F428248
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 379 | 178 | 378 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100757645|Ga0070670_1007576452 |
| Length | 194 |
| Sequence | MITRIREVRRARRMTLQDVADRCAPPTTPQTIGRLETGARTVSVGWLNRIAGALGVEAADLVSLPEREVIPVAATLDHEGAHAPRRDLVVIPPQSAPDLMAMTVFSGIGEYRSGDEIWLQRLEPEAFAGALNRDVLVPRPAGRFLFGRLIGREVPASGQAGGKLHLLPFGAGQRQTVVTDPPWAAMAVKLIRSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 62 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 104 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 124 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 125 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 126 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 127 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 128 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 129 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 130 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 131 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 132 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 133 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 134 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 167 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 168 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 169 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 170 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 171 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 172 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 173 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 177 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 178 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.47 |
| Metatranscriptomes | 0.26 |
| Isolates | 0.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 2.9 |
| Rhizosphere | 95.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_944306 | 2162886011 | Bacteria | 1505 |
| 2 | JGI24748J21848_1008133 | 3300002074 | Bacteria | 1232 |
| 3 | Ga0065712_10083946 | 3300005290 | Bacteria | 2799 |
| 4 | Ga0065715_10006784 | 3300005293 | Bacteria | 2990 |
| 5 | Ga0065715_10023951 | 3300005293 | Bacteria | 2115 |
| 6 | Ga0070676_10028885 | 3300005328 | Bacteria | 3151 |
| 7 | Ga0070690_100379329 | 3300005330 | Bacteria | 1033 |
| 8 | Ga0070670_100000388 | 3300005331 | Bacteria | 36452 |
| 9 | Ga0070670_100010837 | 3300005331 | Bacteria | 7787 |
| 10 | Ga0070670_100052674 | 3300005331 | Bacteria | 3494 |
| 11 | Ga0070670_100757645 | 3300005331 | Bacteria | 875 |
| 12 | Ga0070677_10008070 | 3300005333 | Bacteria | 3531 |
| 13 | Ga0070666_10018963 | 3300005335 | Bacteria | 4433 |
| 14 | Ga0070666_10312953 | 3300005335 | Bacteria | 1119 |
| 15 | Ga0070660_100001015 | 3300005339 | Bacteria | 18888 |
| 16 | Ga0070668_100065784 | 3300005347 | Bacteria | 2812 |
| 17 | Ga0070668_100068585 | 3300005347 | Bacteria | 2757 |
| 18 | Ga0070668_100323187 | 3300005347 | Unclassified | 1299 |
| 19 | Ga0070668_100692532 | 3300005347 | Bacteria | 898 |
| 20 | Ga0070668_100919223 | 3300005347 | Unclassified | 783 |
| 21 | Ga0070669_100074161 | 3300005353 | Bacteria | 2522 |
| 22 | Ga0070669_100814259 | 3300005353 | Bacteria | 794 |
| 23 | Ga0070675_100003957 | 3300005354 | Bacteria | 11235 |
| 24 | Ga0070675_100006462 | 3300005354 | Bacteria | 8999 |
| 25 | Ga0070675_100701429 | 3300005354 | Bacteria | 922 |
| 26 | Ga0070671_100000659 | 3300005355 | Bacteria | 24798 |
| 27 | Ga0070671_100027792 | 3300005355 | Bacteria | 4657 |
| 28 | Ga0070671_100345213 | 3300005355 | Bacteria | 1270 |
| 29 | Ga0070674_100165442 | 3300005356 | Bacteria | 1682 |
| 30 | Ga0070673_100150402 | 3300005364 | Bacteria | 1971 |
| 31 | Ga0070673_101028233 | 3300005364 | Bacteria | 768 |
| 32 | Ga0070673_101317658 | 3300005364 | Archaea | 678 |
| 33 | Ga0070659_100000011 | 3300005366 | Bacteria | 185903 |
| 34 | Ga0070667_100025265 | 3300005367 | Bacteria | 4938 |
| 35 | Ga0070667_100039158 | 3300005367 | Bacteria | 3973 |
| 36 | Ga0070701_10154909 | 3300005438 | Bacteria | 1323 |
| 37 | Ga0070663_100089777 | 3300005455 | Bacteria | 2275 |
| 38 | Ga0070678_100012935 | 3300005456 | Bacteria | 5211 |
| 39 | Ga0070662_100006784 | 3300005457 | Bacteria | 7403 |
| 40 | Ga0070662_100018759 | 3300005457 | Bacteria | 4684 |
| 41 | Ga0070681_10063043 | 3300005458 | Bacteria | 3679 |
| 42 | Ga0068867_100052356 | 3300005459 | Bacteria | 3013 |
| 43 | Ga0070684_100087485 | 3300005535 | Bacteria | 2767 |
| 44 | Ga0068853_100073961 | 3300005539 | Bacteria | 2972 |
| 45 | Ga0070672_100020387 | 3300005543 | Bacteria | 4834 |
| 46 | Ga0070672_100751165 | 3300005543 | Bacteria | 856 |
| 47 | Ga0070686_100000284 | 3300005544 | Bacteria | 34135 |
| 48 | Ga0070695_100277857 | 3300005545 | Bacteria | 1229 |
| 49 | Ga0070693_100100560 | 3300005547 | Bacteria | 1761 |
| 50 | Ga0070665_100000972 | 3300005548 | Bacteria | 36392 |
| 51 | Ga0070665_100202950 | 3300005548 | Bacteria | 1983 |
| 52 | Ga0070664_100001431 | 3300005564 | Bacteria | 19035 |
| 53 | Ga0068857_100145608 | 3300005577 | Bacteria | 2144 |
| 54 | Ga0068852_100236527 | 3300005616 | Bacteria | 1744 |
| 55 | Ga0068852_101656703 | 3300005616 | Bacteria | 662 |
| 56 | Ga0068859_100046919 | 3300005617 | Bacteria | 4338 |
| 57 | Ga0068864_100034547 | 3300005618 | Bacteria | 4301 |
| 58 | Ga0068864_100087632 | 3300005618 | Bacteria | 2741 |
| 59 | Ga0068861_100201777 | 3300005719 | Bacteria | 1670 |
| 60 | Ga0068861_100548083 | 3300005719 | Bacteria | 1053 |
| 61 | Ga0068861_101027746 | 3300005719 | Bacteria | 788 |
| 62 | Ga0068870_10592133 | 3300005840 | Bacteria | 752 |
| 63 | Ga0068863_100119032 | 3300005841 | Bacteria | 2517 |
| 64 | Ga0068858_100910298 | 3300005842 | Bacteria | 860 |
| 65 | Ga0068860_100164863 | 3300005843 | Bacteria | 2139 |
| 66 | Ga0068860_100995405 | 3300005843 | Bacteria | 856 |
| 67 | Ga0068862_100038877 | 3300005844 | Bacteria | 4038 |
| 68 | Ga0068862_100088461 | 3300005844 | Bacteria | 2695 |
| 69 | Ga0068862_100571485 | 3300005844 | Bacteria | 1082 |
| 70 | Ga0068862_100595086 | 3300005844 | Bacteria | 1061 |
| 71 | Ga0081539_10040142 | 3300005985 | Bacteria | 2751 |
| 72 | Ga0075431_100008388 | 3300006847 | Bacteria | 10339 |
| 73 | Ga0075434_100710119 | 3300006871 | Bacteria | 1023 |
| 74 | Ga0097620_100046919 | 3300006931 | Bacteria | 4338 |
| 75 | Ga0111539_10112916 | 3300009094 | Bacteria | 3187 |
| 76 | Ga0105245_10785292 | 3300009098 | Bacteria | 990 |
| 77 | Ga0105243_11334102 | 3300009148 | Bacteria | 736 |
| 78 | Ga0105248_10031149 | 3300009177 | Bacteria | 5961 |
| 79 | Ga0105238_10114503 | 3300009551 | Bacteria | 2676 |
| 80 | Ga0105249_10031098 | 3300009553 | Bacteria | 4826 |
