F428315

General Info

Members Datasets Scaffolds Average Seq Length
379 171 379 191

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100404151|Ga0068871_1004041512
Length 227
Sequence LADWRISKFFQINSLEICKLPFNSSIRQSANAQIIVRMLKKIVVIGPESTGKSTLCEELAQHYDALWCPEFAREYLLTFGMQYDFDDLLTIAKGQLAMEDEYAVKAEKEWNDQKIKRTAAPVLFIDTNMYVMKVWCEFVFGKCHSFIIDQIVDRYYDGYLLCNTDLPWEKDELREYPNEEIRQQLYLMYKDIMVNQSVPWCNITGNNEHRLKIAIEGVDAFLTNIAQ

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 0.53
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10018804 3300003203 Bacteria 2832
2 rootH2_10110262 3300003320 Bacteria 1321
3 JGI25160J50197_1003216 3300003354 Bacteria 7386
4 Ga0065714_10157218 3300005288 Bacteria 1071
5 Ga0065712_10004488 3300005290 Bacteria 5394
6 Ga0065712_10070979 3300005290 Bacteria 5550
7 Ga0065712_10121021 3300005290 Bacteria 1607
8 Ga0065712_10272430 3300005290 Unclassified 912
9 Ga0065715_10007870 3300005293 Bacteria 2864
10 Ga0065707_10215855 3300005295 Bacteria 1245
11 Ga0070658_10000512 3300005327 Bacteria 33597
12 Ga0070676_10009543 3300005328 Bacteria 5241
13 Ga0070676_10099384 3300005328 Unclassified 1795
14 Ga0070683_100014441 3300005329 Bacteria 6908
15 Ga0070683_100159946 3300005329 Bacteria 2137
16 Ga0070670_100002539 3300005331 Bacteria 15056
17 Ga0070670_100282156 3300005331 Bacteria 1450
18 Ga0070670_100289649 3300005331 Unclassified 1431
19 Ga0070677_10328477 3300005333 Bacteria 786
20 Ga0068869_100083455 3300005334 Bacteria 2390
21 Ga0068869_100137664 3300005334 Bacteria 1883
22 Ga0068869_101233150 3300005334 Unclassified 658
23 Ga0070666_10000322 3300005335 Bacteria 30612
24 Ga0068868_100000119 3300005338 Bacteria 49590
25 Ga0068868_100360620 3300005338 Bacteria 1247
26 Ga0070689_100079597 3300005340 Bacteria 2571
27 Ga0070689_100101671 3300005340 Bacteria 2275
28 Ga0070689_100137698 3300005340 Bacteria 1961
29 Ga0070687_100129579 3300005343 Bacteria 1455
30 Ga0070687_100167413 3300005343 Bacteria 1305
31 Ga0070661_100009078 3300005344 Bacteria 6878
32 Ga0070661_100057467 3300005344 Bacteria 2851
33 Ga0070661_100389339 3300005344 Unclassified 1100
34 Ga0070668_100000645 3300005347 Bacteria 23563
35 Ga0070669_100074259 3300005353 Bacteria 2521
36 Ga0070669_100176302 3300005353 Bacteria 1670
37 Ga0070669_100294039 3300005353 Bacteria 1305
38 Ga0070675_100079421 3300005354 Bacteria 2734
39 Ga0070675_100359005 3300005354 Unclassified 1293
40 Ga0070674_100361612 3300005356 Bacteria 1175
41 Ga0070673_100000331 3300005364 Bacteria 24760
42 Ga0070673_100112495 3300005364 Bacteria 2260
43 Ga0070673_100136828 3300005364 Bacteria 2063
44 Ga0070673_100291745 3300005364 Bacteria 1433
45 Ga0070673_100592447 3300005364 Bacteria 1010
46 Ga0070673_101075254 3300005364 Bacteria 751
47 Ga0070688_100006355 3300005365 Bacteria 6314
48 Ga0070688_100016465 3300005365 Bacteria 4227
49 Ga0070688_100030589 3300005365 Bacteria 3232
50 Ga0070688_100202974 3300005365 Unclassified 1388
51 Ga0070667_100000706 3300005367 Bacteria 32167
52 Ga0070667_100050060 3300005367 Bacteria 3520
53 Ga0070667_100089707 3300005367 Unclassified 2641
54 Ga0070667_100109535 3300005367 Bacteria 2393
55 Ga0070705_100845231 3300005440 Bacteria 732
56 Ga0070700_101063560 3300005441 Bacteria 669
57 Ga0070663_100262638 3300005455 Unclassified 1370
58 Ga0070678_100652346 3300005456 Unclassified 944
59 Ga0070662_100000209 3300005457 Bacteria 34168
60 Ga0070662_100002256 3300005457 Bacteria 11826
61 Ga0068867_100008666 3300005459 Bacteria 7182
62 Ga0068867_100016317 3300005459 Bacteria 5274
63 Ga0068867_100198198 3300005459 Bacteria 1606
64 Ga0068867_100241553 3300005459 Unclassified 1465
65 Ga0068867_100389079 3300005459 Unclassified 1173
66 Ga0068867_100495936 3300005459 Bacteria 1049
67 Ga0070685_10015847 3300005466 Bacteria 4008
68 Ga0070685_10023183 3300005466 Bacteria 3396
69 Ga0070685_10033855 3300005466 Bacteria 2874
70 Ga0070685_10489097 3300005466 Bacteria 869
71 Ga0070707_100490665 3300005468 Bacteria 1190
72 Ga0070698_100008587 3300005471 Bacteria 11019
73 Ga0070698_100066902 3300005471 Bacteria 3615
74 Ga0070699_100523406 3300005518 Unclassified 1078
75 Ga0070684_100042107 3300005535 Bacteria 3941
76 Ga0068853_100001904 3300005539 Bacteria 15372
77 Ga0068853_100030463 3300005539 Unclassified 4557
78 Ga0070672_100000183 3300005543 Bacteria 34362
79 Ga0070672_100127535 3300005543 Bacteria 2088
80 Ga0070672_100175978 3300005543 Bacteria 1781
81 Ga0070672_100708272 3300005543 Bacteria 882
82 Ga0070665_100001045 3300005548 Bacteria 34668
83 Ga0070664_100010227 3300005564 Bacteria 7609
84 Ga0070664_100721714 3300005564 Unclassified 929
85 Ga0068857_100657443 3300005577 Unclassified 993
86 Ga0068857_100765852 3300005577 Bacteria 920
87 Ga0068854_100386614 3300005578 Bacteria 1154
88 Ga0068854_100393206 3300005578 Unclassified 1145
89 Ga0068854_100582045 3300005578 Unclassified 953
90 Ga0068854_101173524 3300005578 Unclassified 687
91 Ga0068852_100237503 3300005616 Bacteria 1740
92 Ga0068859_100077792 3300005617 Bacteria 3358
93 Ga0068859_100108088 3300005617 Bacteria 2843
94 Ga0068859_100117612 3300005617 Bacteria 2723
95 Ga0068859_100297810 3300005617 Bacteria 1706
96 Ga0068859_100403064 3300005617 Bacteria 1464
97 Ga0068859_100528009 3300005617 Bacteria 1275
98 Ga0068859_101090571 3300005617 Bacteria 878
99 Ga0068859_101976944 3300005617 Bacteria 644
100 Ga0068864_100003700 3300005618 Bacteria 12632
