F424512

General Info

Members Datasets Scaffolds Average Seq Length
367 190 367 182

Family's Representative Sequence

Representative Sequence 3300049663|Ga0501223_049072|Ga0501223_049072_164_805
Length 213
Sequence MKSRGPRVAKPSISDALEIPTKTFDPTMQRLTKTDEHAIARTFIDHASHFLVRDYLPKIERCLEKLSDEQIWWRANEESNSIGNLILHLCGNARQWIVCGVGSAPDSRDRDSEFEQRDVIPRDRLLTLLRSTLSDVEATLQAFDVSTLLERRKIQGNDVEILEAIFHVTEHFSMHTGQIIMLTKMMTSADLRFYEFDAGAPVVRWRSGSSGSS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
158 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
159 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
160 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
161 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
162 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
163 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
164 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
165 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
166 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
167 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
168 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
169 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
170 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
171 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
174 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
175 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
176 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
177 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
178 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
181 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
182 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
183 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
184 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.37
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1491579 2162886007 Bacteria 1138
2 JGI24034J14986_100683 3300001432 Bacteria 1999
3 JGI24748J21848_1000014 3300002074 Bacteria 147126
4 JGI24034J26672_10000012 3300002239 Bacteria 146139
5 JGI25406J46586_10065752 3300003203 Bacteria 1154
6 Ga0065704_10107363 3300005289 Bacteria 2058
7 Ga0065707_10193015 3300005295 Bacteria 1351
8 Ga0070690_100006648 3300005330 Bacteria 6568
9 Ga0070690_100283543 3300005330 Bacteria 1182
10 Ga0070690_100361641 3300005330 Bacteria 1056
11 Ga0070670_100010853 3300005331 Bacteria 7783
12 Ga0068869_100012954 3300005334 Bacteria 5527
13 Ga0068868_100060435 3300005338 Bacteria 3000
14 Ga0070660_100024251 3300005339 Unclassified 4500
15 Ga0070689_100243028 3300005340 Bacteria 1483
16 Ga0070689_100544903 3300005340 Unclassified 999
17 Ga0070689_101015172 3300005340 Unclassified 738
18 Ga0070687_100299416 3300005343 Bacteria 1020
19 Ga0070687_100839553 3300005343 Bacteria 654
20 Ga0070687_101119023 3300005343 Unclassified 577
21 Ga0070661_100019273 3300005344 Unclassified 4861
22 Ga0070661_100257575 3300005344 Bacteria 1348
23 Ga0070669_100076331 3300005353 Bacteria 2487
24 Ga0070675_100028995 3300005354 Bacteria 4460
25 Ga0070675_100409157 3300005354 Bacteria 1211
26 Ga0070675_101303399 3300005354 Unclassified 669
27 Ga0070671_100052859 3300005355 Bacteria 3377
28 Ga0070674_100538505 3300005356 Unclassified 978
29 Ga0070674_100974608 3300005356 Bacteria 743
30 Ga0070673_100006061 3300005364 Bacteria 7831
31 Ga0070673_100523740 3300005364 Unclassified 1075
32 Ga0070673_100619834 3300005364 Bacteria 988
33 Ga0070688_100045547 3300005365 Bacteria 2711
34 Ga0070659_100283669 3300005366 Bacteria 1378
35 Ga0070701_10077865 3300005438 Unclassified 1788
36 Ga0070705_100050051 3300005440 Bacteria 2429
37 Ga0070705_100201697 3300005440 Bacteria 1364
38 Ga0070700_100007003 3300005441 Bacteria 6053
39 Ga0070700_100475959 3300005441 Unclassified 956
40 Ga0070694_100079625 3300005444 Bacteria 2275
41 Ga0070694_100364787 3300005444 Bacteria 1123
42 Ga0070708_100498506 3300005445 Bacteria 1149
43 Ga0070681_10002994 3300005458 Bacteria 15675
44 Ga0070681_10088404 3300005458 Unclassified 3050
45 Ga0070681_10410162 3300005458 Unclassified 1266
46 Ga0070706_100000146 3300005467 Bacteria 89818
47 Ga0070706_100043093 3300005467 Unclassified 4169
48 Ga0070699_100108095 3300005518 Unclassified 2441
49 Ga0070684_100818046 3300005535 Unclassified 871
50 Ga0068853_100002135 3300005539 Bacteria 14717
51 Ga0068853_100084673 3300005539 Bacteria 2778
52 Ga0070672_101159927 3300005543 Unclassified 688
53 Ga0070686_100266865 3300005544 Unclassified 1257
54 Ga0070696_100030448 3300005546 Bacteria 3694
55 Ga0070696_100208689 3300005546 Unclassified 1461
56 Ga0070696_100528910 3300005546 Bacteria 942
57 Ga0070693_100019502 3300005547 Unclassified 3556
58 Ga0070693_100096318 3300005547 Bacteria 1794
59 Ga0070693_100185053 3300005547 Bacteria 1343
60 Ga0070693_100409790 3300005547 Bacteria 942
61 Ga0070704_100051106 3300005549 Bacteria 2909
62 Ga0068855_100097103 3300005563 Unclassified 3394
63 Ga0070664_100003045 3300005564 Bacteria 13551
64 Ga0068857_100025360 3300005577 Bacteria 5220
65 Ga0068857_100033672 3300005577 Bacteria 4532
66 Ga0068857_100203464 3300005577 Bacteria 1805
67 Ga0068857_100764637 3300005577 Bacteria 921
68 Ga0068854_100181624 3300005578 Unclassified 1644
69 Ga0068854_100191222 3300005578 Bacteria 1604
70 Ga0070702_100221880 3300005615 Bacteria 1264
71 Ga0070702_100384302 3300005615 Bacteria 999
72 Ga0068859_100000465 3300005617 Bacteria 40071
73 Ga0068859_100032529 3300005617 Bacteria 5239