| 81 | Ga0105249_10467391 | 3300009553 | Bacteria | 1302 |
| 82 | Ga0157373_10448329 | 3300013100 | Bacteria | 928 |
| 83 | Ga0157371_10336651 | 3300013102 | Bacteria | 1097 |
| 84 | Ga0157371_10394988 | 3300013102 | Bacteria | 1011 |
| 85 | Ga0163162_10171368 | 3300013306 | Bacteria | 2295 |
| 86 | Ga0163162_11829510 | 3300013306 | Bacteria | 694 |
| 87 | Ga0157375_10030774 | 3300013308 | Bacteria | 5066 |
| 88 | Ga0157375_10420621 | 3300013308 | Bacteria | 1502 |
| 89 | Ga0163163_10114499 | 3300014325 | Bacteria | 2728 |
| 90 | Ga0157380_10043971 | 3300014326 | Bacteria | 3498 |
| 91 | Ga0157380_10154691 | 3300014326 | Bacteria | 1986 |
| 92 | Ga0157380_10217314 | 3300014326 | Bacteria | 1708 |
| 93 | Ga0163161_10176575 | 3300017792 | Bacteria | 1635 |
| 94 | Ga0206356_11320069 | 3300020070 | Bacteria | 1838 |
| 95 | Ga0213876_10015582 | 3300021384 | Bacteria | 4022 |
| 96 | Ga0207697_10002366 | 3300025315 | Bacteria | 9823 |
| 97 | Ga0207682_10157621 | 3300025893 | Bacteria | 1027 |
| 98 | Ga0207688_10047526 | 3300025901 | Bacteria | 2396 |
| 99 | Ga0207680_10173820 | 3300025903 | Bacteria | 1452 |
| 100 | Ga0207645_10059139 | 3300025907 | Bacteria | 2447 |
| 101 | Ga0207645_10189152 | 3300025907 | Bacteria | 1352 |
| 102 | Ga0207705_10051674 | 3300025909 | Bacteria | 2958 |
| 103 | Ga0207657_10001539 | 3300025919 | Bacteria | 24700 |
| 104 | Ga0207649_10013333 | 3300025920 | Bacteria | 4586 |
| 105 | Ga0207681_10013819 | 3300025923 | Bacteria | 5002 |
| 106 | Ga0207681_10020849 | 3300025923 | Bacteria | 4159 |
| 107 | Ga0207681_10786532 | 3300025923 | Bacteria | 794 |
| 108 | Ga0207694_10202239 | 3300025924 | Bacteria | 1616 |
| 109 | Ga0207650_10007222 | 3300025925 | Bacteria | 7570 |
| 110 | Ga0207650_10014922 | 3300025925 | Bacteria | 5405 |
| 111 | Ga0207650_10015744 | 3300025925 | Bacteria | 5272 |
| 112 | Ga0207650_10231482 | 3300025925 | Bacteria | 1491 |
| 113 | Ga0207650_10638018 | 3300025925 | Bacteria | 897 |
| 114 | Ga0207659_10036179 | 3300025926 | Bacteria | 3418 |
| 115 | Ga0207659_10575797 | 3300025926 | Bacteria | 958 |
| 116 | Ga0207644_10008210 | 3300025931 | Bacteria | 6838 |
| 117 | Ga0207644_10219512 | 3300025931 | Bacteria | 1506 |
| 118 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 119 | Ga0207706_10002348 | 3300025933 | Bacteria | 18484 |
| 120 | Ga0207706_10015283 | 3300025933 | Bacteria | 6942 |
| 121 | Ga0207706_10726603 | 3300025933 | Bacteria | 847 |
| 122 | Ga0207669_10023963 | 3300025937 | Bacteria | 3272 |
| 123 | Ga0207691_10003436 | 3300025940 | Bacteria | 15408 |
| 124 | Ga0207691_10010358 | 3300025940 | Bacteria | 8942 |
| 125 | Ga0207689_10388753 | 3300025942 | Bacteria | 1162 |
| 126 | Ga0207661_10139705 | 3300025944 | Bacteria | 2084 |
| 127 | Ga0207679_10044308 | 3300025945 | Bacteria | 3209 |
| 128 | Ga0207651_10008872 | 3300025960 | Bacteria | 5460 |
| 129 | Ga0207651_10780725 | 3300025960 | Bacteria | 846 |
| 130 | Ga0207712_10077782 | 3300025961 | Bacteria | 2406 |
| 131 | Ga0207712_10210175 | 3300025961 | Bacteria | 1549 |
| 132 | Ga0207712_10506824 | 3300025961 | Bacteria | 1032 |
| 133 | Ga0207668_10056468 | 3300025972 | Bacteria | 2734 |
| 134 | Ga0207668_10223220 | 3300025972 | Bacteria | 1514 |
| 135 | Ga0207668_10825146 | 3300025972 | Unclassified | 822 |
| 136 | Ga0207658_10108479 | 3300025986 | Bacteria | 2190 |
| 137 | Ga0207677_10000150 | 3300026023 | Bacteria | 55710 |
| 138 | Ga0207703_10691731 | 3300026035 | Bacteria | 969 |
| 139 | Ga0207639_10610989 | 3300026041 | Bacteria | 1006 |
| 140 | Ga0207639_10908198 | 3300026041 | Bacteria | 823 |
| 141 | Ga0207678_10111744 | 3300026067 | Bacteria | 2331 |
| 142 | Ga0207708_10029953 | 3300026075 | Bacteria | 4127 |
| 143 | Ga0207702_11235923 | 3300026078 | Bacteria | 741 |
| 144 | Ga0207641_10120334 | 3300026088 | Bacteria | 2342 |
| 145 | Ga0207648_10069348 | 3300026089 | Bacteria | 3072 |
| 146 | Ga0207676_10078243 | 3300026095 | Bacteria | 2678 |
| 147 | Ga0207676_10606082 | 3300026095 | Bacteria | 1052 |
| 148 | Ga0207676_11211105 | 3300026095 | Bacteria | 748 |
| 149 | Ga0207674_10973176 | 3300026116 | Bacteria | 817 |
| 150 | Ga0207675_100014477 | 3300026118 | Bacteria | 7353 |
| 151 | Ga0207675_100441034 | 3300026118 | Bacteria | 1289 |
| 152 | Ga0207675_101699327 | 3300026118 | Bacteria | 651 |
| 153 | Ga0207683_10002608 | 3300026121 | Bacteria | 15739 |
| 154 | Ga0207698_10785444 | 3300026142 | Bacteria | 953 |
| 155 | Ga0209974_10025747 | 3300027876 | Bacteria | 1947 |
| 156 | Ga0209974_10050036 | 3300027876 | Bacteria | 1403 |
| 157 | Ga0268266_10000566 | 3300028379 | Bacteria | 51401 |
| 158 | Ga0268266_10163481 | 3300028379 | Bacteria | 2015 |
| 159 | Ga0268265_10071645 | 3300028380 | Bacteria | 2700 |
| 160 | Ga0268265_10367950 | 3300028380 | Bacteria | 1318 |
| 161 | Ga0268264_10011026 | 3300028381 | Bacteria | 7461 |
| 162 | Ga0268264_10557263 | 3300028381 | Bacteria | 1125 |
| 163 | Ga0316182_1084298 | 3300030745 | Bacteria | 1617 |
| 164 | Ga0307513_10527064 | 3300031456 | Bacteria | 896 |
| 165 | Ga0307408_100016105 | 3300031548 | Bacteria | 4985 |
| 166 | Ga0307408_100428676 | 3300031548 | Bacteria | 1142 |
| 167 | Ga0307408_101183973 | 3300031548 | Bacteria | 712 |
| 168 | Ga0307405_10006669 | 3300031731 | Bacteria | 5700 |
| 169 | Ga0307405_10045320 | 3300031731 | Bacteria | 2694 |
| 170 | Ga0307405_10063381 | 3300031731 | Bacteria | 2344 |
| 171 | Ga0307405_10063983 | 3300031731 | Bacteria | 2335 |
| 172 | Ga0307405_10066897 | 3300031731 | Bacteria | 2293 |
| 173 | Ga0307405_10082819 | 3300031731 | Bacteria | 2101 |
| 174 | Ga0307405_10187346 | 3300031731 | Bacteria | 1491 |
| 175 | Ga0307405_10230278 | 3300031731 | Bacteria | 1366 |
| 176 | Ga0307405_10263110 | 3300031731 | Bacteria | 1289 |
| 177 | Ga0307405_10278309 | 3300031731 | Bacteria | 1258 |
| 178 | Ga0307405_10334089 | 3300031731 | Bacteria | 1162 |
| 179 | Ga0307405_10379219 | 3300031731 | Bacteria | 1100 |
| 180 | Ga0307405_10540967 | 3300031731 | Bacteria | 941 |
| 181 | Ga0307405_10589549 | 3300031731 | Bacteria | 905 |
| 182 | Ga0307413_10012882 | 3300031824 | Bacteria | 4179 |
| 183 | Ga0307413_10022026 | 3300031824 | Bacteria | 3424 |
| 184 | Ga0307413_10070498 | 3300031824 | Bacteria | 2198 |
| 185 | Ga0307413_10080354 | 3300031824 | Bacteria | 2087 |
| 186 | Ga0307413_10089482 | 3300031824 | Bacteria | 2000 |
| 187 | Ga0307413_10090606 | 3300031824 | Bacteria | 1990 |
| 188 | Ga0307413_10110956 | 3300031824 | Bacteria | 1836 |
| 189 | Ga0307413_10152555 | 3300031824 | Bacteria | 1612 |
| 190 | Ga0307413_10362597 | 3300031824 | Bacteria | 1122 |
| 191 | Ga0307413_10509365 | 3300031824 | Bacteria | 968 |
