
62 3300033528 Ga0316588_1003922 Ga0316588_10039222 161
63 3300033528 Ga0316588_1023194 Ga0316588_10231942 161
64 3300033528 Ga0316588_1078593 Ga0316588_10785932 161
65 3300033529 Ga0316587_1019411 Ga0316587_10194111 161
66 3300033541 Ga0316596_1001848 Ga0316596_10018482 161
67 3300036647 Ga0316582_0262880 Ga0316582_0262880_597_1085 161
68 3300036712 Ga0316584_0019843 Ga0316584_0019843_2429_2917 161
69 3300038725 Ga0400484_37643 Ga0400484_37643_15013_15510 161
70 3300038725 Ga0400484_40498 Ga0400484_40498_10666_11163 161
71 3300038741 Ga0400488_42673 Ga0400488_42673_546_1043 161
72 3300039062 Ga0400483_172652 Ga0400483_172652_820_1317 161
73 3300041512 Ga0451853_2103703 Ga0451853_2103703_760_1248 161
74 3300044712 Ga0453684_0005634 Ga0453684_0005634_22987_23472 161
75 3300044712 Ga0453684_0246756 Ga0453684_0246756_839_1324 161
76 3300048924 Ga0496121_0051498 Ga0496121_0051498_2211_2723 161
77 3300060346 Ga0587111_0130411 Ga0587111_0130411_42_548 161
78 iso_pu_bacteria 2846540461 2846542613 161
79 iso_pu_bacteria 2932406140 2932409812 161
80 iso_pu_bacteria 2939577877 2939578930 161
81 iso_pu_bacteria 8055693939 8055697254 161
82 iso_pu_bacteria 8057304971 8057309232 161
83 3300031456 Ga0307513_10061729 Ga0307513_100617292 162
84 3300033179 Ga0307507_10087079 Ga0307507_100870792 162
85 3300035091 Ga0373951_0126419 Ga0373951_0126419_20_514 162
86 3300042876 Ga0451577_0347795 Ga0451577_0347795_163_654 162
87 3300059424 Ga0590075_049252 Ga0590075_049252_377_874 162
88 3300059426 Ga0590077_065298 Ga0590077_065298_137_634 162
89 iso_pu_bacteria 2852103415 2852105013 162
90 iso_pu_bacteria 2854601825 2854602080 162
91 iso_pu_bacteria 2919493220 2919494665 162
92 iso_pu_bacteria 2919543075 2919544158 162
93 iso_pu_bacteria 2923525760 2923528093 162
94 iso_pu_bacteria 2939642701 2939645385 162
95 iso_pu_bacteria 3000376612 3000378825 162
96 2162886007 SwRhRL2b_contig_637118 SwRhRL2b_0495.00005700 163
97 3300005289 Ga0065704_10070623 Ga0065704_1007062310 163
98 3300006914 Ga0075436_101237614 Ga0075436_1012376141 163
99 3300006944 Ga0099823_1000001 Ga0099823_1000001201 163
100 3300006944 Ga0099823_1000011 Ga0099823_100001193 163
101 3300009011 Ga0105251_10065159 Ga0105251_100651591 163
102 3300009011 Ga0105251_10074331 Ga0105251_100743312 163
103 3300009011 Ga0105251_10092360 Ga0105251_100923602 163
104 3300009036 Ga0105244_10007943 Ga0105244_100079432 163
105 3300009036 Ga0105244_10025727 Ga0105244_100257271 163
106 3300009036 Ga0105244_10064833 Ga0105244_100648333 163
107 3300009036 Ga0105244_10113006 Ga0105244_101130062 163
108 3300009092 Ga0105250_10002511 Ga0105250_100025114 163
109 3300009092 Ga0105250_10113670 Ga0105250_101136701 163
110 3300009148 Ga0105243_10003844 Ga0105243_100038448 163
111 3300009148 Ga0105243_10011222 Ga0105243_100112224 163