74 Ga0068859_100060068 3300005617 Bacteria 3831
75 Ga0068859_100086410 3300005617 Unclassified 3183
76 Ga0068859_100127271 3300005617 Unclassified 2617
77 Ga0068859_100167145 3300005617 Bacteria 2279
78 Ga0068859_100325217 3300005617 Unclassified 1632
79 Ga0068859_100365249 3300005617 Unclassified 1539
80 Ga0068859_100671396 3300005617 Bacteria 1128
81 Ga0068859_100695543 3300005617 Unclassified 1107
82 Ga0068859_100928270 3300005617 Bacteria 954
83 Ga0068859_101134242 3300005617 Unclassified 860
84 Ga0068864_100206515 3300005618 Bacteria 1807
85 Ga0068864_100745502 3300005618 Unclassified 959
86 Ga0068864_100908667 3300005618 Unclassified 870
87 Ga0068864_100913143 3300005618 Unclassified 867
88 Ga0068866_10281302 3300005718 Bacteria 1031
89 Ga0068861_100005204 3300005719 Bacteria 8767
90 Ga0068861_100141621 3300005719 Bacteria 1963
91 Ga0068861_100269772 3300005719 Bacteria 1461
92 Ga0068861_100463668 3300005719 Unclassified 1138
93 Ga0068851_10142315 3300005834 Bacteria 1305
94 Ga0068870_10177121 3300005840 Unclassified 1277
95 Ga0068863_100294763 3300005841 Bacteria 1573
96 Ga0068863_100503750 3300005841 Bacteria 1192
97 Ga0068863_101288313 3300005841 Unclassified 737
98 Ga0068858_100000194 3300005842 Bacteria 64964
99 Ga0068858_100182390 3300005842 Unclassified 1982
100 Ga0068858_100566931 3300005842 Bacteria 1100
101 Ga0068860_100009979 3300005843 Bacteria 9412
102 Ga0068860_100011713 3300005843 Bacteria 8643
103 Ga0068860_100058430 3300005843 Bacteria 3666
104 Ga0068860_100062352 3300005843 Unclassified 3542
105 Ga0068860_100253924 3300005843 Unclassified 1713
106 Ga0068862_100073717 3300005844 Unclassified 2950
107 Ga0068862_100758123 3300005844 Unclassified 945
108 Ga0081539_10000215 3300005985 Bacteria 135054
109 Ga0081539_10002622 3300005985 Bacteria 24590
110 Ga0097621_100045765 3300006237 Unclassified 3536
111 Ga0075428_100053553 3300006844 Bacteria 4422
112 Ga0075431_100108379 3300006847 Unclassified 2866
113 Ga0075433_10008179 3300006852 Bacteria 8330
114 Ga0075433_10035189 3300006852 Unclassified 4305
115 Ga0075433_10043693 3300006852 Bacteria 3891
116 Ga0075433_10085727 3300006852 Bacteria 2781
117 Ga0075433_10327655 3300006852 Unclassified 1354
118 Ga0075433_10331210 3300006852 Bacteria 1346
119 Ga0075434_100049779 3300006871 Unclassified 4161
120 Ga0075434_100053921 3300006871 Bacteria 3995
121 Ga0075434_100291628 3300006871 Unclassified 1651
122 Ga0075434_100719921 3300006871 Bacteria 1015
123 Ga0075429_100086420 3300006880 Unclassified 2733
124 Ga0075429_100184751 3300006880 Bacteria 1827
125 Ga0097620_100000465 3300006931 Bacteria 40071
126 Ga0097620_100032531 3300006931 Bacteria 5239
127 Ga0097620_100060063 3300006931 Bacteria 3831
128 Ga0097620_100086412 3300006931 Unclassified 3183
129 Ga0097620_100099076 3300006931 Unclassified 2969
130 Ga0097620_100127265 3300006931 Unclassified 2617
131 Ga0097620_100167142 3300006931 Bacteria 2279
132 Ga0097620_100325208 3300006931 Unclassified 1632
133 Ga0097620_100365238 3300006931 Unclassified 1539
134 Ga0097620_100447599 3300006931 Bacteria 1388
135 Ga0097620_100671431 3300006931 Bacteria 1128
136 Ga0097620_100695511 3300006931 Unclassified 1107
137 Ga0097620_100928252 3300006931 Bacteria 954
138 Ga0097620_101134172 3300006931 Unclassified 860
139 Ga0105240_10136976 3300009093 Bacteria 2931
140 Ga0105240_10345371 3300009093 Unclassified 1689
141 Ga0105240_10447357 3300009093 Bacteria 1446
142 Ga0111539_10000643 3300009094 Bacteria 45175
143 Ga0111539_10054193 3300009094 Unclassified 4772
144 Ga0111539_10239155 3300009094 Bacteria 2113
145 Ga0111539_11355183 3300009094 Bacteria 825
146 Ga0105245_10134811 3300009098 Bacteria 2320
147 Ga0105247_10000050 3300009101 Bacteria 146183
148 Ga0105247_10229249 3300009101 Unclassified 1260
149 Ga0114129_10011672 3300009147 Bacteria 12503
150 Ga0114129_10016771 3300009147 Bacteria 10428
151 Ga0114129_10080066 3300009147 Bacteria 4541
152 Ga0114129_10197658 3300009147 Bacteria 2726
153 Ga0114129_11037946 3300009147 Bacteria 1030
154 Ga0114129_11675417 3300009147 Unclassified 777
155 Ga0105243_10141532 3300009148 Bacteria 2053
156 Ga0105243_10982363 3300009148 Unclassified 846
157 Ga0105243_11108332 3300009148 Unclassified 800
158 Ga0105243_11212744 3300009148 Unclassified 768
159 Ga0105243_11436592 3300009148 Unclassified 711
160 Ga0105241_10179489 3300009174 Unclassified 1755
161 Ga0105242_10020415 3300009176 Bacteria 5195
162 Ga0105242_10599143 3300009176 Unclassified 1064
163 Ga0105248_10241673 3300009177 Bacteria 2033
164 Ga0105237_10698356 3300009545 Bacteria 1021
165 Ga0105238_10017969 3300009551 Bacteria 7188
166 Ga0105238_10837569 3300009551 Unclassified 936
167 Ga0105249_10021096 3300009553 Bacteria 5830
168 Ga0105249_10073753 3300009553 Bacteria 3157
169 Ga0105249_10282134 3300009553 Unclassified 1659
170 Ga0105239_10002786 3300010375 Bacteria 21889
171 Ga0105239_10184183 3300010375 Bacteria 2337
172 Ga0105239_10496628 3300010375 Bacteria 1387
173 Ga0105239_11371857 3300010375 Unclassified 816
174 Ga0105246_10140986 3300011119 Bacteria 1812
175 Ga0105246_10221301 3300011119 Unclassified 1484
176 Ga0105246_10520359 3300011119 Bacteria 1014
177 Ga0157374_10919085 3300013296 Unclassified 893
178 Ga0157378_10029457 3300013297 Unclassified 4846
179 Ga0157378_10031462 3300013297 Bacteria 4687
180 Ga0157378_10425310 3300013297 Unclassified 1313
181 Ga0157378_10776362 3300013297 Bacteria 982
182 Ga0163162_10006887 3300013306 Bacteria 11030
