F428248

General Info

Members Datasets Scaffolds Average Seq Length
379 178 378 185

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100757645|Ga0070670_1007576452
Length 194
Sequence MITRIREVRRARRMTLQDVADRCAPPTTPQTIGRLETGARTVSVGWLNRIAGALGVEAADLVSLPEREVIPVAATLDHEGAHAPRRDLVVIPPQSAPDLMAMTVFSGIGEYRSGDEIWLQRLEPEAFAGALNRDVLVPRPAGRFLFGRLIGREVPASGQAGGKLHLLPFGAGQRQTVVTDPPWAAMAVKLIRSL

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
127 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
165 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
168 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
169 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
170 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
171 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
172 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
173 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
178 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.26
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 2.9
Rhizosphere 95.25
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_944306 2162886011 Bacteria 1505
2 JGI24748J21848_1008133 3300002074 Bacteria 1232
3 Ga0065712_10083946 3300005290 Bacteria 2799
4 Ga0065715_10006784 3300005293 Bacteria 2990
5 Ga0065715_10023951 3300005293 Bacteria 2115
6 Ga0070676_10028885 3300005328 Bacteria 3151
7 Ga0070690_100379329 3300005330 Bacteria 1033
8 Ga0070670_100000388 3300005331 Bacteria 36452
9 Ga0070670_100010837 3300005331 Bacteria 7787
10 Ga0070670_100052674 3300005331 Bacteria 3494
11 Ga0070670_100757645 3300005331 Bacteria 875
12 Ga0070677_10008070 3300005333 Bacteria 3531
13 Ga0070666_10018963 3300005335 Bacteria 4433
14 Ga0070666_10312953 3300005335 Bacteria 1119
15 Ga0070660_100001015 3300005339 Bacteria 18888
16 Ga0070668_100065784 3300005347 Bacteria 2812
17 Ga0070668_100068585 3300005347 Bacteria 2757
18 Ga0070668_100323187 3300005347 Unclassified 1299
19 Ga0070668_100692532 3300005347 Bacteria 898
20 Ga0070668_100919223 3300005347 Unclassified 783
21 Ga0070669_100074161 3300005353 Bacteria 2522
22 Ga0070669_100814259 3300005353 Bacteria 794
23 Ga0070675_100003957 3300005354 Bacteria 11235
24 Ga0070675_100006462 3300005354 Bacteria 8999
25 Ga0070675_100701429 3300005354 Bacteria 922
26 Ga0070671_100000659 3300005355 Bacteria 24798
27 Ga0070671_100027792 3300005355 Bacteria 4657
28 Ga0070671_100345213 3300005355 Bacteria 1270
29 Ga0070674_100165442 3300005356 Bacteria 1682
30 Ga0070673_100150402 3300005364 Bacteria 1971
31 Ga0070673_101028233 3300005364 Bacteria 768
32 Ga0070673_101317658 3300005364 Archaea 678
33 Ga0070659_100000011 3300005366 Bacteria 185903
34 Ga0070667_100025265 3300005367 Bacteria 4938
35 Ga0070667_100039158 3300005367 Bacteria 3973
36 Ga0070701_10154909 3300005438 Bacteria 1323
37 Ga0070663_100089777 3300005455 Bacteria 2275
38 Ga0070678_100012935 3300005456 Bacteria 5211
39 Ga0070662_100006784 3300005457 Bacteria 7403
40 Ga0070662_100018759 3300005457 Bacteria 4684
41 Ga0070681_10063043 3300005458 Bacteria 3679
42 Ga0068867_100052356 3300005459 Bacteria 3013
43 Ga0070684_100087485 3300005535 Bacteria 2767
44 Ga0068853_100073961 3300005539 Bacteria 2972
45 Ga0070672_100020387 3300005543 Bacteria 4834
46 Ga0070672_100751165 3300005543 Bacteria 856
47 Ga0070686_100000284 3300005544 Bacteria 34135
48 Ga0070695_100277857 3300005545 Bacteria 1229
49 Ga0070693_100100560 3300005547 Bacteria 1761
50 Ga0070665_100000972 3300005548 Bacteria 36392
51 Ga0070665_100202950 3300005548 Bacteria 1983
52 Ga0070664_100001431 3300005564 Bacteria 19035
53 Ga0068857_100145608 3300005577 Bacteria 2144
54 Ga0068852_100236527 3300005616 Bacteria 1744
55 Ga0068852_101656703 3300005616 Bacteria 662
56 Ga0068859_100046919 3300005617 Bacteria 4338
57 Ga0068864_100034547 3300005618 Bacteria 4301
58 Ga0068864_100087632 3300005618 Bacteria 2741
59 Ga0068861_100201777 3300005719 Bacteria 1670
60 Ga0068861_100548083 3300005719 Bacteria 1053
61 Ga0068861_101027746 3300005719 Bacteria 788
62 Ga0068870_10592133 3300005840 Bacteria 752
63 Ga0068863_100119032 3300005841 Bacteria 2517
64 Ga0068858_100910298 3300005842 Bacteria 860
65 Ga0068860_100164863 3300005843 Bacteria 2139
66 Ga0068860_100995405 3300005843 Bacteria 856
67 Ga0068862_100038877 3300005844 Bacteria 4038
68 Ga0068862_100088461 3300005844 Bacteria 2695
69 Ga0068862_100571485 3300005844 Bacteria 1082
70 Ga0068862_100595086 3300005844 Bacteria 1061
71 Ga0081539_10040142 3300005985 Bacteria 2751
72 Ga0075431_100008388 3300006847 Bacteria 10339
73 Ga0075434_100710119 3300006871 Bacteria 1023
74 Ga0097620_100046919 3300006931 Bacteria 4338
75 Ga0111539_10112916 3300009094 Bacteria 3187
76 Ga0105245_10785292 3300009098 Bacteria 990
77 Ga0105243_11334102 3300009148 Bacteria 736