101 Ga0068864_100082434 3300005618 Bacteria 2822
102 Ga0068864_100647606 3300005618 Bacteria 1029
103 Ga0068864_101355257 3300005618 Bacteria 713
104 Ga0068866_10177853 3300005718 Unclassified 1254
105 Ga0068861_100029152 3300005719 Bacteria 4035
106 Ga0068861_100310036 3300005719 Bacteria 1370
107 Ga0068861_100603228 3300005719 Bacteria 1008
108 Ga0068861_100627873 3300005719 Bacteria 989
109 Ga0068861_101146211 3300005719 Unclassified 749
110 Ga0068870_10326283 3300005840 Unclassified 977
111 Ga0068863_100003358 3300005841 Bacteria 15805
112 Ga0068863_100011520 3300005841 Bacteria 8554
113 Ga0068863_100275059 3300005841 Bacteria 1631
114 Ga0068863_100364360 3300005841 Bacteria 1409
115 Ga0068863_100473995 3300005841 Unclassified 1230
116 Ga0068863_101181199 3300005841 Bacteria 771
117 Ga0068863_101466175 3300005841 Bacteria 691
118 Ga0068858_100001328 3300005842 Bacteria 25539
119 Ga0068858_100506275 3300005842 Bacteria 1167
120 Ga0068860_100001860 3300005843 Bacteria 22460
121 Ga0068860_100004501 3300005843 Bacteria 14216
122 Ga0068860_100023864 3300005843 Bacteria 5912
123 Ga0068860_101746611 3300005843 Bacteria 644
124 Ga0068862_100057136 3300005844 Bacteria 3345
125 Ga0068862_100915424 3300005844 Bacteria 863
126 Ga0081539_10000042 3300005985 Bacteria 289955
127 Ga0081539_10017620 3300005985 Bacteria 5003
128 Ga0070715_10057834 3300006163 Bacteria 1691
129 Ga0075366_10004442 3300006195 Bacteria 7526
130 Ga0097621_100089273 3300006237 Bacteria 2577
131 Ga0097621_100090964 3300006237 Bacteria 2554
132 Ga0097621_100123596 3300006237 Unclassified 2197
133 Ga0097621_100317239 3300006237 Bacteria 1380
134 Ga0097621_100712375 3300006237 Bacteria 925
135 Ga0097621_100936205 3300006237 Bacteria 808
136 Ga0075370_10095646 3300006353 Bacteria 1716
137 Ga0068871_100004865 3300006358 Bacteria 9385
138 Ga0068871_100016186 3300006358 Bacteria 5607
139 Ga0068871_100404151 3300006358 Bacteria 1217
140 Ga0068871_100667710 3300006358 Unclassified 950
141 Ga0075428_100161523 3300006844 Bacteria 2432
142 Ga0075428_100343966 3300006844 Unclassified 1601
143 Ga0068865_100376274 3300006881 Bacteria 1157
144 Ga0097620_100077793 3300006931 Bacteria 3358
145 Ga0097620_100108085 3300006931 Bacteria 2843
146 Ga0097620_100117605 3300006931 Bacteria 2723
147 Ga0097620_100297801 3300006931 Bacteria 1706
148 Ga0097620_100403021 3300006931 Bacteria 1464
149 Ga0097620_100528066 3300006931 Bacteria 1275
150 Ga0097620_101090422 3300006931 Bacteria 878
151 Ga0097620_101976860 3300006931 Bacteria 644
152 Ga0105240_10001169 3300009093 Bacteria 46003
153 Ga0105240_10292085 3300009093 Bacteria 1868
154 Ga0105240_10305885 3300009093 Unclassified 1817
155 Ga0111539_10130060 3300009094 Bacteria 2948
156 Ga0105247_10054289 3300009101 Bacteria 2473
157 Ga0105241_10273575 3300009174 Bacteria 1440
158 Ga0105241_10762432 3300009174 Unclassified 888
159 Ga0105242_10012022 3300009176 Bacteria 6664
160 Ga0105242_10018172 3300009176 Bacteria 5492
161 Ga0105242_10042515 3300009176 Bacteria 3670
162 Ga0105242_10066365 3300009176 Unclassified 2979
163 Ga0105248_10047915 3300009177 Bacteria 4793
164 Ga0105248_10471482 3300009177 Bacteria 1415
165 Ga0105237_10010249 3300009545 Bacteria 9983
166 Ga0105237_10084091 3300009545 Bacteria 3173
167 Ga0105237_10137967 3300009545 Bacteria 2433
168 Ga0105238_10587140 3300009551 Unclassified 1121
169 Ga0105249_10013935 3300009553 Bacteria 7107
170 Ga0105249_10030807 3300009553 Bacteria 4849
171 Ga0105249_10594814 3300009553 Bacteria 1160
172 Ga0105249_10684805 3300009553 Bacteria 1084
173 Ga0105249_11642568 3300009553 Bacteria 715
174 Ga0105239_10031202 3300010375 Bacteria 5862
175 Ga0105239_10055185 3300010375 Bacteria 4358
176 Ga0105239_10154228 3300010375 Bacteria 2564
177 Ga0105246_10032106 3300011119 Bacteria 3480
178 Ga0105246_10095191 3300011119 Bacteria 2156
179 Ga0157373_10001569 3300013100 Bacteria 17436
180 Ga0157373_10111886 3300013100 Bacteria 1919
181 Ga0157371_10000759 3300013102 Bacteria 37290
182 Ga0157371_10006131 3300013102 Bacteria 9992
183 Ga0157371_10012709 3300013102 Bacteria 6420
184 Ga0157371_10079916 3300013102 Bacteria 2316
185 Ga0157371_10129171 3300013102 Bacteria 1797
186 Ga0157370_10196443 3300013104 Unclassified 1872
187 Ga0157374_10000027 3300013296 Bacteria 233444
188 Ga0157374_10000505 3300013296 Bacteria 35194
189 Ga0157374_10246128 3300013296 Bacteria 1759
190 Ga0157378_10751986 3300013297 Bacteria 998
191 Ga0157378_10850346 3300013297 Unclassified 941
192 Ga0163162_10000096 3300013306 Bacteria 80090
193 Ga0163162_10000766 3300013306 Bacteria 29884
194 Ga0163162_10037532 3300013306 Bacteria 4835
195 Ga0163162_10071367 3300013306 Bacteria 3526
196 Ga0163162_10125098 3300013306 Bacteria 2676
197 Ga0163162_10177972 3300013306 Bacteria 2253
198 Ga0163162_10208892 3300013306 Bacteria 2082
199 Ga0163162_10579412 3300013306 Unclassified 1249
200 Ga0157372_10010850 3300013307 Bacteria 9699
201 Ga0157372_10012542 3300013307 Bacteria 9026
202 Ga0157372_10068589 3300013307 Unclassified 3987
203 Ga0157372_10376948 3300013307 Bacteria 1653
204 Ga0157375_10000512 3300013308 Bacteria 34894
205 Ga0157375_10024733 3300013308 Bacteria 5564
206 Ga0157375_10071613 3300013308 Bacteria 3480
207 Ga0157375_10148352 3300013308 Bacteria 2478
208 Ga0157375_10191292 3300013308 Bacteria 2201
209 Ga0157375_10272248 3300013308 Bacteria 1856
210 Ga0157375_10495218 3300013308 Bacteria 1386