112 3300013104 Ga0157370_10034729 Ga0157370_100347293 163
113 3300013307 Ga0157372_10014333 Ga0157372_100143335 163
114 3300025225 Ga0209566_100469 Ga0209566_10046925 163
115 3300025226 Ga0209674_101668 Ga0209674_1016682 163
116 3300025292 Ga0209676_1000682 Ga0209676_10006826 163
117 3300025711 Ga0207696_1000081 Ga0207696_100008148 163
118 3300025711 Ga0207696_1002404 Ga0207696_10024045 163
119 3300025711 Ga0207696_1002560 Ga0207696_10025608 163
120 3300025728 Ga0207655_1000039 Ga0207655_1000039211 163
121 3300025728 Ga0207655_1005777 Ga0207655_10057776 163
122 3300025728 Ga0207655_1049161 Ga0207655_10491611 163
123 3300025728 Ga0207655_1133472 Ga0207655_11334722 163
124 3300025735 Ga0207713_1001457 Ga0207713_10014579 163
125 3300025735 Ga0207713_1011067 Ga0207713_10110671 163
126 3300025735 Ga0207713_1013149 Ga0207713_10131494 163
127 3300025920 Ga0207649_10708690 Ga0207649_107086901 163
128 3300025935 Ga0207709_10073109 Ga0207709_100731092 163
129 3300027296 Ga0209389_1000007 Ga0209389_1000007210 163
130 3300027296 Ga0209389_1000067 Ga0209389_100006788 163
131 3300031727 Ga0316576_10663138 Ga0316576_106631381 163
132 3300039062 Ga0400483_141510 Ga0400483_141510_91_597 163
133 3300039062 Ga0400483_177389 Ga0400483_177389_13271_13777 163
134 3300039093 Ga0400489_59486 Ga0400489_59486_325_843 163
135 3300042006 Ga0439432_002023 Ga0439432_002023_5001_5504 163
136 3300042142 Ga0450905_000056 Ga0450905_000056_9008_9511 163
137 3300042142 Ga0450905_005292 Ga0450905_005292_236_739 163
138 3300042533 Ga0450901_000268 Ga0450901_000268_265_768 163
139 3300046454 Ga0495592_0238135 Ga0495592_0238135_594_1127 163
140 3300046463 Ga0495653_0004833 Ga0495653_0004833_2390_2887 163
141 3300046477 Ga0495664_0064484 Ga0495664_0064484_1523_2056 163
142 3300046492 Ga0495585_0005854 Ga0495585_0005854_915_1412 163
143 3300046500 Ga0495596_0042541 Ga0495596_0042541_567_1070 163
144 3300046515 Ga0495620_0000104 Ga0495620_0000104_16632_17135 163
145 3300046516 Ga0495628_0064095 Ga0495628_0064095_901_1434 163
146 3300046519 Ga0495632_0000213 Ga0495632_0000213_44857_45360 163
147 3300046522 Ga0495643_0001157 Ga0495643_0001157_17059_17562 163
148 3300046524 Ga0495648_0000178 Ga0495648_0000178_56659_57162 163
149 3300046665 Ga0495661_0000528 Ga0495661_0000528_22317_22814 163
150 3300046694 Ga0495649_0000530 Ga0495649_0000530_9251_9754 163
151 3300047319 Ga0495674_0074696 Ga0495674_0074696_714_1247 163
152 3300047444 Ga0495675_0249186 Ga0495675_0249186_55_588 163
153 3300047471 Ga0495684_0050561 Ga0495684_0050561_1457_1990 163
154 3300048088 Ga0495602_0143547 Ga0495602_0143547_657_1190 163
155 3300048913 Ga0496110_0009812 Ga0496110_0009812_2367_2870 163
156 3300048917 Ga0496114_0003610 Ga0496114_0003610_7716_8219 163
157 3300048919 Ga0496116_0012691 Ga0496116_0012691_3384_3887 163