183 Ga0163162_10064439 3300013306 Bacteria 3710
184 Ga0163162_10077251 3300013306 Bacteria 3393
185 Ga0157372_10014831 3300013307 Bacteria 8344
186 Ga0157372_10721437 3300013307 Unclassified 1159
187 Ga0157375_10110813 3300013308 Unclassified 2843
188 Ga0157375_11541049 3300013308 Unclassified 785
189 Ga0163163_10003114 3300014325 Bacteria 14057
190 Ga0163163_10007741 3300014325 Bacteria 9494
191 Ga0163163_10031350 3300014325 Bacteria 5130
192 Ga0157380_10129134 3300014326 Bacteria 2153
193 Ga0157380_10360398 3300014326 Unclassified 1364
194 Ga0157380_10439017 3300014326 Unclassified 1250
195 Ga0157377_10083459 3300014745 Unclassified 1872
196 Ga0157379_10153237 3300014968 Bacteria 2079
197 Ga0157379_10186885 3300014968 Bacteria 1872
198 Ga0157376_11308923 3300014969 Unclassified 755
199 Ga0207672_1000212 3300025223 Bacteria 8197
200 Ga0207710_10000003 3300025900 Bacteria 1071597
201 Ga0207710_10001694 3300025900 Bacteria 10687
202 Ga0207688_10041732 3300025901 Unclassified 2553
203 Ga0207643_10000740 3300025908 Bacteria 20063
204 Ga0207684_10000327 3300025910 Bacteria 67005
205 Ga0207707_10057565 3300025912 Bacteria 3383
206 Ga0207707_10141665 3300025912 Bacteria 2102
207 Ga0207707_10249112 3300025912 Bacteria 1543
208 Ga0207695_10097879 3300025913 Bacteria 2934
209 Ga0207671_10081712 3300025914 Unclassified 2424
210 Ga0207662_10030690 3300025918 Unclassified 3121
211 Ga0207657_10034767 3300025919 Unclassified 4527
212 Ga0207649_10076153 3300025920 Bacteria 2158
213 Ga0207649_10615220 3300025920 Bacteria 836
214 Ga0207681_10452804 3300025923 Bacteria 1044
215 Ga0207694_10010187 3300025924 Bacteria 7085
216 Ga0207650_10000143 3300025925 Bacteria 87521
217 Ga0207687_10058443 3300025927 Bacteria 2713
218 Ga0207644_10000093 3300025931 Bacteria 64685
219 Ga0207690_10051505 3300025932 Unclassified 2754
220 Ga0207690_10985334 3300025932 Bacteria 701
221 Ga0207706_10348355 3300025933 Bacteria 1288
222 Ga0207686_10106099 3300025934 Unclassified 1885
223 Ga0207709_10171777 3300025935 Unclassified 1522
224 Ga0207709_10239012 3300025935 Bacteria 1320
225 Ga0207709_10342010 3300025935 Unclassified 1126
226 Ga0207709_10628035 3300025935 Unclassified 853
227 Ga0207670_10020048 3300025936 Bacteria 4099
228 Ga0207670_10339963 3300025936 Bacteria 1186
229 Ga0207665_10000007 3300025939 Bacteria 177869
230 Ga0207691_10051808 3300025940 Bacteria 3751
231 Ga0207711_10054358 3300025941 Bacteria 3436
232 Ga0207711_10059969 3300025941 Bacteria 3277
233 Ga0207689_10004377 3300025942 Bacteria 12852
234 Ga0207689_10074365 3300025942 Unclassified 2792
235 Ga0207689_10113632 3300025942 Bacteria 2226
236 Ga0207689_10200889 3300025942 Bacteria 1645
237 Ga0207689_10242222 3300025942 Bacteria 1491
238 Ga0207679_10026777 3300025945 Unclassified 3980
239 Ga0207667_10169106 3300025949 Bacteria 2247
240 Ga0207667_11167801 3300025949 Bacteria 751
241 Ga0207651_10723635 3300025960 Unclassified 878
242 Ga0207651_10847461 3300025960 Bacteria 812
243 Ga0207712_10002809 3300025961 Bacteria 11145
244 Ga0207712_10045193 3300025961 Bacteria 3048
245 Ga0207640_10330901 3300025981 Bacteria 1217
246 Ga0207703_10000225 3300026035 Bacteria 64974
247 Ga0207703_10087544 3300026035 Unclassified 2612
248 Ga0207703_10138448 3300026035 Unclassified 2110
249 Ga0207703_10450519 3300026035 Bacteria 1202
250 Ga0207703_10520817 3300026035 Bacteria 1118
251 Ga0207703_10780080 3300026035 Unclassified 912
252 Ga0207639_10012628 3300026041 Bacteria 5887
253 Ga0207708_10000499 3300026075 Bacteria 30185
254 Ga0207708_10048452 3300026075 Unclassified 3234
255 Ga0207708_10127427 3300026075 Bacteria 1988
256 Ga0207641_10129769 3300026088 Bacteria 2262
257 Ga0207648_10055185 3300026089 Unclassified 3469
258 Ga0207648_10086876 3300026089 Bacteria 2729
259 Ga0207648_10095637 3300026089 Bacteria 2599
260 Ga0207676_10136466 3300026095 Unclassified 2094
261 Ga0207676_10247204 3300026095 Unclassified 1604
262 Ga0207674_10000129 3300026116 Bacteria 88458
263 Ga0207674_10480477 3300026116 Bacteria 1201
264 Ga0207674_10495772 3300026116 Unclassified 1180
265 Ga0207675_100004141 3300026118 Bacteria 14039
266 Ga0207675_100254755 3300026118 Bacteria 1699
267 Ga0207683_10100053 3300026121 Bacteria 2588
268 Ga0207428_10001094 3300027907 Bacteria 29497
269 Ga0268265_10114898 3300028380 Unclassified 2205
270 Ga0268265_10306616 3300028380 Bacteria 1432
271 Ga0268264_10018706 3300028381 Bacteria 5664
272 Ga0268264_10023744 3300028381 Bacteria 5001
273 Ga0268264_10034076 3300028381 Unclassified 4187
274 Ga0268264_10049893 3300028381 Unclassified 3483
275 Ga0268264_10089133 3300028381 Bacteria 2656
276 Ga0268264_10214688 3300028381 Unclassified 1768
277 Ga0307408_100179496 3300031548 Bacteria 1697
278 Ga0307405_10024514 3300031731 Bacteria 3447
279 Ga0307413_10042259 3300031824 Bacteria 2677
280 Ga0307410_10440537 3300031852 Bacteria 1061
281 Ga0307406_10004268 3300031901 Bacteria 7776
282 Ga0307407_10134788 3300031903 Unclassified 1585
283 Ga0307412_10032755 3300031911 Unclassified 3297
284 Ga0307416_100035654 3300032002 Unclassified 3803
285 Ga0307414_10047076 3300032004 Bacteria 2965
286 Ga0307411_10029931 3300032005 Bacteria 3332
287 Ga0307415_100005096 3300032126 Bacteria 6921
288 Ga0373940_0049466 3300035088 Unclassified 1177
289 Ga0373942_0006450 3300035207 Bacteria 2710
290 Ga0373961_0221340 3300035241 Unclassified 675
291 Ga0373931_0154121 3300035691 Unclassified 1342
292 Ga0395900_0224856 3300037418 Unclassified 1890