| 192 | Ga0307413_10583649 | 3300031824 | Bacteria | 912 |
| 193 | Ga0307413_11508078 | 3300031824 | Bacteria | 594 |
| 194 | Ga0307410_10003328 | 3300031852 | Bacteria | 8040 |
| 195 | Ga0307410_10004580 | 3300031852 | Bacteria | 7171 |
| 196 | Ga0307410_10004647 | 3300031852 | Bacteria | 7132 |
| 197 | Ga0307410_10067200 | 3300031852 | Bacteria | 2472 |
| 198 | Ga0307410_10165703 | 3300031852 | Bacteria | 1660 |
| 199 | Ga0307410_10180334 | 3300031852 | Bacteria | 1598 |
| 200 | Ga0307410_10257602 | 3300031852 | Bacteria | 1359 |
| 201 | Ga0307410_10263703 | 3300031852 | Bacteria | 1344 |
| 202 | Ga0307410_10278542 | 3300031852 | Bacteria | 1311 |
| 203 | Ga0307410_10318511 | 3300031852 | Bacteria | 1233 |
| 204 | Ga0307410_10333757 | 3300031852 | Bacteria | 1206 |
| 205 | Ga0307410_10510422 | 3300031852 | Bacteria | 990 |
| 206 | Ga0307406_10010296 | 3300031901 | Bacteria | 5270 |
| 207 | Ga0307406_10023956 | 3300031901 | Bacteria | 3640 |
| 208 | Ga0307406_10136365 | 3300031901 | Bacteria | 1730 |
| 209 | Ga0307406_10161079 | 3300031901 | Bacteria | 1613 |
| 210 | Ga0307406_10299782 | 3300031901 | Bacteria | 1234 |
| 211 | Ga0307406_10318167 | 3300031901 | Bacteria | 1202 |
| 212 | Ga0307407_10011890 | 3300031903 | Bacteria | 4163 |
| 213 | Ga0307407_10014559 | 3300031903 | Bacteria | 3857 |
| 214 | Ga0307407_10028898 | 3300031903 | Bacteria | 2970 |
| 215 | Ga0307407_10029411 | 3300031903 | Bacteria | 2950 |
| 216 | Ga0307407_10192986 | 3300031903 | Bacteria | 1359 |
| 217 | Ga0307407_10284576 | 3300031903 | Bacteria | 1146 |
| 218 | Ga0307407_10300392 | 3300031903 | Bacteria | 1119 |
| 219 | Ga0307407_10484625 | 3300031903 | Bacteria | 904 |
| 220 | Ga0307412_10013691 | 3300031911 | Bacteria | 4764 |
| 221 | Ga0307412_10034254 | 3300031911 | Bacteria | 3235 |
| 222 | Ga0307412_10053086 | 3300031911 | Bacteria | 2686 |
| 223 | Ga0307412_10118152 | 3300031911 | Bacteria | 1904 |
| 224 | Ga0307412_10118742 | 3300031911 | Bacteria | 1900 |
| 225 | Ga0307412_10125695 | 3300031911 | Bacteria | 1854 |
| 226 | Ga0307412_10225929 | 3300031911 | Bacteria | 1438 |
| 227 | Ga0307412_10238586 | 3300031911 | Bacteria | 1405 |
| 228 | Ga0307412_10312680 | 3300031911 | Bacteria | 1246 |
| 229 | Ga0307412_10509262 | 3300031911 | Bacteria | 1003 |
| 230 | Ga0307412_11015820 | 3300031911 | Bacteria | 733 |
| 231 | Ga0307409_100007650 | 3300031995 | Bacteria | 6483 |
| 232 | Ga0307409_100021481 | 3300031995 | Bacteria | 4426 |
| 233 | Ga0307409_100028521 | 3300031995 | Bacteria | 3979 |
| 234 | Ga0307409_100058835 | 3300031995 | Bacteria | 2987 |
| 235 | Ga0307409_100135693 | 3300031995 | Bacteria | 2111 |
| 236 | Ga0307409_100161254 | 3300031995 | Bacteria | 1961 |
| 237 | Ga0307409_100177324 | 3300031995 | Bacteria | 1883 |
| 238 | Ga0307409_100189349 | 3300031995 | Bacteria | 1830 |
| 239 | Ga0307409_100218987 | 3300031995 | Bacteria | 1717 |
| 240 | Ga0307409_100277269 | 3300031995 | Bacteria | 1547 |
| 241 | Ga0307409_100280433 | 3300031995 | Bacteria | 1540 |
| 242 | Ga0307409_100656245 | 3300031995 | Bacteria | 1043 |
| 243 | Ga0307409_101280236 | 3300031995 | Bacteria | 758 |
| 244 | Ga0307409_101498804 | 3300031995 | Bacteria | 702 |
| 245 | Ga0307416_100084990 | 3300032002 | Bacteria | 2691 |
| 246 | Ga0307416_100092216 | 3300032002 | Bacteria | 2604 |
| 247 | Ga0307416_100107016 | 3300032002 | Bacteria | 2453 |
| 248 | Ga0307416_100114612 | 3300032002 | Bacteria | 2385 |
| 249 | Ga0307416_100120253 | 3300032002 | Bacteria | 2338 |
| 250 | Ga0307416_100138287 | 3300032002 | Bacteria | 2208 |
| 251 | Ga0307416_100251104 | 3300032002 | Bacteria | 1721 |
| 252 | Ga0307416_100346162 | 3300032002 | Bacteria | 1502 |
| 253 | Ga0307416_100660823 | 3300032002 | Bacteria | 1131 |
| 254 | Ga0307416_101265986 | 3300032002 | Bacteria | 843 |
| 255 | Ga0307416_101807559 | 3300032002 | Bacteria | 715 |
| 256 | Ga0307414_10027581 | 3300032004 | Bacteria | 3672 |
| 257 | Ga0307414_10034187 | 3300032004 | Bacteria | 3367 |
| 258 | Ga0307414_10069791 | 3300032004 | Bacteria | 2528 |
| 259 | Ga0307414_10076742 | 3300032004 | Bacteria | 2429 |
| 260 | Ga0307414_10192811 | 3300032004 | Bacteria | 1650 |
| 261 | Ga0307414_10235073 | 3300032004 | Bacteria | 1513 |
| 262 | Ga0307414_10239739 | 3300032004 | Bacteria | 1500 |
| 263 | Ga0307414_10340613 | 3300032004 | Bacteria | 1283 |
| 264 | Ga0307414_10361288 | 3300032004 | Bacteria | 1249 |
| 265 | Ga0307414_10629175 | 3300032004 | Bacteria | 965 |
| 266 | Ga0307414_10722137 | 3300032004 | Bacteria | 903 |
| 267 | Ga0307414_11369329 | 3300032004 | Bacteria | 657 |
| 268 | Ga0307411_10006255 | 3300032005 | Bacteria | 5939 |
| 269 | Ga0307411_10014337 | 3300032005 | Bacteria | 4406 |
| 270 | Ga0307411_10019890 | 3300032005 | Bacteria | 3889 |
| 271 | Ga0307411_10027966 | 3300032005 | Bacteria | 3421 |
| 272 | Ga0307411_10033830 | 3300032005 | Bacteria | 3174 |
| 273 | Ga0307411_10117057 | 3300032005 | Bacteria | 1919 |
| 274 | Ga0307411_10155047 | 3300032005 | Bacteria | 1707 |
| 275 | Ga0307411_10156300 | 3300032005 | Bacteria | 1702 |
| 276 | Ga0307411_10211512 | 3300032005 | Bacteria | 1498 |
| 277 | Ga0307411_10276068 | 3300032005 | Bacteria | 1335 |
| 278 | Ga0307411_10302578 | 3300032005 | Bacteria | 1283 |
| 279 | Ga0307411_10563966 | 3300032005 | Bacteria | 973 |
| 280 | Ga0307411_10747207 | 3300032005 | Bacteria | 856 |
| 281 | Ga0307415_100004020 | 3300032126 | Bacteria | 7579 |
| 282 | Ga0307415_100025857 | 3300032126 | Bacteria | 3693 |
| 283 | Ga0307415_100042116 | 3300032126 | Bacteria | 3037 |
| 284 | Ga0307415_100074557 | 3300032126 | Bacteria | 2398 |
| 285 | Ga0307415_100093089 | 3300032126 | Bacteria | 2187 |
| 286 | Ga0307415_100112740 | 3300032126 | Bacteria | 2021 |
| 287 | Ga0307415_100125720 | 3300032126 | Bacteria | 1932 |
| 288 | Ga0307415_100206084 | 3300032126 | Bacteria | 1564 |
| 289 | Ga0307415_100349597 | 3300032126 | Bacteria | 1244 |
| 290 | Ga0307415_100590759 | 3300032126 | Bacteria | 986 |
| 291 | Ga0307415_101052290 | 3300032126 | Bacteria | 759 |
| 292 | Ga0395899_0067455 | 3300037312 | Bacteria | 2625 |
| 293 | Ga0395899_0079021 | 3300037312 | Bacteria | 2397 |
| 294 | Ga0395900_0000325 | 3300037418 | Bacteria | 70579 |
| 295 | Ga0395900_0171241 | 3300037418 | Bacteria | 2210 |
| 296 | Ga0395898_0173386 | 3300037466 | Bacteria | 2062 |
| 297 | Ga0395898_0182736 | 3300037466 | Bacteria | 2004 |
| 298 | Ga0395905_0000218 | 3300037471 | Bacteria | 87745 |
| 299 | Ga0395901_0003360 | 3300038443 | Bacteria | 16117 |
| 300 | Ga0395901_0363889 | 3300038443 | Bacteria | 1491 |
| 301 | Ga0436365_0883240 | 3300039437 | Bacteria | 13839 |
| 302 | Ga0436363_0790267 | 3300039450 | Bacteria | 829 |