211 Ga0157375_10532406 3300013308 Bacteria 1337
212 Ga0157375_10656364 3300013308 Bacteria 1205
213 Ga0157375_11707144 3300013308 Bacteria 746
214 Ga0163163_10003348 3300014325 Bacteria 13600
215 Ga0157380_10028288 3300014326 Bacteria 4272
216 Ga0157380_10046574 3300014326 Bacteria 3407
217 Ga0157380_10084162 3300014326 Bacteria 2608
218 Ga0157380_10094716 3300014326 Bacteria 2472
219 Ga0157377_10013400 3300014745 Bacteria 4149
220 Ga0157379_10001520 3300014968 Bacteria 19061
221 Ga0157379_10388573 3300014968 Bacteria 1281
222 Ga0157379_10832884 3300014968 Bacteria 872
223 Ga0157376_10000252 3300014969 Bacteria 37037
224 Ga0157376_10000304 3300014969 Bacteria 33027
225 Ga0157376_10118606 3300014969 Bacteria 2341
226 Ga0157376_10370594 3300014969 Unclassified 1376
227 Ga0157376_10410488 3300014969 Bacteria 1312
228 Ga0157376_10480506 3300014969 Unclassified 1217
229 Ga0157376_10588825 3300014969 Bacteria 1106
230 Ga0157376_11077856 3300014969 Bacteria 828
231 Ga0163161_10005560 3300017792 Bacteria 8732
232 Ga0163161_10028668 3300017792 Bacteria 3954
233 Ga0163161_10220428 3300017792 Bacteria 1469
234 Ga0163161_10354173 3300017792 Bacteria 1167
235 Ga0207426_1000026 3300025302 Bacteria 515228
236 Ga0207697_10056546 3300025315 Unclassified 1628
237 Ga0207682_10022276 3300025893 Bacteria 2495
238 Ga0207642_10095745 3300025899 Unclassified 1478
239 Ga0207642_10119970 3300025899 Bacteria 1355
240 Ga0207710_10157813 3300025900 Unclassified 1103
241 Ga0207680_10000223 3300025903 Bacteria 27399
242 Ga0207680_10484050 3300025903 Bacteria 880
243 Ga0207647_10108401 3300025904 Bacteria 1643
244 Ga0207645_10002965 3300025907 Bacteria 13113
245 Ga0207643_10005011 3300025908 Bacteria 7094
246 Ga0207643_10179550 3300025908 Bacteria 1280
247 Ga0207643_10376035 3300025908 Unclassified 895
248 Ga0207705_10011091 3300025909 Bacteria 6533
249 Ga0207695_10000299 3300025913 Bacteria 122118
250 Ga0207695_10000676 3300025913 Bacteria 67018
251 Ga0207695_10072095 3300025913 Bacteria 3526
252 Ga0207695_10155081 3300025913 Bacteria 2225
253 Ga0207695_10434545 3300025913 Bacteria 1196
254 Ga0207671_10008961 3300025914 Bacteria 8420
255 Ga0207671_10079325 3300025914 Bacteria 2459
256 Ga0207671_10080490 3300025914 Bacteria 2442
257 Ga0207662_10156829 3300025918 Bacteria 1452
258 Ga0207662_10234447 3300025918 Bacteria 1199
259 Ga0207662_10498596 3300025918 Bacteria 838
260 Ga0207649_10310658 3300025920 Bacteria 1155
261 Ga0207646_10330980 3300025922 Bacteria 1376
262 Ga0207681_10650961 3300025923 Bacteria 873
263 Ga0207650_10004553 3300025925 Bacteria 9480
264 Ga0207650_10555791 3300025925 Bacteria 962
265 Ga0207659_10536767 3300025926 Bacteria 993
266 Ga0207659_10849959 3300025926 Bacteria 784
267 Ga0207706_10021918 3300025933 Bacteria 5734
268 Ga0207706_10086598 3300025933 Bacteria 2754
269 Ga0207686_10001012 3300025934 Bacteria 16646
270 Ga0207670_10006100 3300025936 Bacteria 6661
271 Ga0207670_10017385 3300025936 Bacteria 4346
272 Ga0207670_10045647 3300025936 Bacteria 2906
273 Ga0207669_10465302 3300025937 Bacteria 1005
274 Ga0207704_10130370 3300025938 Bacteria 1740
275 Ga0207704_10225920 3300025938 Bacteria 1389
276 Ga0207704_10349402 3300025938 Bacteria 1151
277 Ga0207691_10000057 3300025940 Bacteria 89823
278 Ga0207691_10027395 3300025940 Bacteria 5342
279 Ga0207691_10030866 3300025940 Bacteria 5004
280 Ga0207691_10065084 3300025940 Bacteria 3301
281 Ga0207711_10092140 3300025941 Bacteria 2667
282 Ga0207689_10077285 3300025942 Bacteria 2737
283 Ga0207689_11015032 3300025942 Unclassified 700
284 Ga0207661_10183581 3300025944 Bacteria 1829
285 Ga0207679_10044619 3300025945 Bacteria 3199
286 Ga0207651_10015959 3300025960 Bacteria 4383
287 Ga0207651_10127269 3300025960 Bacteria 1943
288 Ga0207651_11408635 3300025960 Unclassified 627
289 Ga0207712_10001303 3300025961 Bacteria 17080
290 Ga0207668_10000170 3300025972 Bacteria 45140
291 Ga0207640_10791583 3300025981 Unclassified 821
292 Ga0207658_10001297 3300025986 Bacteria 19745
293 Ga0207677_10001046 3300026023 Bacteria 15188
294 Ga0207703_10003855 3300026035 Bacteria 12459
295 Ga0207703_10174602 3300026035 Bacteria 1892
296 Ga0207639_10003650 3300026041 Bacteria 10345
297 Ga0207639_10096739 3300026041 Bacteria 2376
298 Ga0207639_11046667 3300026041 Bacteria 765
299 Ga0207678_10125887 3300026067 Unclassified 2186
300 Ga0207702_10376482 3300026078 Unclassified 1364
301 Ga0207641_10001794 3300026088 Bacteria 20639
302 Ga0207641_10007368 3300026088 Bacteria 9159
303 Ga0207641_10713124 3300026088 Bacteria 988
304 Ga0207641_11138437 3300026088 Bacteria 779
305 Ga0207648_10010287 3300026089 Bacteria 8882
306 Ga0207648_10041367 3300026089 Unclassified 4047
307 Ga0207648_10067800 3300026089 Bacteria 3110
308 Ga0207648_10138676 3300026089 Bacteria 2143
309 Ga0207648_10373013 3300026089 Bacteria 1289
310 Ga0207648_10439256 3300026089 Unclassified 1187
311 Ga0207648_10524276 3300026089 Bacteria 1086
312 Ga0207648_10745701 3300026089 Bacteria 909
313 Ga0207676_10000768 3300026095 Bacteria 25093
314 Ga0207676_10553926 3300026095 Bacteria 1099
315 Ga0207676_10758214 3300026095 Bacteria 944
316 Ga0207674_10286004 3300026116 Bacteria 1597
317 Ga0207674_10608308 3300026116 Bacteria 1056
318 Ga0207675_100002214 3300026118 Bacteria 19316
319 Ga0207675_100024824 3300026118 Bacteria 5577
320 Ga0207675_100111612 3300026118 Bacteria 2580
321 Ga0207675_100422498 3300026118 Bacteria 1317