78 Ga0105248_10031149 3300009177 Bacteria 5961
79 Ga0105238_10114503 3300009551 Bacteria 2676
80 Ga0105249_10031098 3300009553 Bacteria 4826
81 Ga0105249_10467391 3300009553 Bacteria 1302
82 Ga0157373_10448329 3300013100 Bacteria 928
83 Ga0157371_10336651 3300013102 Bacteria 1097
84 Ga0157371_10394988 3300013102 Bacteria 1011
85 Ga0163162_10171368 3300013306 Bacteria 2295
86 Ga0163162_11829510 3300013306 Bacteria 694
87 Ga0157375_10030774 3300013308 Bacteria 5066
88 Ga0157375_10420621 3300013308 Bacteria 1502
89 Ga0163163_10114499 3300014325 Bacteria 2728
90 Ga0157380_10043971 3300014326 Bacteria 3498
91 Ga0157380_10154691 3300014326 Bacteria 1986
92 Ga0157380_10217314 3300014326 Bacteria 1708
93 Ga0163161_10176575 3300017792 Bacteria 1635
94 Ga0206356_11320069 3300020070 Bacteria 1838
95 Ga0213876_10015582 3300021384 Bacteria 4022
96 Ga0207697_10002366 3300025315 Bacteria 9823
97 Ga0207682_10157621 3300025893 Bacteria 1027
98 Ga0207688_10047526 3300025901 Bacteria 2396
99 Ga0207680_10173820 3300025903 Bacteria 1452
100 Ga0207645_10059139 3300025907 Bacteria 2447
101 Ga0207645_10189152 3300025907 Bacteria 1352
102 Ga0207705_10051674 3300025909 Bacteria 2958
103 Ga0207657_10001539 3300025919 Bacteria 24700
104 Ga0207649_10013333 3300025920 Bacteria 4586
105 Ga0207681_10013819 3300025923 Bacteria 5002
106 Ga0207681_10020849 3300025923 Bacteria 4159
107 Ga0207681_10786532 3300025923 Bacteria 794
108 Ga0207694_10202239 3300025924 Bacteria 1616
109 Ga0207650_10007222 3300025925 Bacteria 7570
110 Ga0207650_10014922 3300025925 Bacteria 5405
111 Ga0207650_10015744 3300025925 Bacteria 5272
112 Ga0207650_10231482 3300025925 Bacteria 1491
113 Ga0207650_10638018 3300025925 Bacteria 897
114 Ga0207659_10036179 3300025926 Bacteria 3418
115 Ga0207659_10575797 3300025926 Bacteria 958
116 Ga0207644_10008210 3300025931 Bacteria 6838
117 Ga0207644_10219512 3300025931 Bacteria 1506
118 Ga0207690_10000005 3300025932 Bacteria 581199
119 Ga0207706_10002348 3300025933 Bacteria 18484
120 Ga0207706_10015283 3300025933 Bacteria 6942
121 Ga0207706_10726603 3300025933 Bacteria 847
122 Ga0207669_10023963 3300025937 Bacteria 3272
123 Ga0207691_10003436 3300025940 Bacteria 15408
124 Ga0207691_10010358 3300025940 Bacteria 8942
125 Ga0207689_10388753 3300025942 Bacteria 1162
126 Ga0207661_10139705 3300025944 Bacteria 2084
127 Ga0207679_10044308 3300025945 Bacteria 3209
128 Ga0207651_10008872 3300025960 Bacteria 5460
129 Ga0207651_10780725 3300025960 Bacteria 846
130 Ga0207712_10077782 3300025961 Bacteria 2406
131 Ga0207712_10210175 3300025961 Bacteria 1549
132 Ga0207712_10506824 3300025961 Bacteria 1032
133 Ga0207668_10056468 3300025972 Bacteria 2734
134 Ga0207668_10223220 3300025972 Bacteria 1514
135 Ga0207668_10825146 3300025972 Unclassified 822
136 Ga0207658_10108479 3300025986 Bacteria 2190
137 Ga0207677_10000150 3300026023 Bacteria 55710
138 Ga0207703_10691731 3300026035 Bacteria 969
139 Ga0207639_10610989 3300026041 Bacteria 1006
140 Ga0207639_10908198 3300026041 Bacteria 823
141 Ga0207678_10111744 3300026067 Bacteria 2331
142 Ga0207708_10029953 3300026075 Bacteria 4127
143 Ga0207702_11235923 3300026078 Bacteria 741
144 Ga0207641_10120334 3300026088 Bacteria 2342
145 Ga0207648_10069348 3300026089 Bacteria 3072
146 Ga0207676_10078243 3300026095 Bacteria 2678
147 Ga0207676_10606082 3300026095 Bacteria 1052
148 Ga0207676_11211105 3300026095 Bacteria 748
149 Ga0207674_10973176 3300026116 Bacteria 817
150 Ga0207675_100014477 3300026118 Bacteria 7353
151 Ga0207675_100441034 3300026118 Bacteria 1289
152 Ga0207675_101699327 3300026118 Bacteria 651
153 Ga0207683_10002608 3300026121 Bacteria 15739
154 Ga0207698_10785444 3300026142 Bacteria 953
155 Ga0209974_10025747 3300027876 Bacteria 1947
156 Ga0209974_10050036 3300027876 Bacteria 1403
157 Ga0268266_10000566 3300028379 Bacteria 51401
158 Ga0268266_10163481 3300028379 Bacteria 2015
159 Ga0268265_10071645 3300028380 Bacteria 2700
160 Ga0268265_10367950 3300028380 Bacteria 1318
161 Ga0268264_10011026 3300028381 Bacteria 7461
162 Ga0268264_10557263 3300028381 Bacteria 1125
163 Ga0316182_1084298 3300030745 Bacteria 1617
164 Ga0307513_10527064 3300031456 Bacteria 896
165 Ga0307408_100016105 3300031548 Bacteria 4985
166 Ga0307408_100428676 3300031548 Bacteria 1142
167 Ga0307408_101183973 3300031548 Bacteria 712
168 Ga0307405_10006669 3300031731 Bacteria 5700
169 Ga0307405_10045320 3300031731 Bacteria 2694
170 Ga0307405_10063381 3300031731 Bacteria 2344
171 Ga0307405_10063983 3300031731 Bacteria 2335
172 Ga0307405_10066897 3300031731 Bacteria 2293
173 Ga0307405_10082819 3300031731 Bacteria 2101
174 Ga0307405_10187346 3300031731 Bacteria 1491
175 Ga0307405_10230278 3300031731 Bacteria 1366
176 Ga0307405_10263110 3300031731 Bacteria 1289
177 Ga0307405_10278309 3300031731 Bacteria 1258