| 303 | Ga0439465_0073878 | 3300041413 | Bacteria | 1147 |
| 304 | Ga0451853_1796508 | 3300041512 | Bacteria | 596 |
| 305 | Ga0439443_006536 | 3300042003 | Bacteria | 1596 |
| 306 | Ga0439445_0004604 | 3300042004 | Bacteria | 3125 |
| 307 | Ga0439432_074778 | 3300042006 | Bacteria | 1030 |
| 308 | Ga0450890_028776 | 3300042127 | Bacteria | 783 |
| 309 | Ga0439464_0062830 | 3300042439 | Unclassified | 1089 |
| 310 | Ga0439464_0157983 | 3300042439 | Bacteria | 711 |
| 311 | Ga0439460_0158225 | 3300042461 | Bacteria | 758 |
| 312 | Ga0451577_0852751 | 3300042876 | Bacteria | 822 |
| 313 | Ga0466970_0144230 | 3300044765 | Unclassified | 1313 |
| 314 | Ga0466960_0291921 | 3300044901 | Unclassified | 917 |
| 315 | Ga0466967_0414556 | 3300045976 | Bacteria | 1312 |
| 316 | Ga0466967_0424344 | 3300045976 | Bacteria | 1297 |
| 317 | Ga0495585_0144732 | 3300046492 | Bacteria | 1243 |
| 318 | Ga0495585_0161460 | 3300046492 | Bacteria | 1162 |
| 319 | Ga0495616_0000187 | 3300046513 | Bacteria | 51726 |
| 320 | Ga0495620_0287982 | 3300046515 | Bacteria | 625 |
| 321 | Ga0495631_0324497 | 3300046518 | Bacteria | 655 |
| 322 | Ga0495663_0000513 | 3300046525 | Bacteria | 13953 |
| 323 | Ga0495663_0003464 | 3300046525 | Bacteria | 4544 |
| 324 | Ga0495663_0003635 | 3300046525 | Bacteria | 4420 |
| 325 | Ga0495598_0000433 | 3300046537 | Bacteria | 7572 |
| 326 | Ga0495598_0003297 | 3300046537 | Bacteria | 3414 |
| 327 | Ga0495621_0000667 | 3300046539 | Bacteria | 8688 |
| 328 | Ga0495621_0005252 | 3300046539 | Bacteria | 3709 |
| 329 | Ga0495621_0017588 | 3300046539 | Bacteria | 2312 |
| 330 | Ga0495621_0041837 | 3300046539 | Bacteria | 1610 |
| 331 | Ga0495633_0003085 | 3300046558 | Bacteria | 11332 |
| 332 | Ga0495633_0058673 | 3300046558 | Bacteria | 1806 |
| 333 | Ga0495656_0268701 | 3300046615 | Bacteria | 866 |
| 334 | Ga0495668_0197938 | 3300046616 | Bacteria | 1100 |
| 335 | Ga0495668_0232080 | 3300046616 | Bacteria | 1010 |
| 336 | Ga0495625_0055469 | 3300046660 | Bacteria | 2826 |
| 337 | Ga0495659_0090185 | 3300046664 | Bacteria | 1176 |
| 338 | Ga0495659_0104880 | 3300046664 | Bacteria | 1098 |
| 339 | Ga0495659_0128055 | 3300046664 | Bacteria | 1005 |
| 340 | Ga0495670_0004696 | 3300046691 | Bacteria | 6704 |
| 341 | Ga0495670_0006682 | 3300046691 | Bacteria | 5672 |
| 342 | Ga0495670_0008427 | 3300046691 | Bacteria | 5069 |
| 343 | Ga0495670_0016095 | 3300046691 | Bacteria | 3677 |
| 344 | Ga0495670_0025132 | 3300046691 | Bacteria | 2946 |
| 345 | Ga0495670_0050037 | 3300046691 | Bacteria | 2091 |
| 346 | Ga0495670_0157208 | 3300046691 | Bacteria | 1193 |
| 347 | Ga0495677_0011591 | 3300047445 | Bacteria | 3223 |
| 348 | Ga0495685_098251 | 3300047447 | Bacteria | 967 |
| 349 | Ga0495615_0016857 | 3300048090 | Bacteria | 1583 |
| 350 | Ga0496102_0509036 | 3300048905 | Bacteria | 1126 |
| 351 | Ga0496106_0930844 | 3300048909 | Bacteria | 685 |
| 352 | Ga0496107_0311212 | 3300048910 | Bacteria | 1172 |
| 353 | Ga0496108_1219424 | 3300048911 | Bacteria | 635 |
| 354 | Ga0496109_0062250 | 3300048912 | Bacteria | 3412 |
| 355 | Ga0496109_0438934 | 3300048912 | Bacteria | 1233 |
| 356 | Ga0496109_1331451 | 3300048912 | Bacteria | 654 |
| 357 | Ga0496110_0019643 | 3300048913 | Bacteria | 5691 |
| 358 | Ga0496111_0020013 | 3300048914 | Bacteria | 4656 |
| 359 | Ga0496113_0680017 | 3300048916 | Bacteria | 822 |
| 360 | Ga0496114_0258685 | 3300048917 | Bacteria | 1532 |
| 361 | Ga0501292_000020 | 3300049515 | Bacteria | 54099 |
| 362 | Ga0501032_0660713 | 3300049569 | Bacteria | 664 |
| 363 | Ga0501069_0038718 | 3300049585 | Bacteria | 2632 |
| 364 | Ga0501223_001203 | 3300049663 | Bacteria | 6067 |
| 365 | Ga0501224_000429 | 3300049664 | Bacteria | 5033 |
| 366 | Ga0501235_006285 | 3300049669 | Bacteria | 2586 |
| 367 | Ga0501235_090056 | 3300049669 | Bacteria | 740 |
| 368 | Ga0501257_109172 | 3300049686 | Bacteria | 732 |
| 369 | Ga0501245_000754 | 3300049708 | Bacteria | 4021 |
| 370 | Ga0501270_054021 | 3300049767 | Bacteria | 735 |
| 371 | Ga0501273_008084 | 3300049770 | Bacteria | 1252 |
| 372 | Ga0501279_000022 | 3300049775 | Bacteria | 54370 |
| 373 | Ga0501280_000035 | 3300049776 | Bacteria | 40433 |
| 374 | Ga0501281_00319 | 3300049777 | Bacteria | 4929 |
| 375 | nmdc:mga06r32_10044_c1 | 3300050510 | Bacteria | 8544 |
| 376 | nmdc:mga08y16_352194_c1 | 3300050511 | Bacteria | 1512 |
| 377 | Ga0500604_0001460 | 3300053151 | Bacteria | 6593 |
| 378 | Ga0500627_0011055 | 3300053158 | Bacteria | 3315 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046525 | Ga0495663_0003464 | Ga0495663_0003464_801_1364 | 150 |
| 2 | 3300046539 | Ga0495621_0005252 | Ga0495621_0005252_588_1151 | 150 |
| 3 | 3300046691 | Ga0495670_0008427 | Ga0495670_0008427_3443_4006 | 150 |
| 4 | 3300047447 | Ga0495685_098251 | Ga0495685_098251_81_644 | 150 |
| 5 | 3300047445 | Ga0495677_0011591 | Ga0495677_0011591_35_598 | 151 |
| 6 | 3300048090 | Ga0495615_0016857 | Ga0495615_0016857_43_606 | 151 |
| 7 | 3300046691 | Ga0495670_0025132 | Ga0495670_0025132_829_1392 | 152 |
| 8 | 3300041512 | Ga0451853_1796508 | Ga0451853_1796508_66_551 | 153 |
| 9 | 3300031995 | Ga0307409_100189349 | Ga0307409_1001893492 | 162 |
| 10 | 3300032005 | Ga0307411_10276068 | Ga0307411_102760681 | 162 |
| 11 | 3300002074 | JGI24748J21848_1008133 | JGI24748J21848_10081331 | 174 |
| 12 | 3300005293 | Ga0065715_10006784 | Ga0065715_100067842 | 174 |
| 13 | 3300005293 | Ga0065715_10023951 | Ga0065715_100239513 | 174 |
| 14 | 3300005328 | Ga0070676_10028885 | Ga0070676_100288853 | 174 |
| 15 | 3300005330 | Ga0070690_100379329 | Ga0070690_1003793291 | 174 |
| 16 | 3300005331 | Ga0070670_100010837 | Ga0070670_1000108372 | 174 |
| 17 | 3300005331 | Ga0070670_100052674 | Ga0070670_1000526741 | 174 |
| 18 | 3300005331 | Ga0070670_100757645 | Ga0070670_1007576452 | 174 |
| 19 | 3300005333 | Ga0070677_10008070 | Ga0070677_100080702 | 174 |
| 20 | 3300005335 | Ga0070666_10312953 | Ga0070666_103129532 | 174 |
| 21 | 3300005339 | Ga0070660_100001015 | Ga0070660_10000101520 | 174 |
| 22 | 3300005347 | Ga0070668_100065784 | Ga0070668_1000657844 | 174 |
| 23 | 3300005347 | Ga0070668_100068585 | Ga0070668_1000685854 | 174 |
| 24 | 3300005347 | Ga0070668_100323187 | Ga0070668_1003231872 | 174 |
| 25 | 3300005347 | Ga0070668_100692532 | Ga0070668_1006925322 | 174 |
| 26 | 3300005347 | Ga0070668_100919223 | Ga0070668_1009192231 | 174 |
| 27 | 3300005353 | Ga0070669_100074161 | Ga0070669_1000741611 | 174 |
| 28 | 3300005353 | Ga0070669_100814259 | Ga0070669_1008142591 | 174 |
| 29 | 3300005354 | Ga0070675_100006462 | Ga0070675_1000064623 | 174 |
| 30 | 3300005354 | Ga0070675_100701429 | Ga0070675_1007014292 | 174 |