322 Ga0207675_100449857 3300026118 Bacteria 1276
323 Ga0207683_10275275 3300026121 Bacteria 1538
324 Ga0207683_11290434 3300026121 Unclassified 676
325 Ga0207698_10003443 3300026142 Bacteria 9529
326 Ga0207698_10031290 3300026142 Bacteria 3839
327 Ga0207698_10111994 3300026142 Bacteria 2289
328 Ga0207698_10152737 3300026142 Bacteria 2007
329 Ga0268266_10002368 3300028379 Bacteria 20373
330 Ga0268265_10252501 3300028380 Bacteria 1563
331 Ga0268264_10001415 3300028381 Bacteria 22431
332 Ga0268264_10082694 3300028381 Bacteria 2748
333 Ga0268264_10126998 3300028381 Unclassified 2255
334 Ga0268264_10948800 3300028381 Bacteria 865
335 Ga0307414_10016895 3300032004 Bacteria 4451
336 Ga0373923_0036144 3300035111 Unclassified 2015
337 Ga0373924_0015814 3300035410 Bacteria 2874
338 Ga0373933_0051231 3300035724 Unclassified 2467
339 Ga0373937_0024072 3300036401 Bacteria 5490
340 Ga0373937_0194706 3300036401 Bacteria 1905
341 Ga0395899_0116751 3300037312 Bacteria 1914
342 Ga0395899_0394807 3300037312 Unclassified 916
343 Ga0395900_0057170 3300037418 Bacteria 4015
344 Ga0395900_0102848 3300037418 Bacteria 2934
345 Ga0395898_0101129 3300037466 Bacteria 2768
346 Ga0395898_0190654 3300037466 Bacteria 1958
347 Ga0395898_0233382 3300037466 Bacteria 1754
348 Ga0395905_0057448 3300037471 Bacteria 3640
349 Ga0395905_0748262 3300037471 Bacteria 880
350 Ga0395901_0249097 3300038443 Bacteria 1851
351 Ga0395901_0271838 3300038443 Bacteria 1762
352 Ga0436365_0446991 3300039437 Bacteria 832
353 Ga0451802_2032186 3300041460 Bacteria 1390
354 Ga0451807_1660963 3300041486 Bacteria 695
355 Ga0450923_009319 3300042125 Unclassified 1714
356 Ga0451577_0346085 3300042876 Bacteria 1349
357 Ga0466965_0214435 3300044683 Bacteria 1024
358 Ga0495608_0053957 3300046511 Unclassified 2658
359 Ga0495618_0016477 3300046514 Bacteria 4522
360 Ga0495630_0008316 3300046517 Bacteria 7449
361 Ga0495643_0010120 3300046522 Bacteria 5816
362 Ga0495663_0072126 3300046525 Bacteria 1101
363 Ga0495586_0597035 3300046535 Unclassified 638
364 Ga0495598_0126630 3300046537 Bacteria 871
365 Ga0495668_0000339 3300046616 Bacteria 62659
366 Ga0495634_0035548 3300046642 Bacteria 3411
367 Ga0495635_0062331 3300046663 Bacteria 2561
368 Ga0495599_0150761 3300046678 Unclassified 1440
369 Ga0495672_0362410 3300047320 Unclassified 671
370 Ga0501032_0100559 3300049569 Bacteria 1916
371 Ga0501034_0736143 3300049571 Bacteria 882
372 Ga0501080_0464004 3300049742 Bacteria 1134
373 Ga0501035_0270932 3300049822 Bacteria 1437
374 nmdc:mga0k408_239357_c1 3300050493 Bacteria 1084
375 nmdc:mga07m45_90128_c1 3300050496 Bacteria 1756
376 nmdc:mga08y16_165999_c1 3300050511 Bacteria 2293
377 nmdc:mga08y16_339051_c1 3300050511 Unclassified 1545
378 Ga0500616_0083168 3300053153 Bacteria 1604
379 Ga0500645_016700 3300053730 Bacteria 2308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026142 Ga0207698_10152737 Ga0207698_101527374 158
2 3300046535 Ga0495586_0597035 Ga0495586_0597035_25_561 169
3 3300003320 rootH2_10110262 rootH2_101102622 171
4 3300050493 nmdc:mga0k408_239357_c1 nmdc:mga0k408_239357_c1_36_560 171
5 3300053730 Ga0500645_016700 Ga0500645_016700_317_850 174
6 3300014326 Ga0157380_10084162 Ga0157380_100841622 175
7 3300005344 Ga0070661_100389339 Ga0070661_1003893392 176
8 3300009093 Ga0105240_10305885 Ga0105240_103058853 176
9 3300009101 Ga0105247_10054289 Ga0105247_100542892 176
10 3300009176 Ga0105242_10012022 Ga0105242_100120227 176
11 3300009177 Ga0105248_10047915 Ga0105248_100479153 176
12 3300009545 Ga0105237_10084091 Ga0105237_100840913 176
13 3300009553 Ga0105249_10013935 Ga0105249_100139359 176
14 3300010375 Ga0105239_10031202 Ga0105239_100312026 176
15 3300011119 Ga0105246_10032106 Ga0105246_100321063 176
16 3300013296 Ga0157374_10000505 Ga0157374_1000050524 176
17 3300013306 Ga0163162_10000096 Ga0163162_1000009627 176
18 3300013307 Ga0157372_10010850 Ga0157372_100108502 176
19 3300013308 Ga0157375_10000512 Ga0157375_1000051213 176
20 3300014325 Ga0163163_10003348 Ga0163163_100033488 176
21 3300014968 Ga0157379_10001520 Ga0157379_100015209 176
22 3300014969 Ga0157376_10000252 Ga0157376_1000025228 176
23 3300006163 Ga0070715_10057834 Ga0070715_100578342 177
24 3300006195 Ga0075366_10004442 Ga0075366_100044425 177
25 3300006353 Ga0075370_10095646 Ga0075370_100956461 177
26 3300009174 Ga0105241_10273575 Ga0105241_102735752 177
27 3300009545 Ga0105237_10010249 Ga0105237_100102495 177
28 3300010375 Ga0105239_10055185 Ga0105239_100551852 177
29 3300025914 Ga0207671_10008961 Ga0207671_100089613 177
30 3300026088 Ga0207641_11138437 Ga0207641_111384371 177
31 3300046522 Ga0495643_0010120 Ga0495643_0010120_3318_3908 177
32 3300050496 nmdc:mga07m45_90128_c1 nmdc:mga07m45_90128_c1_159_749 177
33 3300005616 Ga0068852_100237503 Ga0068852_1002375033 178
34 3300006237 Ga0097621_100712375 Ga0097621_1007123752 178
35 3300013102 Ga0157371_10000759 Ga0157371_1000075911 178
36 3300013102 Ga0157371_10012709 Ga0157371_100127095 178
37 3300014969 Ga0157376_10410488 Ga0157376_104104882 178
38 3300017792 Ga0163161_10354173 Ga0163161_103541732 178
39 3300026078 Ga0207702_10376482 Ga0207702_103764822 178
40 3300026142 Ga0207698_10003443 Ga0207698_100034432 178
41 3300041486 Ga0451807_1660963 Ga0451807_1660963_29_616 178
42 3300005331 Ga0070670_100289649 Ga0070670_1002896493 179
43 3300005334 Ga0068869_101233150 Ga0068869_1012331501 179