178 Ga0307405_10334089 3300031731 Bacteria 1162
179 Ga0307405_10379219 3300031731 Bacteria 1100
180 Ga0307405_10540967 3300031731 Bacteria 941
181 Ga0307405_10589549 3300031731 Bacteria 905
182 Ga0307413_10012882 3300031824 Bacteria 4179
183 Ga0307413_10022026 3300031824 Bacteria 3424
184 Ga0307413_10070498 3300031824 Bacteria 2198
185 Ga0307413_10080354 3300031824 Bacteria 2087
186 Ga0307413_10089482 3300031824 Bacteria 2000
187 Ga0307413_10090606 3300031824 Bacteria 1990
188 Ga0307413_10110956 3300031824 Bacteria 1836
189 Ga0307413_10152555 3300031824 Bacteria 1612
190 Ga0307413_10362597 3300031824 Bacteria 1122
191 Ga0307413_10509365 3300031824 Bacteria 968
192 Ga0307413_10583649 3300031824 Bacteria 912
193 Ga0307413_11508078 3300031824 Bacteria 594
194 Ga0307410_10003328 3300031852 Bacteria 8040
195 Ga0307410_10004580 3300031852 Bacteria 7171
196 Ga0307410_10004647 3300031852 Bacteria 7132
197 Ga0307410_10067200 3300031852 Bacteria 2472
198 Ga0307410_10165703 3300031852 Bacteria 1660
199 Ga0307410_10180334 3300031852 Bacteria 1598
200 Ga0307410_10257602 3300031852 Bacteria 1359
201 Ga0307410_10263703 3300031852 Bacteria 1344
202 Ga0307410_10278542 3300031852 Bacteria 1311
203 Ga0307410_10318511 3300031852 Bacteria 1233
204 Ga0307410_10333757 3300031852 Bacteria 1206
205 Ga0307410_10510422 3300031852 Bacteria 990
206 Ga0307406_10010296 3300031901 Bacteria 5270
207 Ga0307406_10023956 3300031901 Bacteria 3640
208 Ga0307406_10136365 3300031901 Bacteria 1730
209 Ga0307406_10161079 3300031901 Bacteria 1613
210 Ga0307406_10299782 3300031901 Bacteria 1234
211 Ga0307406_10318167 3300031901 Bacteria 1202
212 Ga0307407_10011890 3300031903 Bacteria 4163
213 Ga0307407_10014559 3300031903 Bacteria 3857
214 Ga0307407_10028898 3300031903 Bacteria 2970
215 Ga0307407_10029411 3300031903 Bacteria 2950
216 Ga0307407_10192986 3300031903 Bacteria 1359
217 Ga0307407_10284576 3300031903 Bacteria 1146
218 Ga0307407_10300392 3300031903 Bacteria 1119
219 Ga0307407_10484625 3300031903 Bacteria 904
220 Ga0307412_10013691 3300031911 Bacteria 4764
221 Ga0307412_10034254 3300031911 Bacteria 3235
222 Ga0307412_10053086 3300031911 Bacteria 2686
223 Ga0307412_10118152 3300031911 Bacteria 1904
224 Ga0307412_10118742 3300031911 Bacteria 1900
225 Ga0307412_10125695 3300031911 Bacteria 1854
226 Ga0307412_10225929 3300031911 Bacteria 1438
227 Ga0307412_10238586 3300031911 Bacteria 1405
228 Ga0307412_10312680 3300031911 Bacteria 1246
229 Ga0307412_10509262 3300031911 Bacteria 1003
230 Ga0307412_11015820 3300031911 Bacteria 733
231 Ga0307409_100007650 3300031995 Bacteria 6483
232 Ga0307409_100021481 3300031995 Bacteria 4426
233 Ga0307409_100028521 3300031995 Bacteria 3979
234 Ga0307409_100058835 3300031995 Bacteria 2987
235 Ga0307409_100135693 3300031995 Bacteria 2111
236 Ga0307409_100161254 3300031995 Bacteria 1961
237 Ga0307409_100177324 3300031995 Bacteria 1883
238 Ga0307409_100189349 3300031995 Bacteria 1830
239 Ga0307409_100218987 3300031995 Bacteria 1717
240 Ga0307409_100277269 3300031995 Bacteria 1547
241 Ga0307409_100280433 3300031995 Bacteria 1540
242 Ga0307409_100656245 3300031995 Bacteria 1043
243 Ga0307409_101280236 3300031995 Bacteria 758
244 Ga0307409_101498804 3300031995 Bacteria 702
245 Ga0307416_100084990 3300032002 Bacteria 2691
246 Ga0307416_100092216 3300032002 Bacteria 2604
247 Ga0307416_100107016 3300032002 Bacteria 2453
248 Ga0307416_100114612 3300032002 Bacteria 2385
249 Ga0307416_100120253 3300032002 Bacteria 2338
250 Ga0307416_100138287 3300032002 Bacteria 2208
251 Ga0307416_100251104 3300032002 Bacteria 1721
252 Ga0307416_100346162 3300032002 Bacteria 1502
253 Ga0307416_100660823 3300032002 Bacteria 1131
254 Ga0307416_101265986 3300032002 Bacteria 843
255 Ga0307416_101807559 3300032002 Bacteria 715
256 Ga0307414_10027581 3300032004 Bacteria 3672
257 Ga0307414_10034187 3300032004 Bacteria 3367
258 Ga0307414_10069791 3300032004 Bacteria 2528
259 Ga0307414_10076742 3300032004 Bacteria 2429
260 Ga0307414_10192811 3300032004 Bacteria 1650
261 Ga0307414_10235073 3300032004 Bacteria 1513
262 Ga0307414_10239739 3300032004 Bacteria 1500
263 Ga0307414_10340613 3300032004 Bacteria 1283
264 Ga0307414_10361288 3300032004 Bacteria 1249
265 Ga0307414_10629175 3300032004 Bacteria 965
266 Ga0307414_10722137 3300032004 Bacteria 903
267 Ga0307414_11369329 3300032004 Bacteria 657
268 Ga0307411_10006255 3300032005 Bacteria 5939
269 Ga0307411_10014337 3300032005 Bacteria 4406
270 Ga0307411_10019890 3300032005 Bacteria 3889
271 Ga0307411_10027966 3300032005 Bacteria 3421
272 Ga0307411_10033830 3300032005 Bacteria 3174
273 Ga0307411_10117057 3300032005 Bacteria 1919
274 Ga0307411_10155047 3300032005 Bacteria 1707
275 Ga0307411_10156300 3300032005 Bacteria 1702
276 Ga0307411_10211512 3300032005 Bacteria 1498
277 Ga0307411_10276068 3300032005 Bacteria 1335