293 Ga0395898_0098946 3300037466 Bacteria 2801
294 Ga0395898_1541446 3300037466 Unclassified 590
295 Ga0436365_1676880 3300039437 Bacteria 3378
296 Ga0436362_0570694 3300039453 Bacteria 1190
297 Ga0439439_0033992 3300041406 Unclassified 1307
298 Ga0439455_0006113 3300042012 Unclassified 2482
299 Ga0439458_0001201 3300042157 Bacteria 6585
300 Ga0451577_0067716 3300042876 Bacteria 3185
301 Ga0451577_0701648 3300042876 Unclassified 916
302 Ga0453683_0027128 3300044673 Bacteria 3636
303 Ga0453684_0239962 3300044712 Bacteria 2087
304 Ga0451576_0032816 3300045051 Bacteria 5522
305 Ga0451576_0212422 3300045051 Unclassified 2020
306 Ga0451576_0737683 3300045051 Unclassified 1035
307 Ga0496103_0471271 3300048906 Bacteria 805
308 Ga0496106_0126526 3300048909 Bacteria 2001
309 Ga0496109_0736073 3300048912 Unclassified 924
310 Ga0496112_0333441 3300048915 Unclassified 1461
311 Ga0496112_0622652 3300048915 Bacteria 1010
312 Ga0501292_041540 3300049515 Unclassified 795
313 Ga0501299_012799 3300049522 Bacteria 1438
314 Ga0501299_058772 3300049522 Unclassified 810
315 Ga0501198_000148 3300049649 Bacteria 9701
316 Ga0501202_084691 3300049652 Unclassified 750
317 Ga0501206_003032 3300049653 Unclassified 2129
318 Ga0501207_005802 3300049654 Unclassified 1718
319 Ga0501209_001471 3300049656 Unclassified 3341
320 Ga0501216_009755 3300049660 Unclassified 1535
321 Ga0501223_000930 3300049663 Bacteria 6919
322 Ga0501223_049072 3300049663 Unclassified 819
323 Ga0501224_002107 3300049664 Bacteria 2696
324 Ga0501227_000312 3300049665 Bacteria 10116
325 Ga0501230_019033 3300049667 Unclassified 1179
326 Ga0501233_001030 3300049668 Unclassified 4725
327 Ga0501233_088498 3300049668 Unclassified 806
328 Ga0501242_001682 3300049674 Bacteria 2255
329 Ga0501243_061468 3300049675 Unclassified 697
330 Ga0501249_048206 3300049679 Bacteria 975
331 Ga0501249_063892 3300049679 Unclassified 855
332 Ga0501253_050272 3300049683 Unclassified 871
333 Ga0501256_008321 3300049685 Unclassified 965
334 Ga0501221_003154 3300049704 Unclassified 2710
335 Ga0501225_0011418 3300049705 Unclassified 2498
336 Ga0501225_0108970 3300049705 Unclassified 815
337 Ga0501229_018683 3300049706 Unclassified 910
338 Ga0501234_001814 3300049707 Bacteria 3373
339 Ga0501234_004137 3300049707 Unclassified 2278
340 Ga0501079_0471244 3300049741 Unclassified 987
341 Ga0501266_020787 3300049763 Unclassified 895
342 Ga0501274_012027 3300049771 Unclassified 816
343 Ga0501204_011930 3300049850 Unclassified 1037
344 Ga0501212_000740 3300049851 Bacteria 3348
345 Ga0501226_001292 3300049853 Bacteria 3243
346 nmdc:mga05p37_1349189_c1 3300050507 Unclassified 723
347 nmdc:mga05p37_7655_c1 3300050507 Bacteria 12743
348 nmdc:mga05p37_8894_c1 3300050507 Bacteria 11865
349 nmdc:mga09592_46494_c1 3300050508 Bacteria 3656
350 nmdc:mga09592_908414_c1 3300050508 Unclassified 740
351 nmdc:mga08y16_1563_c1 3300050511 Bacteria 23088
352 nmdc:mga08y16_356536_c1 3300050511 Bacteria 1502
353 nmdc:mga0n895_1097679_c1 3300050512 Bacteria 773
354 nmdc:mga0n895_114860_c1 3300050512 Bacteria 2710
355 nmdc:mga0n895_32336_c1 3300050512 Bacteria 5021
356 nmdc:mga0n895_379612_c1 3300050512 Bacteria 1430
357 nmdc:mga0n895_663074_c1 3300050512 Unclassified 1041
358 nmdc:mga0rr50_817809_c1 3300050513 Bacteria 795
359 nmdc:mga0a205_141373_c1 3300050515 Bacteria 2307
360 nmdc:mga0a205_195410_c1 3300050515 Bacteria 1914
361 nmdc:mga0a205_22765_c1 3300050515 Bacteria 5216
362 nmdc:mga0a205_386616_c1 3300050515 Unclassified 1264
363 nmdc:mga0a205_4174_c1 3300050515 Bacteria 12946
364 nmdc:mga0a205_44994_c1 3300050515 Unclassified 4257
365 nmdc:mga0a205_625616_c1 3300050515 Bacteria 929
366 nmdc:mga0a205_90131_c2 3300050515 Bacteria 1566
367 nmdc:mga0a205_913364_c1 3300050515 Bacteria 725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031852 Ga0307410_10440537 Ga0307410_104405372 162
2 3300049652 Ga0501202_084691 Ga0501202_084691_122_643 163
3 3300005354 Ga0070675_101303399 Ga0070675_1013033991 165
4 3300006847 Ga0075431_100108379 Ga0075431_1001083793 165
5 3300006880 Ga0075429_100086420 Ga0075429_1000864206 165
6 3300009147 Ga0114129_10016771 Ga0114129_100167718 165
7 3300025941 Ga0207711_10059969 Ga0207711_100599694 165
8 3300009147 Ga0114129_10197658 Ga0114129_101976584 169
9 3300050515 nmdc:mga0a205_141373_c1 nmdc:mga0a205_141373_c1_1508_2041 169
10 3300050515 nmdc:mga0a205_913364_c1 nmdc:mga0a205_913364_c1_81_608 169
11 3300005458 Ga0070681_10410162 Ga0070681_104101622 170
12 3300005577 Ga0068857_100203464 Ga0068857_1002034643 170
13 3300025912 Ga0207707_10141665 Ga0207707_101416654 170
14 3300025939 Ga0207665_10000007 Ga0207665_1000000771 170
15 3300005330 Ga0070690_100361641 Ga0070690_1003616412 171
16 3300005340 Ga0070689_101015172 Ga0070689_1010151721 171
17 3300005343 Ga0070687_101119023 Ga0070687_1011190231 171
18 3300005354 Ga0070675_100028995 Ga0070675_1000289955 171
19 3300005364 Ga0070673_100523740 Ga0070673_1005237401 171
20 3300005365 Ga0070688_100045547 Ga0070688_1000455474 171
21 3300005440 Ga0070705_100050051 Ga0070705_1000500511 171
22 3300005441 Ga0070700_100475959 Ga0070700_1004759591 171
23 3300005535 Ga0070684_100818046 Ga0070684_1008180462 171
24 3300005544 Ga0070686_100266865 Ga0070686_1002668651 171
25 3300005617 Ga0068859_100060068 Ga0068859_10006006810 171
26 3300005617 Ga0068859_101134242 Ga0068859_1011342421 171
27 3300005618 Ga0068864_100913143 Ga0068864_1009131432 171
28 3300005719 Ga0068861_100141621 Ga0068861_1001416213 171