44 3300005354 Ga0070675_100359005 Ga0070675_1003590054 179
45 3300005365 Ga0070688_100202974 Ga0070688_1002029743 179
46 3300005459 Ga0068867_100198198 Ga0068867_1001981982 179
47 3300005539 Ga0068853_100001904 Ga0068853_10000190414 179
48 3300005543 Ga0070672_100127535 Ga0070672_1001275354 179
49 3300005578 Ga0068854_100582045 Ga0068854_1005820452 179
50 3300005617 Ga0068859_101976944 Ga0068859_1019769441 179
51 3300005618 Ga0068864_100082434 Ga0068864_1000824343 179
52 3300005840 Ga0068870_10326283 Ga0068870_103262832 179
53 3300006237 Ga0097621_100317239 Ga0097621_1003172392 179
54 3300006931 Ga0097620_101976860 Ga0097620_1019768601 179
55 3300009174 Ga0105241_10762432 Ga0105241_107624321 179
56 3300009551 Ga0105238_10587140 Ga0105238_105871401 179
57 3300013100 Ga0157373_10111886 Ga0157373_101118863 179
58 3300013102 Ga0157371_10006131 Ga0157371_100061317 179
59 3300013296 Ga0157374_10246128 Ga0157374_102461281 179
60 3300013297 Ga0157378_10751986 Ga0157378_107519862 179
61 3300013307 Ga0157372_10012542 Ga0157372_100125422 179
62 3300013308 Ga0157375_10191292 Ga0157375_101912922 179
63 3300013308 Ga0157375_10495218 Ga0157375_104952182 179
64 3300014326 Ga0157380_10028288 Ga0157380_100282882 179
65 3300025908 Ga0207643_10376035 Ga0207643_103760352 179
66 3300025913 Ga0207695_10072095 Ga0207695_100720955 179
67 3300025938 Ga0207704_10225920 Ga0207704_102259202 179
68 3300025940 Ga0207691_10065084 Ga0207691_100650842 179
69 3300025942 Ga0207689_11015032 Ga0207689_110150322 179
70 3300026041 Ga0207639_10003650 Ga0207639_100036505 179
71 3300026041 Ga0207639_11046667 Ga0207639_110466672 179
72 3300026089 Ga0207648_10745701 Ga0207648_107457012 179
73 3300026095 Ga0207676_10553926 Ga0207676_105539261 179
74 3300026142 Ga0207698_10111994 Ga0207698_101119942 179
75 3300005327 Ga0070658_10000512 Ga0070658_100005126 180
76 3300005328 Ga0070676_10009543 Ga0070676_100095434 180
77 3300005335 Ga0070666_10000322 Ga0070666_1000032226 180
78 3300005338 Ga0068868_100000119 Ga0068868_10000011930 180
79 3300005347 Ga0070668_100000645 Ga0070668_10000064519 180
80 3300005364 Ga0070673_100000331 Ga0070673_1000003315 180
81 3300005367 Ga0070667_100000706 Ga0070667_1000007063 180
82 3300005455 Ga0070663_100262638 Ga0070663_1002626382 180
83 3300005456 Ga0070678_100652346 Ga0070678_1006523462 180
84 3300005457 Ga0070662_100002256 Ga0070662_1000022566 180
85 3300005459 Ga0068867_100016317 Ga0068867_1000163173 180
86 3300005539 Ga0068853_100030463 Ga0068853_1000304632 180
87 3300005543 Ga0070672_100000183 Ga0070672_1000001839 180
88 3300005548 Ga0070665_100001045 Ga0070665_10000104532 180
89 3300005564 Ga0070664_100721714 Ga0070664_1007217142 180
90 3300005578 Ga0068854_100393206 Ga0068854_1003932062 180
91 3300005617 Ga0068859_100297810 Ga0068859_1002978102 180
92 3300005618 Ga0068864_100003700 Ga0068864_1000037006 180
93 3300005718 Ga0068866_10177853 Ga0068866_101778532 180
94 3300005841 Ga0068863_100003358 Ga0068863_1000033589 180
95 3300005842 Ga0068858_100001328 Ga0068858_10000132811 180
96 3300005843 Ga0068860_100001860 Ga0068860_10000186011 180
97 3300006237 Ga0097621_100090964 Ga0097621_1000909642 180
98 3300006358 Ga0068871_100004865 Ga0068871_1000048655 180
99 3300006931 Ga0097620_100297801 Ga0097620_1002978012 180
100 3300009093 Ga0105240_10001169 Ga0105240_1000116916 180
101 3300013100 Ga0157373_10001569 Ga0157373_1000156914 180
102 3300013102 Ga0157371_10079916 Ga0157371_100799162 180
103 3300017792 Ga0163161_10005560 Ga0163161_100055606 180
104 3300025315 Ga0207697_10056546 Ga0207697_100565463 180
105 3300025899 Ga0207642_10119970 Ga0207642_101199702 180
106 3300025900 Ga0207710_10157813 Ga0207710_101578132 180
107 3300025903 Ga0207680_10000223 Ga0207680_100002237 180
108 3300025904 Ga0207647_10108401 Ga0207647_101084012 180
109 3300025907 Ga0207645_10002965 Ga0207645_1000296510 180
110 3300025909 Ga0207705_10011091 Ga0207705_100110916 180
111 3300025913 Ga0207695_10000299 Ga0207695_1000029988 180
112 3300025913 Ga0207695_10155081 Ga0207695_101550813 180
113 3300025914 Ga0207671_10080490 Ga0207671_100804903 180
114 3300025940 Ga0207691_10000057 Ga0207691_1000005739 180
115 3300025960 Ga0207651_10015959 Ga0207651_100159594 180
116 3300025972 Ga0207668_10000170 Ga0207668_1000017027 180
117 3300025986 Ga0207658_10001297 Ga0207658_100012978 180
118 3300026023 Ga0207677_10001046 Ga0207677_1000104613 180
119 3300026035 Ga0207703_10003855 Ga0207703_100038558 180
120 3300026041 Ga0207639_10096739 Ga0207639_100967392 180
121 3300026067 Ga0207678_10125887 Ga0207678_101258873 180
122 3300026088 Ga0207641_10001794 Ga0207641_100017943 180
123 3300026089 Ga0207648_10010287 Ga0207648_100102879 180
124 3300026095 Ga0207676_10000768 Ga0207676_1000076813 180
125 3300026121 Ga0207683_10275275 Ga0207683_102752752 180
126 3300028379 Ga0268266_10002368 Ga0268266_1000236816 180
127 3300028381 Ga0268264_10126998 Ga0268264_101269984 180
128 3300037312 Ga0395899_0116751 Ga0395899_0116751_424_996 180
129 3300037312 Ga0395899_0394807 Ga0395899_0394807_121_693 180
130 3300037418 Ga0395900_0057170 Ga0395900_0057170_1185_1757 180
131 3300037418 Ga0395900_0102848 Ga0395900_0102848_837_1409 180
132 3300037466 Ga0395898_0101129 Ga0395898_0101129_1178_1750 180
133 3300037466 Ga0395898_0190654 Ga0395898_0190654_1223_1795 180
134 3300037466 Ga0395898_0233382 Ga0395898_0233382_1019_1591 180
135 3300037471 Ga0395905_0057448 Ga0395905_0057448_402_974 180
136 3300037471 Ga0395905_0748262 Ga0395905_0748262_101_673 180
137 3300038443 Ga0395901_0249097 Ga0395901_0249097_95_667 180
138 3300038443 Ga0395901_0271838 Ga0395901_0271838_719_1291 180
139 3300003354 JGI25160J50197_1003216 JGI25160J50197_10032165 181
140 3300005364 Ga0070673_101075254 Ga0070673_1010752542 181
141 3300005457 Ga0070662_100000209 Ga0070662_1000002096 181
142 3300005578 Ga0068854_100386614 Ga0068854_1003866142 181
143 3300005719 Ga0068861_100029152 Ga0068861_1000291524 181
144 3300009093 Ga0105240_10292085 Ga0105240_102920851 181
145 3300009545 Ga0105237_10137967 Ga0105237_101379673 181
146 3300025302 Ga0207426_1000026 Ga0207426_1000026286 181
147 3300025903 Ga0207680_10484050 Ga0207680_104840502 181
148 3300025913 Ga0207695_10000676 Ga0207695_1000067644 181
149 3300025913 Ga0207695_10434545 Ga0207695_104345451 181
150 3300025914 Ga0207671_10079325 Ga0207671_100793253 181
151 3300025933 Ga0207706_10021918 Ga0207706_100219182 181
152 3300026118 Ga0207675_100024824 Ga0207675_1000248244 181
153 3300028381 Ga0268264_10948800 Ga0268264_109488002 181
154 3300005843 Ga0068860_100004501 Ga0068860_1000045012 182
155 3300013306 Ga0163162_10000766 Ga0163162_1000076617 182
156 3300028381 Ga0268264_10001415 Ga0268264_1000141513 182
157 3300035111 Ga0373923_0036144 Ga0373923_0036144_439_1050 182
158 3300035410 Ga0373924_0015814 Ga0373924_0015814_1844_2455 182
159 3300035724 Ga0373933_0051231 Ga0373933_0051231_1805_2416 182
160 3300036401 Ga0373937_0024072 Ga0373937_0024072_2820_3431 182
161 3300042876 Ga0451577_0346085 Ga0451577_0346085_107_664 182
162 3300046511 Ga0495608_0053957 Ga0495608_0053957_995_1606 182
163 3300046514 Ga0495618_0016477 Ga0495618_0016477_503_1114 182
164 3300046517 Ga0495630_0008316 Ga0495630_0008316_4890_5501 182
165 3300046642 Ga0495634_0035548 Ga0495634_0035548_2311_2922 182
166 3300046663 Ga0495635_0062331 Ga0495635_0062331_1370_1981 182
167 3300046678 Ga0495599_0150761 Ga0495599_0150761_354_965 182
168 3300005719 Ga0068861_101146211 Ga0068861_1011462111 183
169 3300005843 Ga0068860_101746611 Ga0068860_1017466111 183
170 3300044683 Ga0466965_0214435 Ga0466965_0214435_427_984 183
171 3300005288 Ga0065714_10157218 Ga0065714_101572182 184
172 3300005328 Ga0070676_10099384 Ga0070676_100993843 184
173 3300005459 Ga0068867_100241553 Ga0068867_1002415532 184
174 3300005841 Ga0068863_100011520 Ga0068863_1000115203 184
175 3300005841 Ga0068863_100473995 Ga0068863_1004739952 184
176 3300005844 Ga0068862_100057136 Ga0068862_1000571361 184
177 3300006358 Ga0068871_100667710 Ga0068871_1006677102 184
178 3300006881 Ga0068865_100376274 Ga0068865_1003762742 184
179 3300013306 Ga0163162_10125098 Ga0163162_101250983 184
180 3300013306 Ga0163162_10177972 Ga0163162_101779722 184
181 3300013306 Ga0163162_10579412 Ga0163162_105794123 184
182 3300014969 Ga0157376_10480506 Ga0157376_104805062 184
183 3300017792 Ga0163161_10220428 Ga0163161_102204281 184
184 3300025926 Ga0207659_10849959 Ga0207659_108499591 184
185 3300025938 Ga0207704_10130370 Ga0207704_101303704 184
186 3300025938 Ga0207704_10349402 Ga0207704_103494022 184
187 3300026089 Ga0207648_10067800 Ga0207648_100678004 184
188 3300028380 Ga0268265_10252501 Ga0268265_102525013 184
189 3300039437 Ga0436365_0446991 Ga0436365_0446991_18_608 184
190 3300049742 Ga0501080_0464004 Ga0501080_0464004_405_995 184
191 3300049822 Ga0501035_0270932 Ga0501035_0270932_78_668 184
192 3300053153 Ga0500616_0083168 Ga0500616_0083168_858_1412 184
193 3300005290 Ga0065712_10121021 Ga0065712_101210212 185
194 3300005329 Ga0070683_100014441 Ga0070683_1000144416 185
195 3300005329 Ga0070683_100159946 Ga0070683_1001599462 185
196 3300005331 Ga0070670_100282156 Ga0070670_1002821561 185
197 3300005334 Ga0068869_100083455 Ga0068869_1000834552 185
198 3300005340 Ga0070689_100079597 Ga0070689_1000795973 185
199 3300005344 Ga0070661_100009078 Ga0070661_1000090789 185
200 3300005344 Ga0070661_100057467 Ga0070661_1000574674 185
201 3300005364 Ga0070673_100112495 Ga0070673_1001124954 185
202 3300005365 Ga0070688_100006355 Ga0070688_1000063556 185
203 3300005367 Ga0070667_100050060 Ga0070667_1000500602 185
204 3300005367 Ga0070667_100089707 Ga0070667_1000897072 185
205 3300005459 Ga0068867_100008666 Ga0068867_1000086666 185
206 3300005459 Ga0068867_100495936 Ga0068867_1004959361 185
207 3300005466 Ga0070685_10023183 Ga0070685_100231834 185
208 3300005535 Ga0070684_100042107 Ga0070684_1000421073 185
209 3300005564 Ga0070664_100010227 Ga0070664_1000102274 185
210 3300005617 Ga0068859_100077792 Ga0068859_1000777924 185
211 3300005617 Ga0068859_100528009 Ga0068859_1005280092 185
212 3300005841 Ga0068863_100364360 Ga0068863_1003643602 185
213 3300005843 Ga0068860_100023864 Ga0068860_1000238644 185
214 3300006237 Ga0097621_100123596 Ga0097621_1001235964 185
215 3300006931 Ga0097620_100077793 Ga0097620_1000777932 185
216 3300006931 Ga0097620_100528066 Ga0097620_1005280662 185
217 3300009553 Ga0105249_10594814 Ga0105249_105948142 185
218 3300009553 Ga0105249_10684805 Ga0105249_106848051 185
219 3300010375 Ga0105239_10154228 Ga0105239_101542282 185
220 3300011119 Ga0105246_10095191 Ga0105246_100951912 185
221 3300013306 Ga0163162_10037532 Ga0163162_100375326 185
222 3300013307 Ga0157372_10376948 Ga0157372_103769481 185
223 3300013308 Ga0157375_10024733 Ga0157375_100247335 185
224 3300014969 Ga0157376_10588825 Ga0157376_105888251 185
225 3300025920 Ga0207649_10310658 Ga0207649_103106582 185
226 3300025933 Ga0207706_10086598 Ga0207706_100865983 185
227 3300025936 Ga0207670_10017385 Ga0207670_100173852 185
228 3300025942 Ga0207689_10077285 Ga0207689_100772851 185
229 3300025944 Ga0207661_10183581 Ga0207661_101835812 185
230 3300025945 Ga0207679_10044619 Ga0207679_100446194 185
231 3300026035 Ga0207703_10174602 Ga0207703_101746022 185
232 3300026089 Ga0207648_10041367 Ga0207648_100413675 185
233 3300026089 Ga0207648_10373013 Ga0207648_103730132 185
234 3300026089 Ga0207648_10524276 Ga0207648_105242762 185
235 3300026142 Ga0207698_10031290 Ga0207698_100312902 185
236 3300028381 Ga0268264_10082694 Ga0268264_100826944 185
237 3300005333 Ga0070677_10328477 Ga0070677_103284772 186
238 3300005354 Ga0070675_100079421 Ga0070675_1000794213 186
239 3300005356 Ga0070674_100361612 Ga0070674_1003616122 186
240 3300005364 Ga0070673_100291745 Ga0070673_1002917451 186
241 3300005543 Ga0070672_100175978 Ga0070672_1001759782 186
242 3300005617 Ga0068859_101090571 Ga0068859_1010905712 186
243 3300005719 Ga0068861_100603228 Ga0068861_1006032282 186
244 3300006237 Ga0097621_100936205 Ga0097621_1009362052 186
245 3300006931 Ga0097620_101090422 Ga0097620_1010904222 186
246 3300009176 Ga0105242_10066365 Ga0105242_100663652 186
247 3300013296 Ga0157374_10000027 Ga0157374_1000002798 186
248 3300013308 Ga0157375_10148352 Ga0157375_101483523 186
249 3300014969 Ga0157376_10000304 Ga0157376_100003047 186
250 3300025899 Ga0207642_10095745 Ga0207642_100957452 186
251 3300025925 Ga0207650_10555791 Ga0207650_105557911 186
252 3300025937 Ga0207669_10465302 Ga0207669_104653022 186
253 3300025940 Ga0207691_10027395 Ga0207691_100273955 186
254 3300025960 Ga0207651_11408635 Ga0207651_114086351 186
255 3300026118 Ga0207675_100422498 Ga0207675_1004224981 186
256 3300041460 Ga0451802_2032186 Ga0451802_2032186_189_758 186
257 3300013297 Ga0157378_10850346 Ga0157378_108503462 187
258 3300025926 Ga0207659_10536767 Ga0207659_105367672 187
259 3300046616 Ga0495668_0000339 Ga0495668_0000339_18590_19252 187
260 3300047320 Ga0495672_0362410 Ga0495672_0362410_49_642 187
261 3300042125 Ga0450923_009319 Ga0450923_009319_824_1417 188
262 3300049569 Ga0501032_0100559 Ga0501032_0100559_162_731 188
263 3300049571 Ga0501034_0736143 Ga0501034_0736143_38_607 188
264 3300005290 Ga0065712_10070979 Ga0065712_100709798 189
265 3300005295 Ga0065707_10215855 Ga0065707_102158552 189
266 3300005338 Ga0068868_100360620 Ga0068868_1003606202 189
267 3300005340 Ga0070689_100101671 Ga0070689_1001016714 189
268 3300005343 Ga0070687_100129579 Ga0070687_1001295792 189
269 3300005343 Ga0070687_100167413 Ga0070687_1001674131 189
270 3300005353 Ga0070669_100074259 Ga0070669_1000742592 189
271 3300005353 Ga0070669_100294039 Ga0070669_1002940392 189
272 3300005365 Ga0070688_100016465 Ga0070688_1000164654 189
273 3300005367 Ga0070667_100109535 Ga0070667_1001095351 189
274 3300005466 Ga0070685_10015847 Ga0070685_100158478 189
275 3300005617 Ga0068859_100108088 Ga0068859_1001080885 189
276 3300005617 Ga0068859_100117612 Ga0068859_1001176122 189
277 3300005617 Ga0068859_100403064 Ga0068859_1004030643 189
278 3300005618 Ga0068864_100647606 Ga0068864_1006476062 189
279 3300005618 Ga0068864_101355257 Ga0068864_1013552571 189
280 3300005719 Ga0068861_100310036 Ga0068861_1003100362 189
281 3300005841 Ga0068863_101466175 Ga0068863_1014661751 189
282 3300006931 Ga0097620_100108085 Ga0097620_1001080855 189
283 3300006931 Ga0097620_100117605 Ga0097620_1001176052 189
284 3300006931 Ga0097620_100403021 Ga0097620_1004030213 189
285 3300009094 Ga0111539_10130060 Ga0111539_101300602 189
286 3300009177 Ga0105248_10471482 Ga0105248_104714822 189
287 3300009553 Ga0105249_10030807 Ga0105249_100308075 189
288 3300013306 Ga0163162_10071367 Ga0163162_100713673 189
289 3300013308 Ga0157375_10071613 Ga0157375_100716133 189
290 3300013308 Ga0157375_11707144 Ga0157375_117071441 189
291 3300014969 Ga0157376_11077856 Ga0157376_110778562 189
292 3300017792 Ga0163161_10028668 Ga0163161_100286682 189
293 3300025918 Ga0207662_10156829 Ga0207662_101568292 189
294 3300025918 Ga0207662_10234447 Ga0207662_102344472 189
295 3300025923 Ga0207681_10650961 Ga0207681_106509612 189
296 3300025936 Ga0207670_10045647 Ga0207670_100456472 189
297 3300025941 Ga0207711_10092140 Ga0207711_100921402 189
298 3300025961 Ga0207712_10001303 Ga0207712_100013039 189
299 3300026088 Ga0207641_10713124 Ga0207641_107131242 189
300 3300026095 Ga0207676_10758214 Ga0207676_107582142 189
301 3300026118 Ga0207675_100002214 Ga0207675_10000221415 189
302 3300026118 Ga0207675_100449857 Ga0207675_1004498572 189
303 3300032004 Ga0307414_10016895 Ga0307414_100168953 189
304 3300050511 nmdc:mga08y16_165999_c1 nmdc:mga08y16_165999_c1_206_793 189
305 3300005290 Ga0065712_10004488 Ga0065712_100044884 190
306 3300005290 Ga0065712_10272430 Ga0065712_102724302 190
307 3300005293 Ga0065715_10007870 Ga0065715_100078702 190
308 3300005331 Ga0070670_100002539 Ga0070670_1000025399 190
309 3300005334 Ga0068869_100137664 Ga0068869_1001376643 190
310 3300005340 Ga0070689_100137698 Ga0070689_1001376982 190
311 3300005353 Ga0070669_100176302 Ga0070669_1001763022 190
312 3300005364 Ga0070673_100136828 Ga0070673_1001368281 190
313 3300005364 Ga0070673_100592447 Ga0070673_1005924472 190
314 3300005365 Ga0070688_100030589 Ga0070688_1000305892 190
315 3300005440 Ga0070705_100845231 Ga0070705_1008452311 190