278 Ga0307411_10302578 3300032005 Bacteria 1283
279 Ga0307411_10563966 3300032005 Bacteria 973
280 Ga0307411_10747207 3300032005 Bacteria 856
281 Ga0307415_100004020 3300032126 Bacteria 7579
282 Ga0307415_100025857 3300032126 Bacteria 3693
283 Ga0307415_100042116 3300032126 Bacteria 3037
284 Ga0307415_100074557 3300032126 Bacteria 2398
285 Ga0307415_100093089 3300032126 Bacteria 2187
286 Ga0307415_100112740 3300032126 Bacteria 2021
287 Ga0307415_100125720 3300032126 Bacteria 1932
288 Ga0307415_100206084 3300032126 Bacteria 1564
289 Ga0307415_100349597 3300032126 Bacteria 1244
290 Ga0307415_100590759 3300032126 Bacteria 986
291 Ga0307415_101052290 3300032126 Bacteria 759
292 Ga0395899_0067455 3300037312 Bacteria 2625
293 Ga0395899_0079021 3300037312 Bacteria 2397
294 Ga0395900_0000325 3300037418 Bacteria 70579
295 Ga0395900_0171241 3300037418 Bacteria 2210
296 Ga0395898_0173386 3300037466 Bacteria 2062
297 Ga0395898_0182736 3300037466 Bacteria 2004
298 Ga0395905_0000218 3300037471 Bacteria 87745
299 Ga0395901_0003360 3300038443 Bacteria 16117
300 Ga0395901_0363889 3300038443 Bacteria 1491
301 Ga0436365_0883240 3300039437 Bacteria 13839
302 Ga0436363_0790267 3300039450 Bacteria 829
303 Ga0439465_0073878 3300041413 Bacteria 1147
304 Ga0451853_1796508 3300041512 Bacteria 596
305 Ga0439443_006536 3300042003 Bacteria 1596
306 Ga0439445_0004604 3300042004 Bacteria 3125
307 Ga0439432_074778 3300042006 Bacteria 1030
308 Ga0450890_028776 3300042127 Bacteria 783
309 Ga0439464_0062830 3300042439 Unclassified 1089
310 Ga0439464_0157983 3300042439 Bacteria 711
311 Ga0439460_0158225 3300042461 Bacteria 758
312 Ga0451577_0852751 3300042876 Bacteria 822
313 Ga0466970_0144230 3300044765 Unclassified 1313
314 Ga0466960_0291921 3300044901 Unclassified 917
315 Ga0466967_0414556 3300045976 Bacteria 1312
316 Ga0466967_0424344 3300045976 Bacteria 1297
317 Ga0495585_0144732 3300046492 Bacteria 1243
318 Ga0495585_0161460 3300046492 Bacteria 1162
319 Ga0495616_0000187 3300046513 Bacteria 51726
320 Ga0495620_0287982 3300046515 Bacteria 625
321 Ga0495631_0324497 3300046518 Bacteria 655
322 Ga0495663_0000513 3300046525 Bacteria 13953
323 Ga0495663_0003464 3300046525 Bacteria 4544
324 Ga0495663_0003635 3300046525 Bacteria 4420
325 Ga0495598_0000433 3300046537 Bacteria 7572
326 Ga0495598_0003297 3300046537 Bacteria 3414
327 Ga0495621_0000667 3300046539 Bacteria 8688
328 Ga0495621_0005252 3300046539 Bacteria 3709
329 Ga0495621_0017588 3300046539 Bacteria 2312
330 Ga0495621_0041837 3300046539 Bacteria 1610
331 Ga0495633_0003085 3300046558 Bacteria 11332
332 Ga0495633_0058673 3300046558 Bacteria 1806
333 Ga0495656_0268701 3300046615 Bacteria 866
334 Ga0495668_0197938 3300046616 Bacteria 1100
335 Ga0495668_0232080 3300046616 Bacteria 1010
336 Ga0495625_0055469 3300046660 Bacteria 2826
337 Ga0495659_0090185 3300046664 Bacteria 1176
338 Ga0495659_0104880 3300046664 Bacteria 1098
339 Ga0495659_0128055 3300046664 Bacteria 1005
340 Ga0495670_0004696 3300046691 Bacteria 6704
341 Ga0495670_0006682 3300046691 Bacteria 5672
342 Ga0495670_0008427 3300046691 Bacteria 5069
343 Ga0495670_0016095 3300046691 Bacteria 3677
344 Ga0495670_0025132 3300046691 Bacteria 2946
345 Ga0495670_0050037 3300046691 Bacteria 2091
346 Ga0495670_0157208 3300046691 Bacteria 1193
347 Ga0495677_0011591 3300047445 Bacteria 3223
348 Ga0495685_098251 3300047447 Bacteria 967
349 Ga0495615_0016857 3300048090 Bacteria 1583
350 Ga0496102_0509036 3300048905 Bacteria 1126
351 Ga0496106_0930844 3300048909 Bacteria 685
352 Ga0496107_0311212 3300048910 Bacteria 1172
353 Ga0496108_1219424 3300048911 Bacteria 635
354 Ga0496109_0062250 3300048912 Bacteria 3412
355 Ga0496109_0438934 3300048912 Bacteria 1233
356 Ga0496109_1331451 3300048912 Bacteria 654
357 Ga0496110_0019643 3300048913 Bacteria 5691
358 Ga0496111_0020013 3300048914 Bacteria 4656
359 Ga0496113_0680017 3300048916 Bacteria 822
360 Ga0496114_0258685 3300048917 Bacteria 1532
361 Ga0501292_000020 3300049515 Bacteria 54099
362 Ga0501032_0660713 3300049569 Bacteria 664
363 Ga0501069_0038718 3300049585 Bacteria 2632
364 Ga0501223_001203 3300049663 Bacteria 6067
365 Ga0501224_000429 3300049664 Bacteria 5033
366 Ga0501235_006285 3300049669 Bacteria 2586
367 Ga0501235_090056 3300049669 Bacteria 740
368 Ga0501257_109172 3300049686 Bacteria 732
369 Ga0501245_000754 3300049708 Bacteria 4021
370 Ga0501270_054021 3300049767 Bacteria 735
371 Ga0501273_008084 3300049770 Bacteria 1252
372 Ga0501279_000022 3300049775 Bacteria 54370
373 Ga0501280_000035 3300049776 Bacteria 40433
374 Ga0501281_00319 3300049777 Bacteria 4929
375 nmdc:mga06r32_10044_c1 3300050510 Bacteria 8544
376 nmdc:mga08y16_352194_c1 3300050511 Bacteria 1512
377 Ga0500604_0001460 3300053151 Bacteria 6593
378 Ga0500627_0011055 3300053158 Bacteria 3315

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046525 Ga0495663_0003464 Ga0495663_0003464_801_1364 150
2 3300046539 Ga0495621_0005252 Ga0495621_0005252_588_1151 150
3 3300046691 Ga0495670_0008427 Ga0495670_0008427_3443_4006 150
4 3300047447 Ga0495685_098251 Ga0495685_098251_81_644 150
5 3300047445 Ga0495677_0011591 Ga0495677_0011591_35_598 151
6 3300048090 Ga0495615_0016857 Ga0495615_0016857_43_606 151
7 3300046691 Ga0495670_0025132 Ga0495670_0025132_829_1392 152
8 3300041512 Ga0451853_1796508 Ga0451853_1796508_66_551 153
9 3300031995 Ga0307409_100189349 Ga0307409_1001893492 162
10 3300032005 Ga0307411_10276068 Ga0307411_102760681 162
11 3300002074 JGI24748J21848_1008133 JGI24748J21848_10081331 174
12 3300005293 Ga0065715_10006784 Ga0065715_100067842 174
13 3300005293 Ga0065715_10023951 Ga0065715_100239513 174
14 3300005328 Ga0070676_10028885 Ga0070676_100288853 174
15 3300005330 Ga0070690_100379329 Ga0070690_1003793291 174
16 3300005331 Ga0070670_100010837 Ga0070670_1000108372 174
17 3300005331 Ga0070670_100052674 Ga0070670_1000526741 174
18 3300005331 Ga0070670_100757645 Ga0070670_1007576452 174
19 3300005333 Ga0070677_10008070 Ga0070677_100080702 174
20 3300005335 Ga0070666_10312953 Ga0070666_103129532 174
21 3300005339 Ga0070660_100001015 Ga0070660_10000101520 174
22 3300005347 Ga0070668_100065784 Ga0070668_1000657844 174
23 3300005347 Ga0070668_100068585 Ga0070668_1000685854 174
24 3300005347 Ga0070668_100323187 Ga0070668_1003231872 174
25 3300005347 Ga0070668_100692532 Ga0070668_1006925322 174
26 3300005347 Ga0070668_100919223 Ga0070668_1009192231 174
27 3300005353 Ga0070669_100074161 Ga0070669_1000741611 174
28 3300005353 Ga0070669_100814259 Ga0070669_1008142591 174
29 3300005354 Ga0070675_100006462 Ga0070675_1000064623 174
30 3300005354 Ga0070675_100701429 Ga0070675_1007014292 174
31 3300005355 Ga0070671_100027792 Ga0070671_1000277924 174
32 3300005355 Ga0070671_100345213 Ga0070671_1003452131 174
33 3300005356 Ga0070674_100165442 Ga0070674_1001654423 174
34 3300005364 Ga0070673_100150402 Ga0070673_1001504023 174
35 3300005364 Ga0070673_101028233 Ga0070673_1010282332 174
36 3300005366 Ga0070659_100000011 Ga0070659_100000011109 174
37 3300005367 Ga0070667_100039158 Ga0070667_1000391585 174
38 3300005438 Ga0070701_10154909 Ga0070701_101549092 174
39 3300005455 Ga0070663_100089777 Ga0070663_1000897774 174
40 3300005456 Ga0070678_100012935 Ga0070678_1000129353 174
41 3300005457 Ga0070662_100006784 Ga0070662_1000067849 174
42 3300005458 Ga0070681_10063043 Ga0070681_100630437 174
43 3300005459 Ga0068867_100052356 Ga0068867_1000523563 174
44 3300005535 Ga0070684_100087485 Ga0070684_1000874854 174
45 3300005539 Ga0068853_100073961 Ga0068853_1000739611 174
46 3300005543 Ga0070672_100020387 Ga0070672_1000203877 174
47 3300005543 Ga0070672_100751165 Ga0070672_1007511651 174
48 3300005544 Ga0070686_100000284 Ga0070686_10000028429 174
49 3300005545 Ga0070695_100277857 Ga0070695_1002778572 174
50 3300005547 Ga0070693_100100560 Ga0070693_1001005601 174
51 3300005548 Ga0070665_100000972 Ga0070665_10000097218 174
52 3300005577 Ga0068857_100145608 Ga0068857_1001456082 174
53 3300005616 Ga0068852_100236527 Ga0068852_1002365272 174
54 3300005616 Ga0068852_101656703 Ga0068852_1016567031 174
55 3300005617 Ga0068859_100046919 Ga0068859_1000469197 174
56 3300005618 Ga0068864_100087632 Ga0068864_1000876323 174
57 3300005719 Ga0068861_100201777 Ga0068861_1002017772 174
58 3300005719 Ga0068861_100548083 Ga0068861_1005480832 174
59 3300005719 Ga0068861_101027746 Ga0068861_1010277461 174
60 3300005842 Ga0068858_100910298 Ga0068858_1009102981 174
61 3300005843 Ga0068860_100164863 Ga0068860_1001648632 174
62 3300005843 Ga0068860_100995405 Ga0068860_1009954052 174
63 3300005844 Ga0068862_100038877 Ga0068862_1000388775 174
64 3300005844 Ga0068862_100088461 Ga0068862_1000884612 174
65 3300005844 Ga0068862_100571485 Ga0068862_1005714851 174
66 3300005844 Ga0068862_100595086 Ga0068862_1005950862 174
67 3300005985 Ga0081539_10040142 Ga0081539_100401422 174
68 3300006847 Ga0075431_100008388 Ga0075431_10000838810 174
69 3300006871 Ga0075434_100710119 Ga0075434_1007101191 174
70 3300006931 Ga0097620_100046919 Ga0097620_1000469197 174
71 3300009094 Ga0111539_10112916 Ga0111539_101129164 174
72 3300009098 Ga0105245_10785292 Ga0105245_107852922 174
73 3300009148 Ga0105243_11334102 Ga0105243_113341021 174
74 3300009551 Ga0105238_10114503 Ga0105238_101145032 174
75 3300009553 Ga0105249_10031098 Ga0105249_100310982 174
76 3300009553 Ga0105249_10467391 Ga0105249_104673912 174
77 3300013100 Ga0157373_10448329 Ga0157373_104483291 174
78 3300013102 Ga0157371_10336651 Ga0157371_103366511 174
79 3300013306 Ga0163162_11829510 Ga0163162_118295101 174
80 3300013308 Ga0157375_10420621 Ga0157375_104206213 174
81 3300014326 Ga0157380_10043971 Ga0157380_100439715 174
82 3300014326 Ga0157380_10154691 Ga0157380_101546913 174
83 3300014326 Ga0157380_10217314 Ga0157380_102173142 174
84 3300017792 Ga0163161_10176575 Ga0163161_101765753 174
85 3300020070 Ga0206356_11320069 Ga0206356_113200692 174
86 3300021384 Ga0213876_10015582 Ga0213876_100155826 174
87 3300025315 Ga0207697_10002366 Ga0207697_1000236611 174
88 3300025893 Ga0207682_10157621 Ga0207682_101576212 174
89 3300025901 Ga0207688_10047526 Ga0207688_100475262 174
90 3300025903 Ga0207680_10173820 Ga0207680_101738201 174
91 3300025907 Ga0207645_10059139 Ga0207645_100591392 174
92 3300025907 Ga0207645_10189152 Ga0207645_101891522 174
93 3300025919 Ga0207657_10001539 Ga0207657_1000153921 174
94 3300025923 Ga0207681_10020849 Ga0207681_100208494 174
95 3300025923 Ga0207681_10786532 Ga0207681_107865322 174
96 3300025924 Ga0207694_10202239 Ga0207694_102022392 174
97 3300025925 Ga0207650_10007222 Ga0207650_100072224 174
98 3300025925 Ga0207650_10015744 Ga0207650_100157446 174
99 3300025925 Ga0207650_10638018 Ga0207650_106380182 174
100 3300025926 Ga0207659_10036179 Ga0207659_100361793 174
101 3300025926 Ga0207659_10575797 Ga0207659_105757972 174
102 3300025931 Ga0207644_10219512 Ga0207644_102195121 174