29 3300005840 Ga0068870_10177121 Ga0068870_101771211 171
30 3300005985 Ga0081539_10000215 Ga0081539_1000021535 171
31 3300006844 Ga0075428_100053553 Ga0075428_1000535536 171
32 3300006852 Ga0075433_10043693 Ga0075433_100436934 171
33 3300006871 Ga0075434_100053921 Ga0075434_1000539217 171
34 3300006880 Ga0075429_100184751 Ga0075429_1001847511 171
35 3300006931 Ga0097620_100060063 Ga0097620_10006006310 171
36 3300006931 Ga0097620_101134172 Ga0097620_1011341721 171
37 3300009094 Ga0111539_10239155 Ga0111539_102391554 171
38 3300009147 Ga0114129_10011672 Ga0114129_1001167214 171
39 3300013296 Ga0157374_10919085 Ga0157374_109190851 171
40 3300013297 Ga0157378_10425310 Ga0157378_104253101 171
41 3300013308 Ga0157375_11541049 Ga0157375_115410491 171
42 3300014326 Ga0157380_10439017 Ga0157380_104390172 171
43 3300014745 Ga0157377_10083459 Ga0157377_100834593 171
44 3300014968 Ga0157379_10186885 Ga0157379_101868854 171
45 3300014969 Ga0157376_11308923 Ga0157376_113089232 171
46 3300025918 Ga0207662_10030690 Ga0207662_100306905 171
47 3300025936 Ga0207670_10020048 Ga0207670_100200487 171
48 3300025940 Ga0207691_10051808 Ga0207691_100518084 171
49 3300025960 Ga0207651_10723635 Ga0207651_107236351 171
50 3300026075 Ga0207708_10048452 Ga0207708_100484524 171
51 3300026088 Ga0207641_10129769 Ga0207641_101297693 171
52 3300026095 Ga0207676_10136466 Ga0207676_101364663 171
53 3300026121 Ga0207683_10100053 Ga0207683_101000533 171
54 3300045051 Ga0451576_0032816 Ga0451576_0032816_4089_4619 171
55 3300048912 Ga0496109_0736073 Ga0496109_0736073_303_833 171
56 3300050507 nmdc:mga05p37_7655_c1 nmdc:mga05p37_7655_c1_10344_10874 171
57 3300050508 nmdc:mga09592_46494_c1 nmdc:mga09592_46494_c1_1518_2048 171
58 3300050508 nmdc:mga09592_908414_c1 nmdc:mga09592_908414_c1_131_661 171
59 3300050512 nmdc:mga0n895_114860_c1 nmdc:mga0n895_114860_c1_613_1143 171
60 3300050515 nmdc:mga0a205_22765_c1 nmdc:mga0a205_22765_c1_3846_4376 171
61 3300050515 nmdc:mga0a205_90131_c2 nmdc:mga0a205_90131_c2_377_907 171
62 3300003203 JGI25406J46586_10065752 JGI25406J46586_100657521 172
63 3300005334 Ga0068869_100012954 Ga0068869_1000129543 172
64 3300005338 Ga0068868_100060435 Ga0068868_1000604352 172
65 3300005356 Ga0070674_100974608 Ga0070674_1009746081 172
66 3300005543 Ga0070672_101159927 Ga0070672_1011599271 172
67 3300005578 Ga0068854_100181624 Ga0068854_1001816242 172
68 3300005615 Ga0070702_100221880 Ga0070702_1002218802 172
69 3300005615 Ga0070702_100384302 Ga0070702_1003843022 172
70 3300005618 Ga0068864_100908667 Ga0068864_1009086671 172
71 3300005719 Ga0068861_100005204 Ga0068861_1000052044 172
72 3300005719 Ga0068861_100463668 Ga0068861_1004636683 172
73 3300005985 Ga0081539_10002622 Ga0081539_100026221 172
74 3300006852 Ga0075433_10035189 Ga0075433_100351899 172
75 3300006852 Ga0075433_10327655 Ga0075433_103276552 172
76 3300006871 Ga0075434_100049779 Ga0075434_1000497794 172
77 3300009093 Ga0105240_10345371 Ga0105240_103453712 172
78 3300009098 Ga0105245_10134811 Ga0105245_101348114 172
79 3300009101 Ga0105247_10000050 Ga0105247_1000005041 172
80 3300009147 Ga0114129_11675417 Ga0114129_116754171 172
81 3300009176 Ga0105242_10599143 Ga0105242_105991432 172
82 3300010375 Ga0105239_10002786 Ga0105239_100027864 172
83 3300013297 Ga0157378_10029457 Ga0157378_100294579 172
84 3300013297 Ga0157378_10031462 Ga0157378_100314624 172
85 3300013306 Ga0163162_10006887 Ga0163162_100068879 172
86 3300014326 Ga0157380_10360398 Ga0157380_103603982 172
87 3300025901 Ga0207688_10041732 Ga0207688_100417324 172
88 3300025927 Ga0207687_10058443 Ga0207687_100584434 172
89 3300025935 Ga0207709_10171777 Ga0207709_101717772 172
90 3300025942 Ga0207689_10004377 Ga0207689_100043779 172
91 3300025942 Ga0207689_10200889 Ga0207689_102008893 172
92 3300026118 Ga0207675_100004141 Ga0207675_10000414112 172
93 3300028381 Ga0268264_10089133 Ga0268264_100891334 172
94 3300031731 Ga0307405_10024514 Ga0307405_100245145 172
95 3300031824 Ga0307413_10042259 Ga0307413_100422594 172
96 3300031901 Ga0307406_10004268 Ga0307406_100042684 172
97 3300031903 Ga0307407_10134788 Ga0307407_101347881 172
98 3300031911 Ga0307412_10032755 Ga0307412_100327556 172
99 3300032002 Ga0307416_100035654 Ga0307416_1000356546 172
100 3300032004 Ga0307414_10047076 Ga0307414_100470763 172
101 3300032005 Ga0307411_10029931 Ga0307411_100299314 172
102 3300032126 Ga0307415_100005096 Ga0307415_1000050963 172
103 3300035088 Ga0373940_0049466 Ga0373940_0049466_159_704 172
104 3300035241 Ga0373961_0221340 Ga0373961_0221340_93_641 172
105 3300035691 Ga0373931_0154121 Ga0373931_0154121_661_1209 172
106 3300039437 Ga0436365_1676880 Ga0436365_1676880_2020_2562 172
107 3300039453 Ga0436362_0570694 Ga0436362_0570694_110_628 172
108 3300042012 Ga0439455_0006113 Ga0439455_0006113_1725_2267 172
109 3300042157 Ga0439458_0001201 Ga0439458_0001201_4481_5023 172
110 3300042876 Ga0451577_0067716 Ga0451577_0067716_2120_2656 172
111 3300042876 Ga0451577_0701648 Ga0451577_0701648_285_821 172
112 3300044673 Ga0453683_0027128 Ga0453683_0027128_1155_1691 172
113 3300044712 Ga0453684_0239962 Ga0453684_0239962_566_1102 172
114 3300045051 Ga0451576_0212422 Ga0451576_0212422_1046_1582 172
115 3300049522 Ga0501299_012799 Ga0501299_012799_563_1111 172
116 3300049649 Ga0501198_000148 Ga0501198_000148_4287_4835 172
117 3300049653 Ga0501206_003032 Ga0501206_003032_1148_1696 172
118 3300049654 Ga0501207_005802 Ga0501207_005802_374_922 172
119 3300049656 Ga0501209_001471 Ga0501209_001471_1262_1810 172
120 3300049663 Ga0501223_000930 Ga0501223_000930_3644_4192 172
121 3300049664 Ga0501224_002107 Ga0501224_002107_1700_2248 172
122 3300049665 Ga0501227_000312 Ga0501227_000312_4832_5380 172
123 3300049667 Ga0501230_019033 Ga0501230_019033_184_732 172
124 3300049668 Ga0501233_001030 Ga0501233_001030_86_634 172
125 3300049674 Ga0501242_001682 Ga0501242_001682_1501_2049 172
126 3300049675 Ga0501243_061468 Ga0501243_061468_85_633 172
127 3300049685 Ga0501256_008321 Ga0501256_008321_118_666 172
128 3300049707 Ga0501234_001814 Ga0501234_001814_1570_2118 172
129 3300049850 Ga0501204_011930 Ga0501204_011930_429_977 172
130 3300049851 Ga0501212_000740 Ga0501212_000740_1117_1665 172
131 3300049853 Ga0501226_001292 Ga0501226_001292_1145_1693 172
132 3300050512 nmdc:mga0n895_1097679_c1 nmdc:mga0n895_1097679_c1_161_709 172
133 3300050512 nmdc:mga0n895_32336_c1 nmdc:mga0n895_32336_c1_837_1373 172
134 3300050513 nmdc:mga0rr50_817809_c1 nmdc:mga0rr50_817809_c1_200_736 172
135 3300050515 nmdc:mga0a205_44994_c1 nmdc:mga0a205_44994_c1_662_1198 172
136 3300050515 nmdc:mga0a205_625616_c1 nmdc:mga0a205_625616_c1_367_915 172
137 3300005547 Ga0070693_100185053 Ga0070693_1001850532 173
138 3300005617 Ga0068859_100695543 Ga0068859_1006955431 173
139 3300005618 Ga0068864_100745502 Ga0068864_1007455022 173
140 3300005841 Ga0068863_100503750 Ga0068863_1005037502 173
141 3300005841 Ga0068863_101288313 Ga0068863_1012883132 173
142 3300006931 Ga0097620_100447599 Ga0097620_1004475991 173
143 3300006931 Ga0097620_100695511 Ga0097620_1006955111 173
144 3300011119 Ga0105246_10140986 Ga0105246_101409863 173
145 3300011119 Ga0105246_10221301 Ga0105246_102213013 173
146 3300025908 Ga0207643_10000740 Ga0207643_1000074013 173
147 3300026089 Ga0207648_10086876 Ga0207648_100868762 173
148 3300028380 Ga0268265_10306616 Ga0268265_103066162 173
149 3300028381 Ga0268264_10034076 Ga0268264_100340764 173
150 3300050511 nmdc:mga08y16_356536_c1 nmdc:mga08y16_356536_c1_595_1116 173
151 3300005467 Ga0070706_100000146 Ga0070706_10000014627 174
152 3300025910 Ga0207684_10000327 Ga0207684_100003279 174
153 3300037418 Ga0395900_0224856 Ga0395900_0224856_33_569 174
154 3300037466 Ga0395898_0098946 Ga0395898_0098946_695_1222 174
155 3300037466 Ga0395898_1541446 Ga0395898_1541446_36_572 174
156 3300049741 Ga0501079_0471244 Ga0501079_0471244_249_794 174
157 3300050515 nmdc:mga0a205_386616_c1 nmdc:mga0a205_386616_c1_288_824 174
158 3300005330 Ga0070690_100283543 Ga0070690_1002835432 175
159 3300005339 Ga0070660_100024251 Ga0070660_1000242512 175
160 3300005340 Ga0070689_100243028 Ga0070689_1002430282 175
161 3300005343 Ga0070687_100299416 Ga0070687_1002994161 175
162 3300005344 Ga0070661_100019273 Ga0070661_1000192735 175
163 3300005354 Ga0070675_100409157 Ga0070675_1004091572 175
164 3300005364 Ga0070673_100619834 Ga0070673_1006198341 175
165 3300005458 Ga0070681_10088404 Ga0070681_100884044 175
166 3300005467 Ga0070706_100043093 Ga0070706_1000430931 175
167 3300005539 Ga0068853_100002135 Ga0068853_1000021356 175
168 3300005563 Ga0068855_100097103 Ga0068855_1000971035 175
169 3300005564 Ga0070664_100003045 Ga0070664_1000030452 175
170 3300005577 Ga0068857_100025360 Ga0068857_1000253606 175
171 3300005617 Ga0068859_100032529 Ga0068859_1000325295 175
172 3300005617 Ga0068859_100928270 Ga0068859_1009282702 175
173 3300005618 Ga0068864_100206515 Ga0068864_1002065153 175
174 3300005719 Ga0068861_100269772 Ga0068861_1002697723 175
175 3300005834 Ga0068851_10142315 Ga0068851_101423151 175
176 3300005843 Ga0068860_100009979 Ga0068860_1000099797 175
177 3300006237 Ga0097621_100045765 Ga0097621_1000457654 175
178 3300006931 Ga0097620_100032531 Ga0097620_1000325315 175
179 3300006931 Ga0097620_100928252 Ga0097620_1009282521 175
180 3300009545 Ga0105237_10698356 Ga0105237_106983562 175
181 3300010375 Ga0105239_11371857 Ga0105239_113718571 175
182 3300013306 Ga0163162_10077251 Ga0163162_100772512 175
183 3300013308 Ga0157375_10110813 Ga0157375_101108131 175
184 3300014325 Ga0163163_10003114 Ga0163163_100031142 175
185 3300014325 Ga0163163_10031350 Ga0163163_100313502 175
186 3300025912 Ga0207707_10249112 Ga0207707_102491121 175
187 3300025919 Ga0207657_10034767 Ga0207657_100347671 175
188 3300025920 Ga0207649_10076153 Ga0207649_100761534 175
189 3300025932 Ga0207690_10051505 Ga0207690_100515054 175
190 3300025933 Ga0207706_10348355 Ga0207706_103483552 175
191 3300025936 Ga0207670_10339963 Ga0207670_103399632 175
192 3300025942 Ga0207689_10242222 Ga0207689_102422221 175
193 3300025945 Ga0207679_10026777 Ga0207679_100267772 175
194 3300025949 Ga0207667_10169106 Ga0207667_101691064 175
195 3300025949 Ga0207667_11167801 Ga0207667_111678011 175
196 3300025960 Ga0207651_10847461 Ga0207651_108474611 175
197 3300026041 Ga0207639_10012628 Ga0207639_100126286 175
198 3300026089 Ga0207648_10095637 Ga0207648_100956371 175
199 3300026116 Ga0207674_10000129 Ga0207674_1000012922 175
200 3300028381 Ga0268264_10018706 Ga0268264_100187068 175
201 3300041406 Ga0439439_0033992 Ga0439439_0033992_450_1001 175
202 2162886007 SwRhRL2b_contig_1491579 SwRhRL2b_0400.00006990 176
203 3300001432 JGI24034J14986_100683 JGI24034J14986_1006832 176
204 3300002074 JGI24748J21848_1000014 JGI24748J21848_100001442 176
205 3300002239 JGI24034J26672_10000012 JGI24034J26672_1000001282 176
206 3300005289 Ga0065704_10107363 Ga0065704_101073633 176
207 3300005295 Ga0065707_10193015 Ga0065707_101930153 176
208 3300005330 Ga0070690_100006648 Ga0070690_1000066486 176
209 3300005331 Ga0070670_100010853 Ga0070670_1000108536 176
210 3300005340 Ga0070689_100544903 Ga0070689_1005449031 176
211 3300005343 Ga0070687_100839553 Ga0070687_1008395531 176
212 3300005344 Ga0070661_100257575 Ga0070661_1002575752 176
213 3300005353 Ga0070669_100076331 Ga0070669_1000763312 176
214 3300005355 Ga0070671_100052859 Ga0070671_1000528593 176
215 3300005356 Ga0070674_100538505 Ga0070674_1005385051 176
216 3300005364 Ga0070673_100006061 Ga0070673_1000060614 176
217 3300005366 Ga0070659_100283669 Ga0070659_1002836691 176
218 3300005438 Ga0070701_10077865 Ga0070701_100778654 176
219 3300005440 Ga0070705_100201697 Ga0070705_1002016971 176
220 3300005441 Ga0070700_100007003 Ga0070700_1000070037 176
221 3300005444 Ga0070694_100079625 Ga0070694_1000796253 176
222 3300005444 Ga0070694_100364787 Ga0070694_1003647872 176
223 3300005445 Ga0070708_100498506 Ga0070708_1004985061 176
224 3300005458 Ga0070681_10002994 Ga0070681_100029945 176
225 3300005518 Ga0070699_100108095 Ga0070699_1001080952 176
226 3300005539 Ga0068853_100084673 Ga0068853_1000846735 176
227 3300005546 Ga0070696_100030448 Ga0070696_1000304481 176
228 3300005546 Ga0070696_100208689 Ga0070696_1002086892 176
229 3300005546 Ga0070696_100528910 Ga0070696_1005289102 176
230 3300005547 Ga0070693_100019502 Ga0070693_1000195028 176
231 3300005547 Ga0070693_100096318 Ga0070693_1000963184 176
232 3300005547 Ga0070693_100409790 Ga0070693_1004097901 176
233 3300005549 Ga0070704_100051106 Ga0070704_1000511063 176
234 3300005577 Ga0068857_100033672 Ga0068857_1000336722 176
235 3300005577 Ga0068857_100764637 Ga0068857_1007646372 176
236 3300005578 Ga0068854_100191222 Ga0068854_1001912222 176
237 3300005617 Ga0068859_100000465 Ga0068859_1000004651 176
238 3300005617 Ga0068859_100086410 Ga0068859_1000864102 176
239 3300005617 Ga0068859_100127271 Ga0068859_1001272712 176
240 3300005617 Ga0068859_100167145 Ga0068859_1001671453 176
241 3300005617 Ga0068859_100325217 Ga0068859_1003252172 176
242 3300005617 Ga0068859_100365249 Ga0068859_1003652493 176
243 3300005617 Ga0068859_100671396 Ga0068859_1006713962 176
244 3300005718 Ga0068866_10281302 Ga0068866_102813021 176
245 3300005841 Ga0068863_100294763 Ga0068863_1002947632 176
246 3300005842 Ga0068858_100000194 Ga0068858_10000019419 176
247 3300005842 Ga0068858_100182390 Ga0068858_1001823901 176
248 3300005842 Ga0068858_100566931 Ga0068858_1005669313 176
249 3300005843 Ga0068860_100011713 Ga0068860_1000117136 176
250 3300005843 Ga0068860_100058430 Ga0068860_1000584307 176
251 3300005843 Ga0068860_100062352 Ga0068860_1000623524 176
252 3300005843 Ga0068860_100253924 Ga0068860_1002539241 176
253 3300005844 Ga0068862_100073717 Ga0068862_1000737175 176
254 3300005844 Ga0068862_100758123 Ga0068862_1007581232 176
255 3300006852 Ga0075433_10008179 Ga0075433_100081796 176
256 3300006852 Ga0075433_10085727 Ga0075433_100857274 176
257 3300006852 Ga0075433_10331210 Ga0075433_103312102 176
258 3300006871 Ga0075434_100291628 Ga0075434_1002916281 176
259 3300006871 Ga0075434_100719921 Ga0075434_1007199211 176
260 3300006931 Ga0097620_100000465 Ga0097620_1000004651 176
261 3300006931 Ga0097620_100086412 Ga0097620_1000864122 176
262 3300006931 Ga0097620_100099076 Ga0097620_1000990764 176
263 3300006931 Ga0097620_100127265 Ga0097620_1001272652 176
264 3300006931 Ga0097620_100167142 Ga0097620_1001671423 176
265 3300006931 Ga0097620_100325208 Ga0097620_1003252082 176
266 3300006931 Ga0097620_100365238 Ga0097620_1003652383 176
267 3300006931 Ga0097620_100671431 Ga0097620_1006714312 176
268 3300009093 Ga0105240_10136976 Ga0105240_101369764 176
269 3300009093 Ga0105240_10447357 Ga0105240_104473571 176
270 3300009094 Ga0111539_10000643 Ga0111539_1000064311 176
271 3300009094 Ga0111539_10054193 Ga0111539_100541933 176
272 3300009094 Ga0111539_11355183 Ga0111539_113551831 176
273 3300009101 Ga0105247_10229249 Ga0105247_102292492 176
274 3300009147 Ga0114129_10080066 Ga0114129_100800664 176
275 3300009147 Ga0114129_11037946 Ga0114129_110379461 176
276 3300009148 Ga0105243_10141532 Ga0105243_101415322 176
277 3300009148 Ga0105243_10982363 Ga0105243_109823631 176
278 3300009148 Ga0105243_11108332 Ga0105243_111083321 176
279 3300009148 Ga0105243_11212744 Ga0105243_112127441 176
280 3300009148 Ga0105243_11436592 Ga0105243_114365921 176
281 3300009174 Ga0105241_10179489 Ga0105241_101794892 176
282 3300009176 Ga0105242_10020415 Ga0105242_100204151 176
283 3300009177 Ga0105248_10241673 Ga0105248_102416731 176
284 3300009551 Ga0105238_10017969 Ga0105238_100179693 176
285 3300009551 Ga0105238_10837569 Ga0105238_108375692 176
286 3300009553 Ga0105249_10021096 Ga0105249_100210963 176
287 3300009553 Ga0105249_10073753 Ga0105249_100737534 176
288 3300009553 Ga0105249_10282134 Ga0105249_102821342 176
289 3300010375 Ga0105239_10184183 Ga0105239_101841832 176
290 3300010375 Ga0105239_10496628 Ga0105239_104966281 176
291 3300011119 Ga0105246_10520359 Ga0105246_105203591 176
292 3300013297 Ga0157378_10776362 Ga0157378_107763621 176
293 3300013306 Ga0163162_10064439 Ga0163162_100644395 176
294 3300013307 Ga0157372_10014831 Ga0157372_100148316 176
295 3300013307 Ga0157372_10721437 Ga0157372_107214371 176
296 3300014325 Ga0163163_10007741 Ga0163163_100077419 176
297 3300014326 Ga0157380_10129134 Ga0157380_101291342 176
298 3300014968 Ga0157379_10153237 Ga0157379_101532371 176
299 3300025223 Ga0207672_1000212 Ga0207672_10002129 176
300 3300025900 Ga0207710_10000003 Ga0207710_10000003831 176