158 3300048920 Ga0496117_0001039 Ga0496117_0001039_9156_9659 163
159 3300048920 Ga0496117_0001487 Ga0496117_0001487_18700_19203 163
160 3300048921 Ga0496118_0002404 Ga0496118_0002404_7843_8346 163
161 3300048924 Ga0496121_0100104 Ga0496121_0100104_211_714 163
162 3300048925 Ga0496122_0003761 Ga0496122_0003761_11990_12493 163
163 3300048925 Ga0496122_0004827 Ga0496122_0004827_3651_4154 163
164 3300048925 Ga0496122_0198863 Ga0496122_0198863_549_1052 163
165 3300048926 Ga0496123_0003818 Ga0496123_0003818_3651_4154 163
166 3300048926 Ga0496123_0094193 Ga0496123_0094193_35_538 163
167 3300048926 Ga0496123_0130188 Ga0496123_0130188_356_859 163
168 3300048927 Ga0496124_0003219 Ga0496124_0003219_6126_6629 163
169 3300048927 Ga0496124_0003462 Ga0496124_0003462_14573_15076 163
170 3300048927 Ga0496124_0005382 Ga0496124_0005382_3039_3542 163
171 3300048928 Ga0496125_0000236 Ga0496125_0000236_37796_38299 163
172 3300048928 Ga0496125_0001543 Ga0496125_0001543_24673_25176 163
173 3300048928 Ga0496125_0012274 Ga0496125_0012274_7085_7588 163
174 3300048929 Ga0496126_0019100 Ga0496126_0019100_6200_6703 163
175 3300049571 Ga0501034_0232297 Ga0501034_0232297_621_1115 163
176 3300053125 Ga0500618_000801 Ga0500618_000801_7626_8129 163
177 3300053135 Ga0500659_0000827 Ga0500659_0000827_6744_7247 163
178 3300003758 Ga0055532_1000263 Ga0055532_100026313 164
179 3300003760 Ga0055527_1000239 Ga0055527_100023913 164
180 3300003761 Ga0055535_1000509 Ga0055535_100050913 164
181 3300003762 Ga0055542_1005645 Ga0055542_10056452 164
182 3300003763 Ga0055529_1002192 Ga0055529_10021922 164
183 3300003781 Ga0055536_1000262 Ga0055536_100026211 164
184 3300003781 Ga0055536_1046553 Ga0055536_10465532 164
185 3300003784 Ga0055534_1010850 Ga0055534_10108501 164
186 3300005289 Ga0065704_10088162 Ga0065704_100881622 164
187 3300006051 Ga0075364_10040248 Ga0075364_100402484 164
188 3300006051 Ga0075364_10213058 Ga0075364_102130582 164
189 3300006058 Ga0075432_10011127 Ga0075432_100111272 164
190 3300006058 Ga0075432_10116407 Ga0075432_101164072 164
191 3300006177 Ga0075362_10041080 Ga0075362_100410802 164
192 3300009011 Ga0105251_10011850 Ga0105251_100118504 164
193 3300009036 Ga0105244_10000387 Ga0105244_1000038718 164
194 3300009036 Ga0105244_10008258 Ga0105244_100082585 164
195 3300009036 Ga0105244_10147023 Ga0105244_101470232 164
196 3300009036 Ga0105244_10148566 Ga0105244_101485662 164
197 3300009092 Ga0105250_10026863 Ga0105250_100268632 164
198 3300013100 Ga0157373_10066478 Ga0157373_100664782 164
199 3300013306 Ga0163162_10048376 Ga0163162_100483764 164
200 3300015261 Ga0182006_1000396 Ga0182006_100039610 164
201 3300015261 Ga0182006_1027644 Ga0182006_10276442 164
202 3300015262 Ga0182007_10027741 Ga0182007_100277412 164
203 3300015265 Ga0182005_1028265 Ga0182005_10282652 164
204 3300025228 Ga0209672_100026 Ga0209672_100026317 164