| 31 | 3300005355 | Ga0070671_100027792 | Ga0070671_1000277924 | 174 |
| 32 | 3300005355 | Ga0070671_100345213 | Ga0070671_1003452131 | 174 |
| 33 | 3300005356 | Ga0070674_100165442 | Ga0070674_1001654423 | 174 |
| 34 | 3300005364 | Ga0070673_100150402 | Ga0070673_1001504023 | 174 |
| 35 | 3300005364 | Ga0070673_101028233 | Ga0070673_1010282332 | 174 |
| 36 | 3300005366 | Ga0070659_100000011 | Ga0070659_100000011109 | 174 |
| 37 | 3300005367 | Ga0070667_100039158 | Ga0070667_1000391585 | 174 |
| 38 | 3300005438 | Ga0070701_10154909 | Ga0070701_101549092 | 174 |
| 39 | 3300005455 | Ga0070663_100089777 | Ga0070663_1000897774 | 174 |
| 40 | 3300005456 | Ga0070678_100012935 | Ga0070678_1000129353 | 174 |
| 41 | 3300005457 | Ga0070662_100006784 | Ga0070662_1000067849 | 174 |
| 42 | 3300005458 | Ga0070681_10063043 | Ga0070681_100630437 | 174 |
| 43 | 3300005459 | Ga0068867_100052356 | Ga0068867_1000523563 | 174 |
| 44 | 3300005535 | Ga0070684_100087485 | Ga0070684_1000874854 | 174 |
| 45 | 3300005539 | Ga0068853_100073961 | Ga0068853_1000739611 | 174 |
| 46 | 3300005543 | Ga0070672_100020387 | Ga0070672_1000203877 | 174 |
| 47 | 3300005543 | Ga0070672_100751165 | Ga0070672_1007511651 | 174 |
| 48 | 3300005544 | Ga0070686_100000284 | Ga0070686_10000028429 | 174 |
| 49 | 3300005545 | Ga0070695_100277857 | Ga0070695_1002778572 | 174 |
| 50 | 3300005547 | Ga0070693_100100560 | Ga0070693_1001005601 | 174 |
| 51 | 3300005548 | Ga0070665_100000972 | Ga0070665_10000097218 | 174 |
| 52 | 3300005577 | Ga0068857_100145608 | Ga0068857_1001456082 | 174 |
| 53 | 3300005616 | Ga0068852_100236527 | Ga0068852_1002365272 | 174 |
| 54 | 3300005616 | Ga0068852_101656703 | Ga0068852_1016567031 | 174 |
| 55 | 3300005617 | Ga0068859_100046919 | Ga0068859_1000469197 | 174 |
| 56 | 3300005618 | Ga0068864_100087632 | Ga0068864_1000876323 | 174 |
| 57 | 3300005719 | Ga0068861_100201777 | Ga0068861_1002017772 | 174 |
| 58 | 3300005719 | Ga0068861_100548083 | Ga0068861_1005480832 | 174 |
| 59 | 3300005719 | Ga0068861_101027746 | Ga0068861_1010277461 | 174 |
| 60 | 3300005842 | Ga0068858_100910298 | Ga0068858_1009102981 | 174 |
| 61 | 3300005843 | Ga0068860_100164863 | Ga0068860_1001648632 | 174 |
| 62 | 3300005843 | Ga0068860_100995405 | Ga0068860_1009954052 | 174 |
| 63 | 3300005844 | Ga0068862_100038877 | Ga0068862_1000388775 | 174 |
| 64 | 3300005844 | Ga0068862_100088461 | Ga0068862_1000884612 | 174 |
| 65 | 3300005844 | Ga0068862_100571485 | Ga0068862_1005714851 | 174 |
| 66 | 3300005844 | Ga0068862_100595086 | Ga0068862_1005950862 | 174 |
| 67 | 3300005985 | Ga0081539_10040142 | Ga0081539_100401422 | 174 |
| 68 | 3300006847 | Ga0075431_100008388 | Ga0075431_10000838810 | 174 |
| 69 | 3300006871 | Ga0075434_100710119 | Ga0075434_1007101191 | 174 |
| 70 | 3300006931 | Ga0097620_100046919 | Ga0097620_1000469197 | 174 |
| 71 | 3300009094 | Ga0111539_10112916 | Ga0111539_101129164 | 174 |
| 72 | 3300009098 | Ga0105245_10785292 | Ga0105245_107852922 | 174 |
| 73 | 3300009148 | Ga0105243_11334102 | Ga0105243_113341021 | 174 |
| 74 | 3300009551 | Ga0105238_10114503 | Ga0105238_101145032 | 174 |
| 75 | 3300009553 | Ga0105249_10031098 | Ga0105249_100310982 | 174 |
| 76 | 3300009553 | Ga0105249_10467391 | Ga0105249_104673912 | 174 |
| 77 | 3300013100 | Ga0157373_10448329 | Ga0157373_104483291 | 174 |
| 78 | 3300013102 | Ga0157371_10336651 | Ga0157371_103366511 | 174 |
| 79 | 3300013306 | Ga0163162_11829510 | Ga0163162_118295101 | 174 |
| 80 | 3300013308 | Ga0157375_10420621 | Ga0157375_104206213 | 174 |
| 81 | 3300014326 | Ga0157380_10043971 | Ga0157380_100439715 | 174 |
| 82 | 3300014326 | Ga0157380_10154691 | Ga0157380_101546913 | 174 |
| 83 | 3300014326 | Ga0157380_10217314 | Ga0157380_102173142 | 174 |
| 84 | 3300017792 | Ga0163161_10176575 | Ga0163161_101765753 | 174 |
| 85 | 3300020070 | Ga0206356_11320069 | Ga0206356_113200692 | 174 |
| 86 | 3300021384 | Ga0213876_10015582 | Ga0213876_100155826 | 174 |
| 87 | 3300025315 | Ga0207697_10002366 | Ga0207697_1000236611 | 174 |
| 88 | 3300025893 | Ga0207682_10157621 | Ga0207682_101576212 | 174 |
| 89 | 3300025901 | Ga0207688_10047526 | Ga0207688_100475262 | 174 |
| 90 | 3300025903 | Ga0207680_10173820 | Ga0207680_101738201 | 174 |
| 91 | 3300025907 | Ga0207645_10059139 | Ga0207645_100591392 | 174 |
| 92 | 3300025907 | Ga0207645_10189152 | Ga0207645_101891522 | 174 |
| 93 | 3300025919 | Ga0207657_10001539 | Ga0207657_1000153921 | 174 |
| 94 | 3300025923 | Ga0207681_10020849 | Ga0207681_100208494 | 174 |
| 95 | 3300025923 | Ga0207681_10786532 | Ga0207681_107865322 | 174 |
| 96 | 3300025924 | Ga0207694_10202239 | Ga0207694_102022392 | 174 |
| 97 | 3300025925 | Ga0207650_10007222 | Ga0207650_100072224 | 174 |
| 98 | 3300025925 | Ga0207650_10015744 | Ga0207650_100157446 | 174 |
| 99 | 3300025925 | Ga0207650_10638018 | Ga0207650_106380182 | 174 |
| 100 | 3300025926 | Ga0207659_10036179 | Ga0207659_100361793 | 174 |
| 101 | 3300025926 | Ga0207659_10575797 | Ga0207659_105757972 | 174 |
| 102 | 3300025931 | Ga0207644_10219512 | Ga0207644_102195121 | 174 |
| 103 | 3300025932 | Ga0207690_10000005 | Ga0207690_1000000599 | 174 |
| 104 | 3300025933 | Ga0207706_10002348 | Ga0207706_100023487 | 174 |
| 105 | 3300025933 | Ga0207706_10726603 | Ga0207706_107266032 | 174 |
| 106 | 3300025937 | Ga0207669_10023963 | Ga0207669_100239632 | 174 |
| 107 | 3300025940 | Ga0207691_10010358 | Ga0207691_100103587 | 174 |
| 108 | 3300025942 | Ga0207689_10388753 | Ga0207689_103887532 | 174 |
| 109 | 3300025944 | Ga0207661_10139705 | Ga0207661_101397054 | 174 |
| 110 | 3300025960 | Ga0207651_10008872 | Ga0207651_100088724 | 174 |
| 111 | 3300025960 | Ga0207651_10780725 | Ga0207651_107807251 | 174 |
| 112 | 3300025961 | Ga0207712_10077782 | Ga0207712_100777822 | 174 |
| 113 | 3300025961 | Ga0207712_10210175 | Ga0207712_102101753 | 174 |
| 114 | 3300025961 | Ga0207712_10506824 | Ga0207712_105068242 | 174 |
| 115 | 3300025972 | Ga0207668_10056468 | Ga0207668_100564684 | 174 |
| 116 | 3300025972 | Ga0207668_10223220 | Ga0207668_102232202 | 174 |
| 117 | 3300025972 | Ga0207668_10825146 | Ga0207668_108251461 | 174 |
| 118 | 3300025986 | Ga0207658_10108479 | Ga0207658_101084793 | 174 |
| 119 | 3300026023 | Ga0207677_10000150 | Ga0207677_100001507 | 174 |
| 120 | 3300026035 | Ga0207703_10691731 | Ga0207703_106917312 | 174 |
| 121 | 3300026041 | Ga0207639_10610989 | Ga0207639_106109892 | 174 |
| 122 | 3300026041 | Ga0207639_10908198 | Ga0207639_109081981 | 174 |
| 123 | 3300026067 | Ga0207678_10111744 | Ga0207678_101117442 | 174 |
| 124 | 3300026075 | Ga0207708_10029953 | Ga0207708_100299537 | 174 |