301 3300025900 Ga0207710_10001694 Ga0207710_1000169410 176
302 3300025912 Ga0207707_10057565 Ga0207707_100575654 176
303 3300025913 Ga0207695_10097879 Ga0207695_100978795 176
304 3300025914 Ga0207671_10081712 Ga0207671_100817121 176
305 3300025920 Ga0207649_10615220 Ga0207649_106152201 176
306 3300025923 Ga0207681_10452804 Ga0207681_104528042 176
307 3300025924 Ga0207694_10010187 Ga0207694_100101873 176
308 3300025925 Ga0207650_10000143 Ga0207650_1000014327 176
309 3300025931 Ga0207644_10000093 Ga0207644_1000009321 176
310 3300025932 Ga0207690_10985334 Ga0207690_109853341 176
311 3300025934 Ga0207686_10106099 Ga0207686_101060993 176
312 3300025935 Ga0207709_10239012 Ga0207709_102390121 176
313 3300025935 Ga0207709_10342010 Ga0207709_103420102 176
314 3300025935 Ga0207709_10628035 Ga0207709_106280351 176
315 3300025941 Ga0207711_10054358 Ga0207711_100543582 176
316 3300025942 Ga0207689_10074365 Ga0207689_100743655 176
317 3300025942 Ga0207689_10113632 Ga0207689_101136323 176
318 3300025961 Ga0207712_10002809 Ga0207712_100028099 176
319 3300025961 Ga0207712_10045193 Ga0207712_100451934 176
320 3300025981 Ga0207640_10330901 Ga0207640_103309011 176
321 3300026035 Ga0207703_10000225 Ga0207703_1000022544 176
322 3300026035 Ga0207703_10087544 Ga0207703_100875442 176
323 3300026035 Ga0207703_10138448 Ga0207703_101384483 176
324 3300026035 Ga0207703_10450519 Ga0207703_104505191 176
325 3300026035 Ga0207703_10520817 Ga0207703_105208172 176
326 3300026035 Ga0207703_10780080 Ga0207703_107800802 176
327 3300026075 Ga0207708_10000499 Ga0207708_1000049916 176
328 3300026075 Ga0207708_10127427 Ga0207708_101274273 176
329 3300026089 Ga0207648_10055185 Ga0207648_100551857 176
330 3300026095 Ga0207676_10247204 Ga0207676_102472042 176
331 3300026116 Ga0207674_10480477 Ga0207674_104804771 176
332 3300026116 Ga0207674_10495772 Ga0207674_104957722 176
333 3300026118 Ga0207675_100254755 Ga0207675_1002547551 176
334 3300027907 Ga0207428_10001094 Ga0207428_1000109412 176
335 3300028380 Ga0268265_10114898 Ga0268265_101148984 176
336 3300028381 Ga0268264_10023744 Ga0268264_100237444 176
337 3300028381 Ga0268264_10049893 Ga0268264_100498933 176
338 3300028381 Ga0268264_10214688 Ga0268264_102146882 176
339 3300031548 Ga0307408_100179496 Ga0307408_1001794962 176
340 3300035207 Ga0373942_0006450 Ga0373942_0006450_2137_2685 176
341 3300045051 Ga0451576_0737683 Ga0451576_0737683_275_832 176
342 3300048906 Ga0496103_0471271 Ga0496103_0471271_170_778 176
343 3300048909 Ga0496106_0126526 Ga0496106_0126526_432_1010 176
344 3300048915 Ga0496112_0333441 Ga0496112_0333441_371_931 176
345 3300048915 Ga0496112_0622652 Ga0496112_0622652_402_941 176
346 3300049515 Ga0501292_041540 Ga0501292_041540_76_678 176
347 3300049522 Ga0501299_058772 Ga0501299_058772_62_607 176
348 3300049660 Ga0501216_009755 Ga0501216_009755_622_1167 176
349 3300049663 Ga0501223_049072 Ga0501223_049072_164_805 176
350 3300049668 Ga0501233_088498 Ga0501233_088498_14_559 176
351 3300049679 Ga0501249_048206 Ga0501249_048206_32_586 176
352 3300049679 Ga0501249_063892 Ga0501249_063892_280_840 176
353 3300049683 Ga0501253_050272 Ga0501253_050272_98_700 176
354 3300049704 Ga0501221_003154 Ga0501221_003154_631_1176 176
355 3300049705 Ga0501225_0011418 Ga0501225_0011418_1625_2266 176
356 3300049705 Ga0501225_0108970 Ga0501225_0108970_157_720 176
357 3300049706 Ga0501229_018683 Ga0501229_018683_127_672 176
358 3300049707 Ga0501234_004137 Ga0501234_004137_1120_1674 176
359 3300049763 Ga0501266_020787 Ga0501266_020787_132_734 176
360 3300049771 Ga0501274_012027 Ga0501274_012027_202_804 176
361 3300050507 nmdc:mga05p37_1349189_c1 nmdc:mga05p37_1349189_c1_95_640 176
362 3300050507 nmdc:mga05p37_8894_c1 nmdc:mga05p37_8894_c1_5212_5769 176
363 3300050511 nmdc:mga08y16_1563_c1 nmdc:mga08y16_1563_c1_9633_10202 176
364 3300050512 nmdc:mga0n895_379612_c1 nmdc:mga0n895_379612_c1_225_782 176
365 3300050512 nmdc:mga0n895_663074_c1 nmdc:mga0n895_663074_c1_391_960 176
366 3300050515 nmdc:mga0a205_195410_c1 nmdc:mga0a205_195410_c1_184_741 176
367 3300050515 nmdc:mga0a205_4174_c1 nmdc:mga0a205_4174_c1_2901_3431 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

48

187

0.92

PF12867

DinB_2

DinB superfamily

52

179

0.88

PF07609

DUF1572

Protein of unknown function (DUF1572)

38

199

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8171 12 155
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7994 15 159
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7908 11 151
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.781 15 159
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7776 11 151
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7646 6 154 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7539 13 148 1.20.120.450
2p1aA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7464 12 151 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7444 7 149 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7374 24 152 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A3D0Q9L4-F1-model_v4 DUF1572 domain-containing protein 0.9857 6 162
AF-A0A2V8NX50-F1-model_v4 DUF1572 domain-containing protein 0.9829 9 159
AF-A0A7W1W6A7-F1-model_v4 DUF1572 family protein 0.9815 6 164
AF-A0A2V8L2F7-F1-model_v4 DUF1572 domain-containing protein 0.9815 9 162
AF-A0A3C0ZM80-F1-model_v4 DUF1572 domain-containing protein 0.9805 1 162

Feature Viewer

pLDDT pTM Quality
89.27 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map