205 3300025229 Ga0209147_100033 Ga0209147_100033317 164
206 3300025242 Ga0209258_100051 Ga0209258_100051317 164
207 3300025254 Ga0209148_1000499 Ga0209148_100049916 164
208 3300025272 Ga0209455_1000410 Ga0209455_100041013 164
209 3300025291 Ga0209675_1002080 Ga0209675_10020803 164
210 3300025292 Ga0209676_1000050 Ga0209676_1000050149 164
211 3300025292 Ga0209676_1004343 Ga0209676_10043432 164
212 3300025298 Ga0209050_1005015 Ga0209050_10050154 164
213 3300025303 Ga0209051_1009458 Ga0209051_10094585 164
214 3300025711 Ga0207696_1024096 Ga0207696_10240962 164
215 3300025728 Ga0207655_1004788 Ga0207655_10047888 164
216 3300025728 Ga0207655_1030187 Ga0207655_10301873 164
217 3300025728 Ga0207655_1032660 Ga0207655_10326603 164
218 3300025728 Ga0207655_1127119 Ga0207655_11271191 164
219 3300025735 Ga0207713_1026808 Ga0207713_10268082 164
220 3300027111 Ga0209281_1001279 Ga0209281_10012798 164
221 3300027907 Ga0207428_10297369 Ga0207428_102973692 164
222 3300027907 Ga0207428_10394255 Ga0207428_103942552 164
223 3300027907 Ga0207428_10394672 Ga0207428_103946722 164
224 3300031548 Ga0307408_100000615 Ga0307408_10000061520 164
225 3300031727 Ga0316576_10000065 Ga0316576_1000006523 164
226 3300031911 Ga0307412_10007153 Ga0307412_100071534 164
227 3300032004 Ga0307414_10055178 Ga0307414_100551783 164
228 3300033528 Ga0316588_1090414 Ga0316588_10904141 164
229 3300039437 Ga0436365_1530296 Ga0436365_1530296_170_676 164
230 3300042010 Ga0439452_012219 Ga0439452_012219_1124_1627 164
231 3300042013 Ga0439456_000212 Ga0439456_000212_6155_6670 164
232 3300042016 Ga0439463_006813 Ga0439463_006813_858_1379 164
233 3300042138 Ga0450903_006855 Ga0450903_006855_1095_1616 164
234 3300042146 Ga0450907_012088 Ga0450907_012088_33_536 164
235 3300046453 Ga0495627_130045 Ga0495627_130045_31_552 164
236 3300046457 Ga0495590_0000347 Ga0495590_0000347_11235_11738 164
237 3300046458 Ga0495591_004080 Ga0495591_004080_3037_3540 164
238 3300046460 Ga0495638_0002398 Ga0495638_0002398_37_540 164
239 3300046474 Ga0495605_0002058 Ga0495605_0002058_2700_3203 164
240 3300046474 Ga0495605_0180043 Ga0495605_0180043_386_889 164
241 3300046501 Ga0495607_0003538 Ga0495607_0003538_2766_3269 164
242 3300046501 Ga0495607_0063776 Ga0495607_0063776_1367_1870 164
243 3300046507 Ga0495606_0002126 Ga0495606_0002126_12187_12690 164
244 3300046507 Ga0495606_0004687 Ga0495606_0004687_10198_10701 164
245 3300046512 Ga0495610_0001528 Ga0495610_0001528_16700_17221 164
246 3300046515 Ga0495620_0000807 Ga0495620_0000807_359_862 164
247 3300046518 Ga0495631_0042597 Ga0495631_0042597_141_644 164
248 3300046519 Ga0495632_0000861 Ga0495632_0000861_7909_8430 164
249 3300046519 Ga0495632_0001181 Ga0495632_0001181_2884_3387 164
250 3300046520 Ga0495637_0000520 Ga0495637_0000520_18870_19373 164
251 3300046520 Ga0495637_0000664 Ga0495637_0000664_11268_11771 164
252 3300046522 Ga0495643_0005071 Ga0495643_0005071_5414_5917 164
253 3300046524 Ga0495648_0001759 Ga0495648_0001759_12994_13497 164
254 3300046524 Ga0495648_0039538 Ga0495648_0039538_1325_1828 164
255 3300046530 Ga0495654_0000720 Ga0495654_0000720_13191_13694 164
256 3300046530 Ga0495654_0002013 Ga0495654_0002013_9491_9994 164
257 3300046530 Ga0495654_0002067 Ga0495654_0002067_10766_11269 164
258 3300046530 Ga0495654_0005863 Ga0495654_0005863_3235_3738 164
259 3300046538 Ga0495609_0000499 Ga0495609_0000499_11077_11580 164
260 3300046542 Ga0495597_0001292 Ga0495597_0001292_12187_12690 164
261 3300046542 Ga0495597_0010473 Ga0495597_0010473_2831_3334 164
262 3300046558 Ga0495633_0109869 Ga0495633_0109869_35_544 164
263 3300046660 Ga0495625_0580542 Ga0495625_0580542_108_611 164
264 3300046665 Ga0495661_0001923 Ga0495661_0001923_7827_8348 164
265 3300046692 Ga0495671_0017662 Ga0495671_0017662_1318_1821 164
266 3300046692 Ga0495671_0022159 Ga0495671_0022159_2072_2575 164
267 3300046694 Ga0495649_0001780 Ga0495649_0001780_2892_3395 164
268 3300046810 Ga0495660_0000966 Ga0495660_0000966_9846_10349 164
269 3300046810 Ga0495660_0002324 Ga0495660_0002324_1609_2112 164
270 3300047320 Ga0495672_0044731 Ga0495672_0044731_1509_2012 164
271 3300047323 Ga0495683_0062022 Ga0495683_0062022_355_858 164
272 3300047469 Ga0495673_0002845 Ga0495673_0002845_9032_9535 164
273 3300047470 Ga0495681_0085601 Ga0495681_0085601_191_694 164
274 3300047472 Ga0495686_0004484 Ga0495686_0004484_9874_10377 164
275 3300047472 Ga0495686_0217858 Ga0495686_0217858_565_1068 164
276 3300048091 Ga0495626_0000871 Ga0495626_0000871_7462_7965 164
277 3300048091 Ga0495626_0001700 Ga0495626_0001700_15864_16367 164
278 3300048919 Ga0496116_0002407 Ga0496116_0002407_18000_18509 164
279 3300048919 Ga0496116_0074823 Ga0496116_0074823_64_573 164
280 3300048920 Ga0496117_0000133 Ga0496117_0000133_108017_108520 164
281 3300048921 Ga0496118_0006193 Ga0496118_0006193_9968_10471 164
282 3300048922 Ga0496119_0021182 Ga0496119_0021182_1196_1708 164
283 3300048923 Ga0496120_0007616 Ga0496120_0007616_5016_5528 164
284 3300048923 Ga0496120_0134426 Ga0496120_0134426_723_1226 164
285 3300048924 Ga0496121_0002003 Ga0496121_0002003_1478_1975 164
286 3300048924 Ga0496121_0012013 Ga0496121_0012013_5554_6075 164
287 3300048925 Ga0496122_0000350 Ga0496122_0000350_61980_62489 164
288 3300048925 Ga0496122_0074057 Ga0496122_0074057_516_1019 164
289 3300048926 Ga0496123_0000644 Ga0496123_0000644_37471_37980 164
290 3300048926 Ga0496123_0024904 Ga0496123_0024904_548_1051 164
291 3300048926 Ga0496123_0366157 Ga0496123_0366157_118_639 164
292 3300048927 Ga0496124_0001704 Ga0496124_0001704_746_1258 164
293 3300048927 Ga0496124_0035876 Ga0496124_0035876_1541_2050 164