| 125 | 3300026078 | Ga0207702_11235923 | Ga0207702_112359231 | 174 |
| 126 | 3300026089 | Ga0207648_10069348 | Ga0207648_100693485 | 174 |
| 127 | 3300026095 | Ga0207676_10606082 | Ga0207676_106060821 | 174 |
| 128 | 3300026095 | Ga0207676_11211105 | Ga0207676_112111051 | 174 |
| 129 | 3300026116 | Ga0207674_10973176 | Ga0207674_109731761 | 174 |
| 130 | 3300026118 | Ga0207675_100014477 | Ga0207675_1000144773 | 174 |
| 131 | 3300026118 | Ga0207675_100441034 | Ga0207675_1004410342 | 174 |
| 132 | 3300026118 | Ga0207675_101699327 | Ga0207675_1016993271 | 174 |
| 133 | 3300026121 | Ga0207683_10002608 | Ga0207683_1000260817 | 174 |
| 134 | 3300026142 | Ga0207698_10785444 | Ga0207698_107854442 | 174 |
| 135 | 3300027876 | Ga0209974_10025747 | Ga0209974_100257474 | 174 |
| 136 | 3300027876 | Ga0209974_10050036 | Ga0209974_100500363 | 174 |
| 137 | 3300028379 | Ga0268266_10000566 | Ga0268266_1000056649 | 174 |
| 138 | 3300028380 | Ga0268265_10071645 | Ga0268265_100716452 | 174 |
| 139 | 3300028380 | Ga0268265_10367950 | Ga0268265_103679502 | 174 |
| 140 | 3300028381 | Ga0268264_10011026 | Ga0268264_1001102612 | 174 |
| 141 | 3300028381 | Ga0268264_10557263 | Ga0268264_105572631 | 174 |
| 142 | 3300030745 | Ga0316182_1084298 | Ga0316182_10842982 | 174 |
| 143 | 3300031456 | Ga0307513_10527064 | Ga0307513_105270641 | 174 |
| 144 | 3300031548 | Ga0307408_100016105 | Ga0307408_1000161055 | 174 |
| 145 | 3300031548 | Ga0307408_100428676 | Ga0307408_1004286762 | 174 |
| 146 | 3300031731 | Ga0307405_10006669 | Ga0307405_100066695 | 174 |
| 147 | 3300031731 | Ga0307405_10063381 | Ga0307405_100633814 | 174 |
| 148 | 3300031731 | Ga0307405_10063983 | Ga0307405_100639832 | 174 |
| 149 | 3300031731 | Ga0307405_10066897 | Ga0307405_100668972 | 174 |
| 150 | 3300031731 | Ga0307405_10082819 | Ga0307405_100828194 | 174 |
| 151 | 3300031731 | Ga0307405_10187346 | Ga0307405_101873462 | 174 |
| 152 | 3300031731 | Ga0307405_10230278 | Ga0307405_102302782 | 174 |
| 153 | 3300031731 | Ga0307405_10263110 | Ga0307405_102631102 | 174 |
| 154 | 3300031731 | Ga0307405_10278309 | Ga0307405_102783092 | 174 |
| 155 | 3300031731 | Ga0307405_10334089 | Ga0307405_103340891 | 174 |
| 156 | 3300031731 | Ga0307405_10379219 | Ga0307405_103792192 | 174 |
| 157 | 3300031731 | Ga0307405_10540967 | Ga0307405_105409672 | 174 |
| 158 | 3300031731 | Ga0307405_10589549 | Ga0307405_105895492 | 174 |
| 159 | 3300031824 | Ga0307413_10012882 | Ga0307413_100128822 | 174 |
| 160 | 3300031824 | Ga0307413_10022026 | Ga0307413_100220262 | 174 |
| 161 | 3300031824 | Ga0307413_10089482 | Ga0307413_100894822 | 174 |
| 162 | 3300031824 | Ga0307413_10090606 | Ga0307413_100906064 | 174 |
| 163 | 3300031824 | Ga0307413_10110956 | Ga0307413_101109562 | 174 |
| 164 | 3300031824 | Ga0307413_10152555 | Ga0307413_101525551 | 174 |
| 165 | 3300031824 | Ga0307413_10362597 | Ga0307413_103625972 | 174 |
| 166 | 3300031824 | Ga0307413_10509365 | Ga0307413_105093651 | 174 |
| 167 | 3300031824 | Ga0307413_10583649 | Ga0307413_105836492 | 174 |
| 168 | 3300031824 | Ga0307413_11508078 | Ga0307413_115080781 | 174 |
| 169 | 3300031852 | Ga0307410_10003328 | Ga0307410_100033288 | 174 |
| 170 | 3300031852 | Ga0307410_10004580 | Ga0307410_100045808 | 174 |
| 171 | 3300031852 | Ga0307410_10004647 | Ga0307410_100046477 | 174 |
| 172 | 3300031852 | Ga0307410_10165703 | Ga0307410_101657034 | 174 |
| 173 | 3300031852 | Ga0307410_10180334 | Ga0307410_101803342 | 174 |
| 174 | 3300031852 | Ga0307410_10257602 | Ga0307410_102576022 | 174 |
| 175 | 3300031852 | Ga0307410_10263703 | Ga0307410_102637032 | 174 |
| 176 | 3300031852 | Ga0307410_10278542 | Ga0307410_102785422 | 174 |
| 177 | 3300031852 | Ga0307410_10318511 | Ga0307410_103185111 | 174 |
| 178 | 3300031852 | Ga0307410_10333757 | Ga0307410_103337571 | 174 |
| 179 | 3300031852 | Ga0307410_10510422 | Ga0307410_105104222 | 174 |
| 180 | 3300031901 | Ga0307406_10010296 | Ga0307406_100102965 | 174 |
| 181 | 3300031901 | Ga0307406_10023956 | Ga0307406_100239563 | 174 |
| 182 | 3300031901 | Ga0307406_10136365 | Ga0307406_101363654 | 174 |
| 183 | 3300031901 | Ga0307406_10161079 | Ga0307406_101610793 | 174 |
| 184 | 3300031901 | Ga0307406_10299782 | Ga0307406_102997822 | 174 |
| 185 | 3300031901 | Ga0307406_10318167 | Ga0307406_103181672 | 174 |
| 186 | 3300031903 | Ga0307407_10011890 | Ga0307407_100118905 | 174 |
| 187 | 3300031903 | Ga0307407_10014559 | Ga0307407_100145597 | 174 |
| 188 | 3300031903 | Ga0307407_10028898 | Ga0307407_100288982 | 174 |
| 189 | 3300031903 | Ga0307407_10029411 | Ga0307407_100294113 | 174 |
| 190 | 3300031903 | Ga0307407_10192986 | Ga0307407_101929862 | 174 |
| 191 | 3300031903 | Ga0307407_10284576 | Ga0307407_102845762 | 174 |
| 192 | 3300031903 | Ga0307407_10300392 | Ga0307407_103003922 | 174 |
| 193 | 3300031903 | Ga0307407_10484625 | Ga0307407_104846252 | 174 |
| 194 | 3300031911 | Ga0307412_10013691 | Ga0307412_100136913 | 174 |
| 195 | 3300031911 | Ga0307412_10034254 | Ga0307412_100342542 | 174 |
| 196 | 3300031911 | Ga0307412_10053086 | Ga0307412_100530862 | 174 |
| 197 | 3300031911 | Ga0307412_10118152 | Ga0307412_101181522 | 174 |
| 198 | 3300031911 | Ga0307412_10118742 | Ga0307412_101187423 | 174 |
| 199 | 3300031911 | Ga0307412_10125695 | Ga0307412_101256954 | 174 |
| 200 | 3300031911 | Ga0307412_10225929 | Ga0307412_102259291 | 174 |
| 201 | 3300031911 | Ga0307412_10238586 | Ga0307412_102385864 | 174 |
| 202 | 3300031911 | Ga0307412_10312680 | Ga0307412_103126801 | 174 |
| 203 | 3300031911 | Ga0307412_10509262 | Ga0307412_105092622 | 174 |
| 204 | 3300031911 | Ga0307412_11015820 | Ga0307412_110158201 | 174 |
| 205 | 3300031995 | Ga0307409_100007650 | Ga0307409_1000076506 | 174 |
| 206 | 3300031995 | Ga0307409_100021481 | Ga0307409_1000214815 | 174 |
| 207 | 3300031995 | Ga0307409_100028521 | Ga0307409_1000285216 | 174 |
| 208 | 3300031995 | Ga0307409_100058835 | Ga0307409_1000588354 | 174 |
| 209 | 3300031995 | Ga0307409_100135693 | Ga0307409_1001356932 | 174 |
| 210 | 3300031995 | Ga0307409_100161254 | Ga0307409_1001612542 | 174 |
| 211 | 3300031995 | Ga0307409_100177324 | Ga0307409_1001773242 | 174 |
| 212 | 3300031995 | Ga0307409_100218987 | Ga0307409_1002189874 | 174 |
| 213 | 3300031995 | Ga0307409_100277269 | Ga0307409_1002772694 | 174 |
| 214 | 3300031995 | Ga0307409_100280433 | Ga0307409_1002804333 | 174 |
| 215 | 3300031995 | Ga0307409_100656245 | Ga0307409_1006562452 | 174 |
| 216 | 3300031995 | Ga0307409_101280236 | Ga0307409_1012802361 | 174 |
| 217 | 3300032002 | Ga0307416_100084990 | Ga0307416_1000849902 | 174 |
| 218 | 3300032002 | Ga0307416_100092216 | Ga0307416_1000922165 | 174 |
| 219 | 3300032002 | Ga0307416_100107016 | Ga0307416_1001070164 | 174 |