103 3300025932 Ga0207690_10000005 Ga0207690_1000000599 174
104 3300025933 Ga0207706_10002348 Ga0207706_100023487 174
105 3300025933 Ga0207706_10726603 Ga0207706_107266032 174
106 3300025937 Ga0207669_10023963 Ga0207669_100239632 174
107 3300025940 Ga0207691_10010358 Ga0207691_100103587 174
108 3300025942 Ga0207689_10388753 Ga0207689_103887532 174
109 3300025944 Ga0207661_10139705 Ga0207661_101397054 174
110 3300025960 Ga0207651_10008872 Ga0207651_100088724 174
111 3300025960 Ga0207651_10780725 Ga0207651_107807251 174
112 3300025961 Ga0207712_10077782 Ga0207712_100777822 174
113 3300025961 Ga0207712_10210175 Ga0207712_102101753 174
114 3300025961 Ga0207712_10506824 Ga0207712_105068242 174
115 3300025972 Ga0207668_10056468 Ga0207668_100564684 174
116 3300025972 Ga0207668_10223220 Ga0207668_102232202 174
117 3300025972 Ga0207668_10825146 Ga0207668_108251461 174
118 3300025986 Ga0207658_10108479 Ga0207658_101084793 174
119 3300026023 Ga0207677_10000150 Ga0207677_100001507 174
120 3300026035 Ga0207703_10691731 Ga0207703_106917312 174
121 3300026041 Ga0207639_10610989 Ga0207639_106109892 174
122 3300026041 Ga0207639_10908198 Ga0207639_109081981 174
123 3300026067 Ga0207678_10111744 Ga0207678_101117442 174
124 3300026075 Ga0207708_10029953 Ga0207708_100299537 174
125 3300026078 Ga0207702_11235923 Ga0207702_112359231 174
126 3300026089 Ga0207648_10069348 Ga0207648_100693485 174
127 3300026095 Ga0207676_10606082 Ga0207676_106060821 174
128 3300026095 Ga0207676_11211105 Ga0207676_112111051 174
129 3300026116 Ga0207674_10973176 Ga0207674_109731761 174
130 3300026118 Ga0207675_100014477 Ga0207675_1000144773 174
131 3300026118 Ga0207675_100441034 Ga0207675_1004410342 174
132 3300026118 Ga0207675_101699327 Ga0207675_1016993271 174
133 3300026121 Ga0207683_10002608 Ga0207683_1000260817 174
134 3300026142 Ga0207698_10785444 Ga0207698_107854442 174
135 3300027876 Ga0209974_10025747 Ga0209974_100257474 174
136 3300027876 Ga0209974_10050036 Ga0209974_100500363 174
137 3300028379 Ga0268266_10000566 Ga0268266_1000056649 174
138 3300028380 Ga0268265_10071645 Ga0268265_100716452 174
139 3300028380 Ga0268265_10367950 Ga0268265_103679502 174
140 3300028381 Ga0268264_10011026 Ga0268264_1001102612 174
141 3300028381 Ga0268264_10557263 Ga0268264_105572631 174
142 3300030745 Ga0316182_1084298 Ga0316182_10842982 174
143 3300031456 Ga0307513_10527064 Ga0307513_105270641 174
144 3300031548 Ga0307408_100016105 Ga0307408_1000161055 174
145 3300031548 Ga0307408_100428676 Ga0307408_1004286762 174
146 3300031731 Ga0307405_10006669 Ga0307405_100066695 174
147 3300031731 Ga0307405_10063381 Ga0307405_100633814 174
148 3300031731 Ga0307405_10063983 Ga0307405_100639832 174
149 3300031731 Ga0307405_10066897 Ga0307405_100668972 174
150 3300031731 Ga0307405_10082819 Ga0307405_100828194 174
151 3300031731 Ga0307405_10187346 Ga0307405_101873462 174
152 3300031731 Ga0307405_10230278 Ga0307405_102302782 174
153 3300031731 Ga0307405_10263110 Ga0307405_102631102 174
154 3300031731 Ga0307405_10278309 Ga0307405_102783092 174
155 3300031731 Ga0307405_10334089 Ga0307405_103340891 174
156 3300031731 Ga0307405_10379219 Ga0307405_103792192 174
157 3300031731 Ga0307405_10540967 Ga0307405_105409672 174
158 3300031731 Ga0307405_10589549 Ga0307405_105895492 174
159 3300031824 Ga0307413_10012882 Ga0307413_100128822 174
160 3300031824 Ga0307413_10022026 Ga0307413_100220262 174
161 3300031824 Ga0307413_10089482 Ga0307413_100894822 174
162 3300031824 Ga0307413_10090606 Ga0307413_100906064 174
163 3300031824 Ga0307413_10110956 Ga0307413_101109562 174
164 3300031824 Ga0307413_10152555 Ga0307413_101525551 174
165 3300031824 Ga0307413_10362597 Ga0307413_103625972 174
166 3300031824 Ga0307413_10509365 Ga0307413_105093651 174
167 3300031824 Ga0307413_10583649 Ga0307413_105836492 174
168 3300031824 Ga0307413_11508078 Ga0307413_115080781 174
169 3300031852 Ga0307410_10003328 Ga0307410_100033288 174
170 3300031852 Ga0307410_10004580 Ga0307410_100045808 174
171 3300031852 Ga0307410_10004647 Ga0307410_100046477 174
172 3300031852 Ga0307410_10165703 Ga0307410_101657034 174
173 3300031852 Ga0307410_10180334 Ga0307410_101803342 174
174 3300031852 Ga0307410_10257602 Ga0307410_102576022 174
175 3300031852 Ga0307410_10263703 Ga0307410_102637032 174
176 3300031852 Ga0307410_10278542 Ga0307410_102785422 174
177 3300031852 Ga0307410_10318511 Ga0307410_103185111 174
178 3300031852 Ga0307410_10333757 Ga0307410_103337571 174
179 3300031852 Ga0307410_10510422 Ga0307410_105104222 174
180 3300031901 Ga0307406_10010296 Ga0307406_100102965 174
181 3300031901 Ga0307406_10023956 Ga0307406_100239563 174
182 3300031901 Ga0307406_10136365 Ga0307406_101363654 174
183 3300031901 Ga0307406_10161079 Ga0307406_101610793 174
184 3300031901 Ga0307406_10299782 Ga0307406_102997822 174
185 3300031901 Ga0307406_10318167 Ga0307406_103181672 174
186 3300031903 Ga0307407_10011890 Ga0307407_100118905 174
187 3300031903 Ga0307407_10014559 Ga0307407_100145597 174
188 3300031903 Ga0307407_10028898 Ga0307407_100288982 174
189 3300031903 Ga0307407_10029411 Ga0307407_100294113 174
190 3300031903 Ga0307407_10192986 Ga0307407_101929862 174
191 3300031903 Ga0307407_10284576 Ga0307407_102845762 174
192 3300031903 Ga0307407_10300392 Ga0307407_103003922 174
193 3300031903 Ga0307407_10484625 Ga0307407_104846252 174
194 3300031911 Ga0307412_10013691 Ga0307412_100136913 174
195 3300031911 Ga0307412_10034254 Ga0307412_100342542 174
196 3300031911 Ga0307412_10053086 Ga0307412_100530862 174
197 3300031911 Ga0307412_10118152 Ga0307412_101181522 174
198 3300031911 Ga0307412_10118742 Ga0307412_101187423 174
199 3300031911 Ga0307412_10125695 Ga0307412_101256954 174
200 3300031911 Ga0307412_10225929 Ga0307412_102259291 174
201 3300031911 Ga0307412_10238586 Ga0307412_102385864 174
202 3300031911 Ga0307412_10312680 Ga0307412_103126801 174
203 3300031911 Ga0307412_10509262 Ga0307412_105092622 174
204 3300031911 Ga0307412_11015820 Ga0307412_110158201 174
205 3300031995 Ga0307409_100007650 Ga0307409_1000076506 174
206 3300031995 Ga0307409_100021481 Ga0307409_1000214815 174
207 3300031995 Ga0307409_100028521 Ga0307409_1000285216 174
208 3300031995 Ga0307409_100058835 Ga0307409_1000588354 174
209 3300031995 Ga0307409_100135693 Ga0307409_1001356932 174
210 3300031995 Ga0307409_100161254 Ga0307409_1001612542 174
211 3300031995 Ga0307409_100177324 Ga0307409_1001773242 174
212 3300031995 Ga0307409_100218987 Ga0307409_1002189874 174
213 3300031995 Ga0307409_100277269 Ga0307409_1002772694 174
214 3300031995 Ga0307409_100280433 Ga0307409_1002804333 174
215 3300031995 Ga0307409_100656245 Ga0307409_1006562452 174
216 3300031995 Ga0307409_101280236 Ga0307409_1012802361 174
217 3300032002 Ga0307416_100084990 Ga0307416_1000849902 174
218 3300032002 Ga0307416_100092216 Ga0307416_1000922165 174
219 3300032002 Ga0307416_100107016 Ga0307416_1001070164 174
220 3300032002 Ga0307416_100114612 Ga0307416_1001146124 174
221 3300032002 Ga0307416_100120253 Ga0307416_1001202533 174
222 3300032002 Ga0307416_100138287 Ga0307416_1001382873 174
223 3300032002 Ga0307416_100251104 Ga0307416_1002511043 174
224 3300032002 Ga0307416_100346162 Ga0307416_1003461623 174
225 3300032002 Ga0307416_100660823 Ga0307416_1006608232 174
226 3300032002 Ga0307416_101265986 Ga0307416_1012659862 174
227 3300032002 Ga0307416_101807559 Ga0307416_1018075592 174
228 3300032004 Ga0307414_10027581 Ga0307414_100275816 174
229 3300032004 Ga0307414_10034187 Ga0307414_100341872 174
230 3300032004 Ga0307414_10069791 Ga0307414_100697912 174
231 3300032004 Ga0307414_10076742 Ga0307414_100767424 174
232 3300032004 Ga0307414_10192811 Ga0307414_101928114 174
233 3300032004 Ga0307414_10235073 Ga0307414_102350732 174
234 3300032004 Ga0307414_10239739 Ga0307414_102397392 174
235 3300032004 Ga0307414_10340613 Ga0307414_103406132 174
236 3300032004 Ga0307414_10361288 Ga0307414_103612882 174
237 3300032004 Ga0307414_10629175 Ga0307414_106291752 174
238 3300032004 Ga0307414_10722137 Ga0307414_107221372 174
239 3300032004 Ga0307414_11369329 Ga0307414_113693291 174
240 3300032005 Ga0307411_10006255 Ga0307411_100062557 174
241 3300032005 Ga0307411_10014337 Ga0307411_100143373 174
242 3300032005 Ga0307411_10019890 Ga0307411_100198906 174
243 3300032005 Ga0307411_10027966 Ga0307411_100279663 174
244 3300032005 Ga0307411_10033830 Ga0307411_100338305 174
245 3300032005 Ga0307411_10117057 Ga0307411_101170573 174
246 3300032005 Ga0307411_10155047 Ga0307411_101550472 174
247 3300032005 Ga0307411_10156300 Ga0307411_101563003 174
248 3300032005 Ga0307411_10211512 Ga0307411_102115121 174
249 3300032005 Ga0307411_10302578 Ga0307411_103025782 174
250 3300032005 Ga0307411_10563966 Ga0307411_105639661 174
251 3300032005 Ga0307411_10747207 Ga0307411_107472071 174
252 3300032126 Ga0307415_100004020 Ga0307415_10000402011 174
253 3300032126 Ga0307415_100025857 Ga0307415_1000258575 174
254 3300032126 Ga0307415_100042116 Ga0307415_1000421165 174
255 3300032126 Ga0307415_100074557 Ga0307415_1000745574 174
256 3300032126 Ga0307415_100093089 Ga0307415_1000930892 174
257 3300032126 Ga0307415_100112740 Ga0307415_1001127402 174
258 3300032126 Ga0307415_100125720 Ga0307415_1001257202 174
259 3300032126 Ga0307415_100206084 Ga0307415_1002060842 174
260 3300032126 Ga0307415_100349597 Ga0307415_1003495971 174
261 3300032126 Ga0307415_100590759 Ga0307415_1005907592 174
262 3300032126 Ga0307415_101052290 Ga0307415_1010522901 174
263 3300037312 Ga0395899_0067455 Ga0395899_0067455_274_837 174
264 3300037312 Ga0395899_0079021 Ga0395899_0079021_842_1405 174
265 3300037418 Ga0395900_0000325 Ga0395900_0000325_33016_33579 174
266 3300037418 Ga0395900_0171241 Ga0395900_0171241_819_1382 174
267 3300037466 Ga0395898_0173386 Ga0395898_0173386_224_787 174
268 3300037466 Ga0395898_0182736 Ga0395898_0182736_436_1002 174
269 3300037471 Ga0395905_0000218 Ga0395905_0000218_77042_77605 174
270 3300038443 Ga0395901_0003360 Ga0395901_0003360_3188_3751 174
271 3300038443 Ga0395901_0363889 Ga0395901_0363889_32_556 174
272 3300039437 Ga0436365_0883240 Ga0436365_0883240_10192_10755 174
273 3300039450 Ga0436363_0790267 Ga0436363_0790267_85_648 174
274 3300041413 Ga0439465_0073878 Ga0439465_0073878_484_1047 174
275 3300042003 Ga0439443_006536 Ga0439443_006536_436_999 174
276 3300042004 Ga0439445_0004604 Ga0439445_0004604_131_694 174
277 3300042127 Ga0450890_028776 Ga0450890_028776_188_727 174
278 3300042439 Ga0439464_0062830 Ga0439464_0062830_75_638 174
279 3300042439 Ga0439464_0157983 Ga0439464_0157983_84_647 174
280 3300042461 Ga0439460_0158225 Ga0439460_0158225_39_602 174
281 3300044765 Ga0466970_0144230 Ga0466970_0144230_61_624 174
282 3300044901 Ga0466960_0291921 Ga0466960_0291921_34_597 174
283 3300045976 Ga0466967_0424344 Ga0466967_0424344_673_1245 174
284 3300046492 Ga0495585_0144732 Ga0495585_0144732_13_576 174
285 3300046513 Ga0495616_0000187 Ga0495616_0000187_46794_47357 174
286 3300046515 Ga0495620_0287982 Ga0495620_0287982_40_603 174
287 3300046525 Ga0495663_0000513 Ga0495663_0000513_8467_9030 174
288 3300046537 Ga0495598_0003297 Ga0495598_0003297_852_1415 174
289 3300046539 Ga0495621_0000667 Ga0495621_0000667_5409_5972 174
290 3300046539 Ga0495621_0017588 Ga0495621_0017588_1580_2143 174
291 3300046558 Ga0495633_0058673 Ga0495633_0058673_752_1315 174
292 3300046615 Ga0495656_0268701 Ga0495656_0268701_118_681 174
293 3300046616 Ga0495668_0197938 Ga0495668_0197938_480_1043 174
294 3300046616 Ga0495668_0232080 Ga0495668_0232080_302_865 174
295 3300046660 Ga0495625_0055469 Ga0495625_0055469_2068_2631 174
296 3300046664 Ga0495659_0090185 Ga0495659_0090185_496_1059 174
297 3300046664 Ga0495659_0104880 Ga0495659_0104880_369_932 174
298 3300046664 Ga0495659_0128055 Ga0495659_0128055_92_655 174
299 3300046691 Ga0495670_0004696 Ga0495670_0004696_958_1521 174
300 3300046691 Ga0495670_0016095 Ga0495670_0016095_1272_1835 174
301 3300046691 Ga0495670_0050037 Ga0495670_0050037_1117_1680 174
302 3300046691 Ga0495670_0157208 Ga0495670_0157208_517_1080 174
303 3300048905 Ga0496102_0509036 Ga0496102_0509036_108_671 174
304 3300048909 Ga0496106_0930844 Ga0496106_0930844_56_619 174
305 3300048912 Ga0496109_1331451 Ga0496109_1331451_13_576 174
306 3300049515 Ga0501292_000020 Ga0501292_000020_37872_38435 174
307 3300049569 Ga0501032_0660713 Ga0501032_0660713_16_582 174
308 3300049585 Ga0501069_0038718 Ga0501069_0038718_1026_1610 174
309 3300049663 Ga0501223_001203 Ga0501223_001203_1889_2452 174
310 3300049664 Ga0501224_000429 Ga0501224_000429_4414_4977 174
311 3300049669 Ga0501235_006285 Ga0501235_006285_950_1513 174
312 3300049669 Ga0501235_090056 Ga0501235_090056_119_682 174
313 3300049686 Ga0501257_109172 Ga0501257_109172_126_689 174
314 3300049708 Ga0501245_000754 Ga0501245_000754_2674_3237 174
315 3300049767 Ga0501270_054021 Ga0501270_054021_98_661 174
316 3300049770 Ga0501273_008084 Ga0501273_008084_50_613 174
317 3300049775 Ga0501279_000022 Ga0501279_000022_37870_38433 174
318 3300049776 Ga0501280_000035 Ga0501280_000035_6299_6862 174
319 3300049777 Ga0501281_00319 Ga0501281_00319_760_1323 174
320 3300050510 nmdc:mga06r32_10044_c1 nmdc:mga06r32_10044_c1_2119_2643 174
321 3300050511 nmdc:mga08y16_352194_c1 nmdc:mga08y16_352194_c1_412_975 174
322 3300053151 Ga0500604_0001460 Ga0500604_0001460_1429_1992 174
323 3300053158 Ga0500627_0011055 Ga0500627_0011055_1128_1691 174
324 iso_pu_bacteria 8057101203 8057101503 174
325 2162886011 MRS1b_contig_944306 MRS1b_0387.00003140 175
326 3300005290 Ga0065712_10083946 Ga0065712_100839463 175
327 3300005331 Ga0070670_100000388 Ga0070670_1000003889 175
328 3300005335 Ga0070666_10018963 Ga0070666_100189635 175
329 3300005354 Ga0070675_100003957 Ga0070675_1000039579 175
330 3300005355 Ga0070671_100000659 Ga0070671_10000065920 175
331 3300005364 Ga0070673_101317658 Ga0070673_1013176581 175
332 3300005367 Ga0070667_100025265 Ga0070667_1000252655 175
333 3300005457 Ga0070662_100018759 Ga0070662_1000187596 175
334 3300005548 Ga0070665_100202950 Ga0070665_1002029501 175
335 3300005564 Ga0070664_100001431 Ga0070664_1000014319 175
336 3300005618 Ga0068864_100034547 Ga0068864_1000345473 175
337 3300005840 Ga0068870_10592133 Ga0068870_105921331 175
338 3300005841 Ga0068863_100119032 Ga0068863_1001190322 175
339 3300009177 Ga0105248_10031149 Ga0105248_100311497 175
340 3300013102 Ga0157371_10394988 Ga0157371_103949881 175
341 3300013306 Ga0163162_10171368 Ga0163162_101713683 175
342 3300013308 Ga0157375_10030774 Ga0157375_100307742 175
343 3300014325 Ga0163163_10114499 Ga0163163_101144992 175
344 3300025909 Ga0207705_10051674 Ga0207705_100516742 175
345 3300025920 Ga0207649_10013333 Ga0207649_100133337 175
346 3300025923 Ga0207681_10013819 Ga0207681_100138194 175
347 3300025925 Ga0207650_10014922 Ga0207650_100149223 175
348 3300025925 Ga0207650_10231482 Ga0207650_102314822 175
349 3300025931 Ga0207644_10008210 Ga0207644_100082106 175
350 3300025933 Ga0207706_10015283 Ga0207706_100152836 175
351 3300025940 Ga0207691_10003436 Ga0207691_100034363 175
352 3300025945 Ga0207679_10044308 Ga0207679_100443083 175
353 3300026088 Ga0207641_10120334 Ga0207641_101203344 175
354 3300026095 Ga0207676_10078243 Ga0207676_100782432 175
355 3300028379 Ga0268266_10163481 Ga0268266_101634813 175
356 3300031548 Ga0307408_101183973 Ga0307408_1011839732 175
357 3300031731 Ga0307405_10045320 Ga0307405_100453203 175
358 3300031824 Ga0307413_10070498 Ga0307413_100704982 175
359 3300031824 Ga0307413_10080354 Ga0307413_100803543 175
360 3300031852 Ga0307410_10067200 Ga0307410_100672003 175
361 3300031995 Ga0307409_101498804 Ga0307409_1014988042 175
362 3300042006 Ga0439432_074778 Ga0439432_074778_96_623 175
363 3300042876 Ga0451577_0852751 Ga0451577_0852751_85_612 175
364 3300045976 Ga0466967_0414556 Ga0466967_0414556_734_1300 175
365 3300046492 Ga0495585_0161460 Ga0495585_0161460_613_1140 175
366 3300046518 Ga0495631_0324497 Ga0495631_0324497_51_578 175
367 3300046525 Ga0495663_0003635 Ga0495663_0003635_239_766 175
368 3300046537 Ga0495598_0000433 Ga0495598_0000433_4028_4555 175
369 3300046539 Ga0495621_0041837 Ga0495621_0041837_386_913 175
370 3300046558 Ga0495633_0003085 Ga0495633_0003085_2168_2695 175
371 3300046691 Ga0495670_0006682 Ga0495670_0006682_269_796 175
372 3300048910 Ga0496107_0311212 Ga0496107_0311212_473_1000 175
373 3300048911 Ga0496108_1219424 Ga0496108_1219424_66_593 175
374 3300048912 Ga0496109_0062250 Ga0496109_0062250_1026_1553 175
375 3300048912 Ga0496109_0438934 Ga0496109_0438934_486_1013 175
376 3300048913 Ga0496110_0019643 Ga0496110_0019643_3283_3810 175
377 3300048914 Ga0496111_0020013 Ga0496111_0020013_431_958 175
378 3300048916 Ga0496113_0680017 Ga0496113_0680017_285_812 175
379 3300048917 Ga0496114_0258685 Ga0496114_0258685_498_1025 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

5

61

0.97

PF13560

HTH_31

Helix-turn-helix domain

3

64

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f52-assembly1.cif.gz_E crystal structure of the clp gene regulator clgr from c. glutamicum 0.8865 1 48
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.8759 1 48
3f52-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from c. glutamicum 0.8661 1 50
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.8614 1 47
5d4z-assembly3.cif.gz_F crystal structure of repressor from salmonella-temperate phage 0.8609 1 49
ID Description Score Start End Superfamily
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8865 1 48 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8798 1 48 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8759 1 48 1.10.260.40
3f52A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8661 1 50 1.10.260.40
3vk0A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8601 1 48 1.10.260.40
ID Description Score Start End GO Terms
AF-N1MH00-F1-model_v4 Uncharacterized protein 0.985 88 175
AF-A0A355WIK9-F1-model_v4 XRE family transcriptional regulator 0.9756 102 175
AF-N1MH00-F1-model_v4 Uncharacterized protein 0.9634 88 175
AF-A0A355WIK9-F1-model_v4 XRE family transcriptional regulator 0.9629 102 175
AF-A0A1J6VP63-F1-model_v4 DUF2642 domain-containing protein 0.9282 113 148

Feature Viewer

pLDDT pTM Quality
86.01 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map