294 3300048928 Ga0496125_0012812 Ga0496125_0012812_1492_2001 164
295 3300048929 Ga0496126_0034698 Ga0496126_0034698_3160_3663 164
296 3300048929 Ga0496126_0082747 Ga0496126_0082747_1246_1758 164
297 3300048929 Ga0496126_0147324 Ga0496126_0147324_638_1147 164
298 3300049460 Ga0495682_0000541 Ga0495682_0000541_9982_10485 164
299 3300049579 Ga0501043_0014444 Ga0501043_0014444_5501_6016 164
300 3300050489 nmdc:mga03683_14775_c1 nmdc:mga03683_14775_c1_495_998 164
301 3300050491 nmdc:mga00v17_121908_c1 nmdc:mga00v17_121908_c1_438_941 164
302 3300050491 nmdc:mga00v17_213741_c1 nmdc:mga00v17_213741_c1_23_571 164
303 3300050491 nmdc:mga00v17_95019_c1 nmdc:mga00v17_95019_c1_936_1439 164
304 3300053126 Ga0500621_004157 Ga0500621_004157_784_1287 164
305 iso_pu_bacteria 2939651529 2939656818 164
306 2162886007 SwRhRL2b_contig_2363866 SwRhRL2b_0637.00010230 165
307 3300005289 Ga0065704_10003258 Ga0065704_100032581 165
308 3300005289 Ga0065704_10070378 Ga0065704_1007037821 165
309 3300006051 Ga0075364_10002483 Ga0075364_100024838 165
310 3300006051 Ga0075364_10181784 Ga0075364_101817841 165
311 3300006946 Ga0079104_1000838 Ga0079104_10008388 165
312 3300009011 Ga0105251_10001670 Ga0105251_100016701 165
313 3300009011 Ga0105251_10027315 Ga0105251_100273152 165
314 3300009036 Ga0105244_10000111 Ga0105244_1000011163 165
315 3300009036 Ga0105244_10000838 Ga0105244_1000083815 165
316 3300009092 Ga0105250_10001932 Ga0105250_100019326 165
317 3300011119 Ga0105246_10076282 Ga0105246_100762823 165
318 3300013102 Ga0157371_10001140 Ga0157371_1000114020 165
319 3300017792 Ga0163161_10861149 Ga0163161_108611491 165
320 3300025711 Ga0207696_1000921 Ga0207696_100092113 165
321 3300025711 Ga0207696_1007619 Ga0207696_10076194 165
322 3300025728 Ga0207655_1000020 Ga0207655_1000020101 165
323 3300025728 Ga0207655_1000255 Ga0207655_100025562 165
324 3300025728 Ga0207655_1002053 Ga0207655_10020532 165
325 3300025735 Ga0207713_1000849 Ga0207713_10008493 165
326 3300025735 Ga0207713_1023979 Ga0207713_10239792 165
327 3300027111 Ga0209281_1001328 Ga0209281_10013281 165
328 3300027312 Ga0209371_1001847 Ga0209371_100184710 165
329 3300030500 Ga0268256_1001617 Ga0268256_10016173 165
330 3300031733 Ga0316577_10040823 Ga0316577_100408233 165
331 3300036647 Ga0316582_0125034 Ga0316582_0125034_948_1463 165
332 3300041405 Ga0439438_003635 Ga0439438_003635_554_1066 165
333 3300042006 Ga0439432_018788 Ga0439432_018788_751_1248 165
334 3300042010 Ga0439452_000011 Ga0439452_000011_99574_100086 165
335 3300046458 Ga0495591_006315 Ga0495591_006315_4641_5138 165
336 3300046460 Ga0495638_0001046 Ga0495638_0001046_7063_7560 165
337 3300046515 Ga0495620_0025265 Ga0495620_0025265_942_1439 165
338 3300046519 Ga0495632_0228247 Ga0495632_0228247_298_795 165
339 3300046542 Ga0495597_0000905 Ga0495597_0000905_10144_10644 165
340 3300046694 Ga0495649_0000399 Ga0495649_0000399_2669_3166 165
341 3300046694 Ga0495649_0004423 Ga0495649_0004423_6017_6514 165
342 3300047446 Ga0495679_006114 Ga0495679_006114_3175_3672 165
343 3300048907 Ga0496104_0000153 Ga0496104_0000153_22409_22933 165
344 3300048908 Ga0496105_0000383 Ga0496105_0000383_26753_27277 165
345 3300048919 Ga0496116_0002018 Ga0496116_0002018_878_1396 165
346 3300048919 Ga0496116_0089012 Ga0496116_0089012_1040_1540 165
347 3300048919 Ga0496116_0453289 Ga0496116_0453289_22_522 165
348 3300048920 Ga0496117_0007465 Ga0496117_0007465_2128_2628 165
349 3300048920 Ga0496117_0055017 Ga0496117_0055017_381_905 165
350 3300048920 Ga0496117_0223058 Ga0496117_0223058_415_933 165
351 3300048921 Ga0496118_0003735 Ga0496118_0003735_387_905 165
352 3300048921 Ga0496118_0008427 Ga0496118_0008427_4112_4612 165
353 3300048921 Ga0496118_0021646 Ga0496118_0021646_672_1172 165
354 3300048921 Ga0496118_0239953 Ga0496118_0239953_415_933 165
355 3300048922 Ga0496119_0003155 Ga0496119_0003155_271_789 165
356 3300048922 Ga0496119_0036433 Ga0496119_0036433_1357_1854 165
357 3300048922 Ga0496119_0077441 Ga0496119_0077441_1244_1744 165
358 3300048922 Ga0496119_0191923 Ga0496119_0191923_430_948 165
359 3300048923 Ga0496120_0016501 Ga0496120_0016501_1357_1854 165
360 3300048923 Ga0496120_0078553 Ga0496120_0078553_571_1071 165
361 3300048924 Ga0496121_0003168 Ga0496121_0003168_19226_19726 165
362 3300048924 Ga0496121_0004507 Ga0496121_0004507_3991_4491 165
363 3300048924 Ga0496121_0014941 Ga0496121_0014941_265_789 165
364 3300048924 Ga0496121_0228321 Ga0496121_0228321_68_568 165
365 3300048925 Ga0496122_0000010 Ga0496122_0000010_28478_28975 165
366 3300048925 Ga0496122_0000016 Ga0496122_0000016_224707_225207 165
367 3300048925 Ga0496122_0251976 Ga0496122_0251976_198_722 165
368 3300048926 Ga0496123_0000017 Ga0496123_0000017_264271_264771 165
369 3300048926 Ga0496123_0000061 Ga0496123_0000061_187703_188200 165
370 3300048926 Ga0496123_0004984 Ga0496123_0004984_12850_13374 165
371 3300048927 Ga0496124_0000795 Ga0496124_0000795_19286_19783 165
372 3300048927 Ga0496124_0077162 Ga0496124_0077162_711_1229 165
373 3300048927 Ga0496124_0128177 Ga0496124_0128177_924_1421 165
374 3300048928 Ga0496125_0003329 Ga0496125_0003329_1345_1842 165
375 3300048928 Ga0496125_0032515 Ga0496125_0032515_271_789 165
376 3300048928 Ga0496125_0213113 Ga0496125_0213113_164_664 165
377 3300048929 Ga0496126_0000818 Ga0496126_0000818_31249_31773 165
378 3300048929 Ga0496126_0054232 Ga0496126_0054232_936_1436 165
379 3300050491 nmdc:mga00v17_5839_c1 nmdc:mga00v17_5839_c1_3754_4254 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05591

T6SS_VipA

Type VI secretion system, VipA, VC_A0107 or Hcp2

23

176

0.98

Feature Viewer

pLDDT pTM Quality
72.48 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map