| 220 | 3300032002 | Ga0307416_100114612 | Ga0307416_1001146124 | 174 |
| 221 | 3300032002 | Ga0307416_100120253 | Ga0307416_1001202533 | 174 |
| 222 | 3300032002 | Ga0307416_100138287 | Ga0307416_1001382873 | 174 |
| 223 | 3300032002 | Ga0307416_100251104 | Ga0307416_1002511043 | 174 |
| 224 | 3300032002 | Ga0307416_100346162 | Ga0307416_1003461623 | 174 |
| 225 | 3300032002 | Ga0307416_100660823 | Ga0307416_1006608232 | 174 |
| 226 | 3300032002 | Ga0307416_101265986 | Ga0307416_1012659862 | 174 |
| 227 | 3300032002 | Ga0307416_101807559 | Ga0307416_1018075592 | 174 |
| 228 | 3300032004 | Ga0307414_10027581 | Ga0307414_100275816 | 174 |
| 229 | 3300032004 | Ga0307414_10034187 | Ga0307414_100341872 | 174 |
| 230 | 3300032004 | Ga0307414_10069791 | Ga0307414_100697912 | 174 |
| 231 | 3300032004 | Ga0307414_10076742 | Ga0307414_100767424 | 174 |
| 232 | 3300032004 | Ga0307414_10192811 | Ga0307414_101928114 | 174 |
| 233 | 3300032004 | Ga0307414_10235073 | Ga0307414_102350732 | 174 |
| 234 | 3300032004 | Ga0307414_10239739 | Ga0307414_102397392 | 174 |
| 235 | 3300032004 | Ga0307414_10340613 | Ga0307414_103406132 | 174 |
| 236 | 3300032004 | Ga0307414_10361288 | Ga0307414_103612882 | 174 |
| 237 | 3300032004 | Ga0307414_10629175 | Ga0307414_106291752 | 174 |
| 238 | 3300032004 | Ga0307414_10722137 | Ga0307414_107221372 | 174 |
| 239 | 3300032004 | Ga0307414_11369329 | Ga0307414_113693291 | 174 |
| 240 | 3300032005 | Ga0307411_10006255 | Ga0307411_100062557 | 174 |
| 241 | 3300032005 | Ga0307411_10014337 | Ga0307411_100143373 | 174 |
| 242 | 3300032005 | Ga0307411_10019890 | Ga0307411_100198906 | 174 |
| 243 | 3300032005 | Ga0307411_10027966 | Ga0307411_100279663 | 174 |
| 244 | 3300032005 | Ga0307411_10033830 | Ga0307411_100338305 | 174 |
| 245 | 3300032005 | Ga0307411_10117057 | Ga0307411_101170573 | 174 |
| 246 | 3300032005 | Ga0307411_10155047 | Ga0307411_101550472 | 174 |
| 247 | 3300032005 | Ga0307411_10156300 | Ga0307411_101563003 | 174 |
| 248 | 3300032005 | Ga0307411_10211512 | Ga0307411_102115121 | 174 |
| 249 | 3300032005 | Ga0307411_10302578 | Ga0307411_103025782 | 174 |
| 250 | 3300032005 | Ga0307411_10563966 | Ga0307411_105639661 | 174 |
| 251 | 3300032005 | Ga0307411_10747207 | Ga0307411_107472071 | 174 |
| 252 | 3300032126 | Ga0307415_100004020 | Ga0307415_10000402011 | 174 |
| 253 | 3300032126 | Ga0307415_100025857 | Ga0307415_1000258575 | 174 |
| 254 | 3300032126 | Ga0307415_100042116 | Ga0307415_1000421165 | 174 |
| 255 | 3300032126 | Ga0307415_100074557 | Ga0307415_1000745574 | 174 |
| 256 | 3300032126 | Ga0307415_100093089 | Ga0307415_1000930892 | 174 |
| 257 | 3300032126 | Ga0307415_100112740 | Ga0307415_1001127402 | 174 |
| 258 | 3300032126 | Ga0307415_100125720 | Ga0307415_1001257202 | 174 |
| 259 | 3300032126 | Ga0307415_100206084 | Ga0307415_1002060842 | 174 |
| 260 | 3300032126 | Ga0307415_100349597 | Ga0307415_1003495971 | 174 |
| 261 | 3300032126 | Ga0307415_100590759 | Ga0307415_1005907592 | 174 |
| 262 | 3300032126 | Ga0307415_101052290 | Ga0307415_1010522901 | 174 |
| 263 | 3300037312 | Ga0395899_0067455 | Ga0395899_0067455_274_837 | 174 |
| 264 | 3300037312 | Ga0395899_0079021 | Ga0395899_0079021_842_1405 | 174 |
| 265 | 3300037418 | Ga0395900_0000325 | Ga0395900_0000325_33016_33579 | 174 |
| 266 | 3300037418 | Ga0395900_0171241 | Ga0395900_0171241_819_1382 | 174 |
| 267 | 3300037466 | Ga0395898_0173386 | Ga0395898_0173386_224_787 | 174 |
| 268 | 3300037466 | Ga0395898_0182736 | Ga0395898_0182736_436_1002 | 174 |
| 269 | 3300037471 | Ga0395905_0000218 | Ga0395905_0000218_77042_77605 | 174 |
| 270 | 3300038443 | Ga0395901_0003360 | Ga0395901_0003360_3188_3751 | 174 |
| 271 | 3300038443 | Ga0395901_0363889 | Ga0395901_0363889_32_556 | 174 |
| 272 | 3300039437 | Ga0436365_0883240 | Ga0436365_0883240_10192_10755 | 174 |
| 273 | 3300039450 | Ga0436363_0790267 | Ga0436363_0790267_85_648 | 174 |
| 274 | 3300041413 | Ga0439465_0073878 | Ga0439465_0073878_484_1047 | 174 |
| 275 | 3300042003 | Ga0439443_006536 | Ga0439443_006536_436_999 | 174 |
| 276 | 3300042004 | Ga0439445_0004604 | Ga0439445_0004604_131_694 | 174 |
| 277 | 3300042127 | Ga0450890_028776 | Ga0450890_028776_188_727 | 174 |
| 278 | 3300042439 | Ga0439464_0062830 | Ga0439464_0062830_75_638 | 174 |
| 279 | 3300042439 | Ga0439464_0157983 | Ga0439464_0157983_84_647 | 174 |
| 280 | 3300042461 | Ga0439460_0158225 | Ga0439460_0158225_39_602 | 174 |
| 281 | 3300044765 | Ga0466970_0144230 | Ga0466970_0144230_61_624 | 174 |
| 282 | 3300044901 | Ga0466960_0291921 | Ga0466960_0291921_34_597 | 174 |
| 283 | 3300045976 | Ga0466967_0424344 | Ga0466967_0424344_673_1245 | 174 |
| 284 | 3300046492 | Ga0495585_0144732 | Ga0495585_0144732_13_576 | 174 |
| 285 | 3300046513 | Ga0495616_0000187 | Ga0495616_0000187_46794_47357 | 174 |
| 286 | 3300046515 | Ga0495620_0287982 | Ga0495620_0287982_40_603 | 174 |
| 287 | 3300046525 | Ga0495663_0000513 | Ga0495663_0000513_8467_9030 | 174 |
| 288 | 3300046537 | Ga0495598_0003297 | Ga0495598_0003297_852_1415 | 174 |
| 289 | 3300046539 | Ga0495621_0000667 | Ga0495621_0000667_5409_5972 | 174 |
| 290 | 3300046539 | Ga0495621_0017588 | Ga0495621_0017588_1580_2143 | 174 |
| 291 | 3300046558 | Ga0495633_0058673 | Ga0495633_0058673_752_1315 | 174 |
| 292 | 3300046615 | Ga0495656_0268701 | Ga0495656_0268701_118_681 | 174 |
| 293 | 3300046616 | Ga0495668_0197938 | Ga0495668_0197938_480_1043 | 174 |
| 294 | 3300046616 | Ga0495668_0232080 | Ga0495668_0232080_302_865 | 174 |
| 295 | 3300046660 | Ga0495625_0055469 | Ga0495625_0055469_2068_2631 | 174 |
| 296 | 3300046664 | Ga0495659_0090185 | Ga0495659_0090185_496_1059 | 174 |
| 297 | 3300046664 | Ga0495659_0104880 | Ga0495659_0104880_369_932 | 174 |
| 298 | 3300046664 | Ga0495659_0128055 | Ga0495659_0128055_92_655 | 174 |
| 299 | 3300046691 | Ga0495670_0004696 | Ga0495670_0004696_958_1521 | 174 |
| 300 | 3300046691 | Ga0495670_0016095 | Ga0495670_0016095_1272_1835 | 174 |
| 301 | 3300046691 | Ga0495670_0050037 | Ga0495670_0050037_1117_1680 | 174 |
| 302 | 3300046691 | Ga0495670_0157208 | Ga0495670_0157208_517_1080 | 174 |
| 303 | 3300048905 | Ga0496102_0509036 | Ga0496102_0509036_108_671 | 174 |
| 304 | 3300048909 | Ga0496106_0930844 | Ga0496106_0930844_56_619 | 174 |
| 305 | 3300048912 | Ga0496109_1331451 | Ga0496109_1331451_13_576 | 174 |
| 306 | 3300049515 | Ga0501292_000020 | Ga0501292_000020_37872_38435 | 174 |
| 307 | 3300049569 | Ga0501032_0660713 | Ga0501032_0660713_16_582 | 174 |
| 308 | 3300049585 | Ga0501069_0038718 | Ga0501069_0038718_1026_1610 | 174 |
| 309 | 3300049663 | Ga0501223_001203 | Ga0501223_001203_1889_2452 | 174 |