316 3300005441 Ga0070700_101063560 Ga0070700_1010635601 190
317 3300005466 Ga0070685_10033855 Ga0070685_100338551 190
318 3300005466 Ga0070685_10489097 Ga0070685_104890972 190
319 3300005468 Ga0070707_100490665 Ga0070707_1004906651 190
320 3300005471 Ga0070698_100008587 Ga0070698_1000085878 190
321 3300005471 Ga0070698_100066902 Ga0070698_1000669024 190
322 3300005518 Ga0070699_100523406 Ga0070699_1005234061 190
323 3300005543 Ga0070672_100708272 Ga0070672_1007082722 190
324 3300005577 Ga0068857_100657443 Ga0068857_1006574432 190
325 3300005577 Ga0068857_100765852 Ga0068857_1007658522 190
326 3300005578 Ga0068854_101173524 Ga0068854_1011735241 190
327 3300005719 Ga0068861_100627873 Ga0068861_1006278731 190
328 3300005841 Ga0068863_100275059 Ga0068863_1002750591 190
329 3300005841 Ga0068863_101181199 Ga0068863_1011811992 190
330 3300005842 Ga0068858_100506275 Ga0068858_1005062752 190
331 3300005844 Ga0068862_100915424 Ga0068862_1009154241 190
332 3300006237 Ga0097621_100089273 Ga0097621_1000892734 190
333 3300006358 Ga0068871_100016186 Ga0068871_1000161863 190
334 3300006844 Ga0075428_100161523 Ga0075428_1001615232 190
335 3300006844 Ga0075428_100343966 Ga0075428_1003439662 190
336 3300009176 Ga0105242_10018172 Ga0105242_100181724 190
337 3300009176 Ga0105242_10042515 Ga0105242_100425154 190
338 3300009553 Ga0105249_11642568 Ga0105249_116425681 190
339 3300013102 Ga0157371_10129171 Ga0157371_101291713 190
340 3300013104 Ga0157370_10196443 Ga0157370_101964431 190
341 3300013306 Ga0163162_10208892 Ga0163162_102088923 190
342 3300013307 Ga0157372_10068589 Ga0157372_100685894 190
343 3300013308 Ga0157375_10272248 Ga0157375_102722482 190
344 3300013308 Ga0157375_10532406 Ga0157375_105324062 190
345 3300013308 Ga0157375_10656364 Ga0157375_106563642 190
346 3300014326 Ga0157380_10046574 Ga0157380_100465744 190
347 3300014326 Ga0157380_10094716 Ga0157380_100947165 190
348 3300014745 Ga0157377_10013400 Ga0157377_100134006 190
349 3300014968 Ga0157379_10388573 Ga0157379_103885732 190
350 3300014969 Ga0157376_10118606 Ga0157376_101186063 190
351 3300014969 Ga0157376_10370594 Ga0157376_103705942 190
352 3300025893 Ga0207682_10022276 Ga0207682_100222762 190
353 3300025908 Ga0207643_10005011 Ga0207643_100050111 190
354 3300025908 Ga0207643_10179550 Ga0207643_101795502 190
355 3300025918 Ga0207662_10498596 Ga0207662_104985961 190
356 3300025922 Ga0207646_10330980 Ga0207646_103309801 190
357 3300025925 Ga0207650_10004553 Ga0207650_100045539 190
358 3300025934 Ga0207686_10001012 Ga0207686_100010126 190
359 3300025936 Ga0207670_10006100 Ga0207670_100061007 190
360 3300025940 Ga0207691_10030866 Ga0207691_100308662 190
361 3300025960 Ga0207651_10127269 Ga0207651_101272692 190
362 3300026088 Ga0207641_10007368 Ga0207641_100073682 190
363 3300026089 Ga0207648_10138676 Ga0207648_101386763 190
364 3300026116 Ga0207674_10286004 Ga0207674_102860042 190
365 3300026116 Ga0207674_10608308 Ga0207674_106083081 190
366 3300026118 Ga0207675_100111612 Ga0207675_1001116122 190
367 3300036401 Ga0373937_0194706 Ga0373937_0194706_510_1109 190
368 3300046525 Ga0495663_0072126 Ga0495663_0072126_428_1018 190
369 3300046537 Ga0495598_0126630 Ga0495598_0126630_163_762 190
370 3300050511 nmdc:mga08y16_339051_c1 nmdc:mga08y16_339051_c1_37_627 190
371 3300005985 Ga0081539_10017620 Ga0081539_100176207 191
372 3300026121 Ga0207683_11290434 Ga0207683_112904341 191
373 3300006358 Ga0068871_100404151 Ga0068871_1004041512 192
374 3300014968 Ga0157379_10832884 Ga0157379_108328841 192
375 3300025981 Ga0207640_10791583 Ga0207640_107915831 192
376 3300005459 Ga0068867_100389079 Ga0068867_1003890792 193
377 3300026089 Ga0207648_10439256 Ga0207648_104392562 193
378 3300003203 JGI25406J46586_10018804 JGI25406J46586_100188042 195
379 3300005985 Ga0081539_10000042 Ga0081539_10000042149 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13521

AAA_28

AAA domain

41

210

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lw7-assembly1.cif.gz_A nadr protein from haemophilus influenzae 0.7968 3 187
6gye-assembly1.cif.gz_A crystal structure of nadr protein in complex with nr 0.7556 3 190
6b9d-assembly1.cif.gz_A human atl1 mutant - r77a bound to gdp 0.7528 3 32
3hjn-assembly1.cif.gz_A crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.7505 10 189
1e9d-assembly1.cif.gz_A mutant human thymidylate kinase (f105y) complexed with aztmp and adp 0.7386 5 194
ID Description Score Start End Superfamily
af_P96394_152_310_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8898 8 181 3.40.50.300
af_P96394_152_310_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8739 8 181 3.40.50.300
af_Q55C83_3_170_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8553 8 182 3.40.50.300
af_Q55C83_3_170_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.841 8 182 3.40.50.300
1lw7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8197 8 183 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9M101-F1-model_v4 AAA family ATPase 0.9863 99 189
AF-A0A7G5XGY8-F1-model_v4 ATP-binding protein 0.9806 5 191 GO:0005524
AF-A0A327PSS2-F1-model_v4 NadR type nicotinamide-nucleotide adenylyltransferase 0.9752 8 185 GO:0016779
AF-A0A0E9MWX0-F1-model_v4 NadR/Ttd14 AAA domain-containing protein 0.9742 7 190
AF-A0A2M8CIW3-F1-model_v4 ATPase 0.9709 7 189

Feature Viewer

pLDDT pTM Quality
92.43 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map