| 310 | 3300049664 | Ga0501224_000429 | Ga0501224_000429_4414_4977 | 174 |
| 311 | 3300049669 | Ga0501235_006285 | Ga0501235_006285_950_1513 | 174 |
| 312 | 3300049669 | Ga0501235_090056 | Ga0501235_090056_119_682 | 174 |
| 313 | 3300049686 | Ga0501257_109172 | Ga0501257_109172_126_689 | 174 |
| 314 | 3300049708 | Ga0501245_000754 | Ga0501245_000754_2674_3237 | 174 |
| 315 | 3300049767 | Ga0501270_054021 | Ga0501270_054021_98_661 | 174 |
| 316 | 3300049770 | Ga0501273_008084 | Ga0501273_008084_50_613 | 174 |
| 317 | 3300049775 | Ga0501279_000022 | Ga0501279_000022_37870_38433 | 174 |
| 318 | 3300049776 | Ga0501280_000035 | Ga0501280_000035_6299_6862 | 174 |
| 319 | 3300049777 | Ga0501281_00319 | Ga0501281_00319_760_1323 | 174 |
| 320 | 3300050510 | nmdc:mga06r32_10044_c1 | nmdc:mga06r32_10044_c1_2119_2643 | 174 |
| 321 | 3300050511 | nmdc:mga08y16_352194_c1 | nmdc:mga08y16_352194_c1_412_975 | 174 |
| 322 | 3300053151 | Ga0500604_0001460 | Ga0500604_0001460_1429_1992 | 174 |
| 323 | 3300053158 | Ga0500627_0011055 | Ga0500627_0011055_1128_1691 | 174 |
| 324 | iso_pu_bacteria | 8057101203 | 8057101503 | 174 |
| 325 | 2162886011 | MRS1b_contig_944306 | MRS1b_0387.00003140 | 175 |
| 326 | 3300005290 | Ga0065712_10083946 | Ga0065712_100839463 | 175 |
| 327 | 3300005331 | Ga0070670_100000388 | Ga0070670_1000003889 | 175 |
| 328 | 3300005335 | Ga0070666_10018963 | Ga0070666_100189635 | 175 |
| 329 | 3300005354 | Ga0070675_100003957 | Ga0070675_1000039579 | 175 |
| 330 | 3300005355 | Ga0070671_100000659 | Ga0070671_10000065920 | 175 |
| 331 | 3300005364 | Ga0070673_101317658 | Ga0070673_1013176581 | 175 |
| 332 | 3300005367 | Ga0070667_100025265 | Ga0070667_1000252655 | 175 |
| 333 | 3300005457 | Ga0070662_100018759 | Ga0070662_1000187596 | 175 |
| 334 | 3300005548 | Ga0070665_100202950 | Ga0070665_1002029501 | 175 |
| 335 | 3300005564 | Ga0070664_100001431 | Ga0070664_1000014319 | 175 |
| 336 | 3300005618 | Ga0068864_100034547 | Ga0068864_1000345473 | 175 |
| 337 | 3300005840 | Ga0068870_10592133 | Ga0068870_105921331 | 175 |
| 338 | 3300005841 | Ga0068863_100119032 | Ga0068863_1001190322 | 175 |
| 339 | 3300009177 | Ga0105248_10031149 | Ga0105248_100311497 | 175 |
| 340 | 3300013102 | Ga0157371_10394988 | Ga0157371_103949881 | 175 |
| 341 | 3300013306 | Ga0163162_10171368 | Ga0163162_101713683 | 175 |
| 342 | 3300013308 | Ga0157375_10030774 | Ga0157375_100307742 | 175 |
| 343 | 3300014325 | Ga0163163_10114499 | Ga0163163_101144992 | 175 |
| 344 | 3300025909 | Ga0207705_10051674 | Ga0207705_100516742 | 175 |
| 345 | 3300025920 | Ga0207649_10013333 | Ga0207649_100133337 | 175 |
| 346 | 3300025923 | Ga0207681_10013819 | Ga0207681_100138194 | 175 |
| 347 | 3300025925 | Ga0207650_10014922 | Ga0207650_100149223 | 175 |
| 348 | 3300025925 | Ga0207650_10231482 | Ga0207650_102314822 | 175 |
| 349 | 3300025931 | Ga0207644_10008210 | Ga0207644_100082106 | 175 |
| 350 | 3300025933 | Ga0207706_10015283 | Ga0207706_100152836 | 175 |
| 351 | 3300025940 | Ga0207691_10003436 | Ga0207691_100034363 | 175 |
| 352 | 3300025945 | Ga0207679_10044308 | Ga0207679_100443083 | 175 |
| 353 | 3300026088 | Ga0207641_10120334 | Ga0207641_101203344 | 175 |
| 354 | 3300026095 | Ga0207676_10078243 | Ga0207676_100782432 | 175 |
| 355 | 3300028379 | Ga0268266_10163481 | Ga0268266_101634813 | 175 |
| 356 | 3300031548 | Ga0307408_101183973 | Ga0307408_1011839732 | 175 |
| 357 | 3300031731 | Ga0307405_10045320 | Ga0307405_100453203 | 175 |
| 358 | 3300031824 | Ga0307413_10070498 | Ga0307413_100704982 | 175 |
| 359 | 3300031824 | Ga0307413_10080354 | Ga0307413_100803543 | 175 |
| 360 | 3300031852 | Ga0307410_10067200 | Ga0307410_100672003 | 175 |
| 361 | 3300031995 | Ga0307409_101498804 | Ga0307409_1014988042 | 175 |
| 362 | 3300042006 | Ga0439432_074778 | Ga0439432_074778_96_623 | 175 |
| 363 | 3300042876 | Ga0451577_0852751 | Ga0451577_0852751_85_612 | 175 |
| 364 | 3300045976 | Ga0466967_0414556 | Ga0466967_0414556_734_1300 | 175 |
| 365 | 3300046492 | Ga0495585_0161460 | Ga0495585_0161460_613_1140 | 175 |
| 366 | 3300046518 | Ga0495631_0324497 | Ga0495631_0324497_51_578 | 175 |
| 367 | 3300046525 | Ga0495663_0003635 | Ga0495663_0003635_239_766 | 175 |
| 368 | 3300046537 | Ga0495598_0000433 | Ga0495598_0000433_4028_4555 | 175 |
| 369 | 3300046539 | Ga0495621_0041837 | Ga0495621_0041837_386_913 | 175 |
| 370 | 3300046558 | Ga0495633_0003085 | Ga0495633_0003085_2168_2695 | 175 |
| 371 | 3300046691 | Ga0495670_0006682 | Ga0495670_0006682_269_796 | 175 |
| 372 | 3300048910 | Ga0496107_0311212 | Ga0496107_0311212_473_1000 | 175 |
| 373 | 3300048911 | Ga0496108_1219424 | Ga0496108_1219424_66_593 | 175 |
| 374 | 3300048912 | Ga0496109_0062250 | Ga0496109_0062250_1026_1553 | 175 |
| 375 | 3300048912 | Ga0496109_0438934 | Ga0496109_0438934_486_1013 | 175 |
| 376 | 3300048913 | Ga0496110_0019643 | Ga0496110_0019643_3283_3810 | 175 |
| 377 | 3300048914 | Ga0496111_0020013 | Ga0496111_0020013_431_958 | 175 |
| 378 | 3300048916 | Ga0496113_0680017 | Ga0496113_0680017_285_812 | 175 |
| 379 | 3300048917 | Ga0496114_0258685 | Ga0496114_0258685_498_1025 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f52-assembly1.cif.gz_E | crystal structure of the clp gene regulator clgr from c. glutamicum | 0.8865 | 1 | 48 |
| 1y7y-assembly1.cif.gz_B | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.8759 | 1 | 48 |
| 3f52-assembly1.cif.gz_A | crystal structure of the clp gene regulator clgr from c. glutamicum | 0.8661 | 1 | 50 |
| 2xj3-assembly1.cif.gz_B | high resolution structure of the t55c mutant of cylr2. | 0.8614 | 1 | 47 |
| 5d4z-assembly3.cif.gz_F | crystal structure of repressor from salmonella-temperate phage | 0.8609 | 1 | 49 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f52E00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8865 | 1 | 48 | 1.10.260.40 |
| 1y7yA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8798 | 1 | 48 | 1.10.260.40 |
| 1y7yB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8759 | 1 | 48 | 1.10.260.40 |
| 3f52A00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8661 | 1 | 50 | 1.10.260.40 |
| 3vk0A00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8601 | 1 | 48 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-N1MH00-F1-model_v4 | Uncharacterized protein | 0.985 | 88 | 175 |
|
| AF-A0A355WIK9-F1-model_v4 | XRE family transcriptional regulator | 0.9756 | 102 | 175 |
|
| AF-N1MH00-F1-model_v4 | Uncharacterized protein | 0.9634 | 88 | 175 |
|
| AF-A0A355WIK9-F1-model_v4 | XRE family transcriptional regulator | 0.9629 | 102 | 175 |
|
| AF-A0A1J6VP63-F1-model_v4 | DUF2642 domain-containing protein | 0.9282 | 113 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar