F424139

General Info

Members Datasets Scaffolds Average Seq Length
366 248 274 276

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0006995|Ga0496116_0006995_2146_3108
Length 320
Sequence LPDRYQPGRFAVGLAQPALDVRPVLKSNHSRRKSLRINPRSKPMHTVTANGATIPALGFGTFRVPGSDVLRIVPKALKTGFRHIDTAQIYGNEAEVGEAIAGSGITRGDIFLTTKVWVDKYKRDAFVTSVDESLHKLKTDYVDLLLLHWPNDAVPLAEQIGALNEVKEAGKVRNIGVSNFNTALMAQSVSLSKAPIVTNQIEYHPYLNQDVVIAEAKKSGMSITSYFAMADGKVFADPVLKDIAANHGKSVAQVVLRWLVQQDGVIALSKTVTEARLAENAAIFDFALSSEEMAAIHALSKADGRIVSPDGLAPVWDAAV

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
5 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
6 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
7 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
8 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
9 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
10 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
11 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
12 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
13 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
14 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
15 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
16 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
17 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
18 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
19 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
20 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
21 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
22 2643221582 Rhizobium sp. Root651 Isolate Unclassified
23 2643221599 Rhizobium sp. Root708 Isolate Unclassified
24 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
25 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
26 2643221693 Rhizobium sp. Root491 Isolate Unclassified
27 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
28 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
29 2751185800 Brucella pituitosa AA2 Isolate Unclassified
30 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
31 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
32 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
33 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
34 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
35 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
36 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
37 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
38 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
39 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
40 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
41 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
42 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
43 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
44 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
45 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
46 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
47 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
48 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
49 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
50 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
51 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
52 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
53 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
54 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
55 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
56 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
57 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
58 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
59 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
60 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
61 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
62 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
63 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
64 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
65 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
66 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
67 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
68 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
69 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
70 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
71 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
72 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
73 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
74 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
75 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
76 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
77 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
78 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
79 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
80 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
81 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
82 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
83 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
84 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
85 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
86 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
87 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
88 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
89 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
90 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
91 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
92 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
93 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
94 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
95 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
98 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
99 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
100 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
101 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
102 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
103 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
104 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
105 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
155 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
222 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
236 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
237 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
238 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
245 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
246 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
247 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
248 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 74.86
Metatranscriptomes 0
Isolates 25.14

Biome Distribution

Category Percentage (%)
Aerial Root 1.09
Bulb 0
Endosphere 20.49
Nodule 6.83
Rhizoplane 3.83
Rhizosphere 38.8
Stem 0
Stem Tuber 0
Unclassified 28.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001126 3300002773 Bacteria 12451
2 JGI25150J39212_1000219 3300002774 Bacteria 31283
3 JGI25150J39212_1009186 3300002774 Bacteria 1897
4 JGI25159J45721_1000451 3300002987 Bacteria 19016
5 JGI25159J45721_1021014 3300002987 Bacteria 1242
6 JGI25151J46595_10000007 3300003187 Bacteria 411751
7 JGI25151J46595_10002780 3300003187 Bacteria 10143
8 JGI25151J46595_10025566 3300003187 Bacteria 2399
9 JGI25153J46596_10000254 3300003215 Bacteria 43730
10 JGI25153J46596_10003776 3300003215 Bacteria 8362
11 JGI25153J46596_10015608 3300003215 Bacteria 3084
12 rootH2_10141006 3300003320 Bacteria 2720
13 rootL2_10132381 3300003322 Bacteria 3171
14 rootL2_10272801 3300003322 Bacteria 1562
15 rootH1_10006849 3300003323 Bacteria 11809
16 JGI25160J50197_1007628 3300003354 Bacteria 4216
17 JGI25161J50226_1000211 3300003374 Bacteria 37205
18 Ga0055526_1004787 3300003771 Bacteria 8014
19 Ga0055528_1001376 3300003790 Bacteria 14935
20 Ga0055540_1022043 3300003792 Bacteria 1638
21 Ga0058692_1001275 3300003856 Bacteria 9566
22 Ga0058692_1004320 3300003856 Bacteria 4229
23 Ga0055543_1000328 3300004625 Bacteria 32632
24 Ga0065165_1009775 3300005262 Bacteria 4242
25 Ga0065165_1014389 3300005262 Bacteria 3075
26 Ga0070658_10376568 3300005327 Unclassified 1217
27 Ga0070711_100092976 3300005439 Bacteria 2177
28 Ga0070665_100005758 3300005548 Bacteria 12725
29 Ga0068855_100033703 3300005563 Bacteria 6110
30 Ga0070717_10205228 3300006028 Bacteria 1728
31 Ga0075368_10026537 3300006042 Bacteria 2228
32 Ga0075363_100332035 3300006048 Bacteria 886
33 Ga0070716_100287865 3300006173 Bacteria 1137
34 Ga0070712_100256777 3300006175 Bacteria 1399
35 Ga0075362_10080905 3300006177 Bacteria 1497
36 Ga0075367_10019987 3300006178 Bacteria 3723
37 Ga0075369_10003451 3300006186 Bacteria 5757
38 Ga0075369_10010064 3300006186 Bacteria 3693
39 Ga0075370_10178003 3300006353 Bacteria 1251
40 Ga0099826_10000063 3300006948 Bacteria 61637
41 Ga0099826_10130721 3300006948 Bacteria 1464
42 Ga0105240_10000298 3300009093 Bacteria 96724
43 Ga0105243_10056939 3300009148 Bacteria 3111
44 Ga0105239_10000044 3300010375 Bacteria 187680
45 Ga0157373_10045600 3300013100 Bacteria 3129
46 Ga0157371_10000966 3300013102 Bacteria 31904
47 Ga0157370_10000338 3300013104 Bacteria 59035
48 Ga0209436_100027 3300025208 Bacteria 87534
49 Ga0207425_1000018 3300025245 Bacteria 411841
50 Ga0207425_1006794 3300025245 Bacteria 3091
51 Ga0209129_1000026 3300025258 Bacteria 411839
52 Ga0209129_1001033 3300025258 Bacteria 16529
53 Ga0209129_1003149 3300025258 Bacteria 7394
54 Ga0209673_1002532 3300025273 Bacteria 12512
55 Ga0209673_1003179 3300025273 Bacteria 9996
56 Ga0209130_1000030 3300025284 Bacteria 323323
57 Ga0209130_1000473 3300025284 Bacteria 41414
58 Ga0209025_1000035 3300025294 Bacteria 411841
59 Ga0209025_1000662 3300025294 Bacteria 59654
60 Ga0209025_1005472 3300025294 Bacteria 10337
61 Ga0209025_1024560 3300025294 Bacteria 3105
62 Ga0209564_1000364 3300025295 Bacteria 84138
63 Ga0209758_1000040 3300025297 Bacteria 411841
64 Ga0209758_1002926 3300025297 Bacteria 16452
65 Ga0209758_1009631 3300025297 Bacteria 5957
66 Ga0209758_1014204 3300025297 Bacteria 4259
67 Ga0209256_1004405 3300025299 Bacteria 8869
68 Ga0207426_1000047 3300025302 Bacteria 417011
69 Ga0207426_1000317 3300025302 Bacteria 94070
70 Ga0209051_1002867 3300025303 Bacteria 11861
71 Ga0209257_1024730 3300025304 Bacteria 2071
72 Ga0207695_10000294 3300025913 Bacteria 123676
73 Ga0207663_10230606 3300025916 Bacteria 1352
74 Ga0207681_10102811 3300025923 Bacteria 2064
75 Ga0207665_10210953 3300025939 Bacteria 1419
76 Ga0207667_10008908 3300025949 Bacteria 11873
77 Ga0209371_1000022 3300027312 Bacteria 536342
78 Ga0209371_1000370 3300027312 Bacteria 48496
79 Ga0209371_1000723 3300027312 Bacteria 27748
80 Ga0209282_1000959 3300027666 Bacteria 15084
81 Ga0209282_1043953 3300027666 Bacteria 2623
82 Ga0307515_10005985 3300028794 Bacteria 24500
83 Ga0307515_10007930 3300028794 Bacteria 20852
84 Ga0307515_10009401 3300028794 Bacteria 18909
85 Ga0307515_10104148 3300028794 Bacteria 3394
86 Ga0268256_1000019 3300030500 Bacteria 587949
87 Ga0268256_1001434 3300030500 Bacteria 14379
88 Ga0307512_10035982 3300030522 Bacteria 4208
89 Ga0307513_10080192 3300031456 Bacteria 3368
90 Ga0307513_10326646 3300031456 Bacteria 1290
91 Ga0307509_10002009 3300031507 Bacteria 33629
92 Ga0307508_10008274 3300031616 Bacteria 9630
93 Ga0307508_10114705 3300031616 Bacteria 2294
94 Ga0307405_10000522 3300031731 Bacteria 14513
95 Ga0307406_10019136 3300031901 Bacteria 4016
96 Ga0307412_10003550 3300031911 Bacteria 8662
97 Ga0307510_10058584 3300033180 Bacteria 3985
98 Ga0307510_10136035 3300033180 Bacteria 2114
99 Ga0307510_10136158 3300033180 Bacteria 2113
100 Ga0451833_0192702 3300041491 Bacteria 23445
101 Ga0451845_0170680 3300041501 Bacteria 2821
102 Ga0451849_0711469 3300041505 Bacteria 1099
103 Ga0439445_0042905 3300042004 Bacteria 1206
104 Ga0495592_0276281 3300046454 Bacteria 1100
105 Ga0495590_0002841 3300046457 Bacteria 7137
106 Ga0495590_0029603 3300046457 Bacteria 1919
107 Ga0495638_0006659 3300046460 Bacteria 8384
108 Ga0495650_0005382 3300046471 Bacteria 8328
109 Ga0495580_0005607 3300046472 Bacteria 10338
110 Ga0495605_0005610 3300046474 Bacteria 7293
111 Ga0495605_0010851 3300046474 Bacteria 5088
112 Ga0495584_0047891 3300046491 Bacteria 2156
113 Ga0495585_0026759 3300046492 Bacteria 3293
114 Ga0495596_0000147 3300046500 Bacteria 48928
115 Ga0495596_0116212 3300046500 Bacteria 1039
116 Ga0495607_0065682 3300046501 Bacteria 2045
117 Ga0495583_0004125 3300046506 Bacteria 10646
118 Ga0495583_0006615 3300046506 Bacteria 7537
119 Ga0495583_0022147 3300046506 Bacteria 3250
120 Ga0495583_0037099 3300046506 Bacteria 2313
121 Ga0495606_0003990 3300046507 Bacteria 15084
122 Ga0495606_0010402 3300046507 Bacteria 7726
123 Ga0495610_0031367 3300046512 Bacteria 2773
124 Ga0495618_0243008 3300046514 Bacteria 1131
125 Ga0495620_0014316 3300046515 Unclassified 4034
126 Ga0495620_0052792 3300046515 Bacteria 1724
127 Ga0495620_0077488 3300046515 Bacteria 1349
128 Ga0495628_0102061 3300046516 Bacteria 2213
129 Ga0495630_0034046 3300046517 Bacteria 3801
130 Ga0495631_0000475 3300046518 Bacteria 27013
131 Ga0495631_0037320 3300046518 Bacteria 2165
132 Ga0495632_0002316 3300046519 Bacteria 14651
133 Ga0495632_0014372 3300046519 Bacteria 4480
134 Ga0495632_0017784 3300046519 Bacteria 3916
135 Ga0495632_0097122 3300046519 Bacteria 1391
136 Ga0495643_0005395 3300046522 Bacteria 8655
137 Ga0495643_0009944 3300046522 Bacteria 5877
138 Ga0495648_0079859 3300046524 Bacteria 1865
139 Ga0495663_0024023 3300046525 Bacteria 1770
140 Ga0495642_0007588 3300046528 Bacteria 4156
141 Ga0495665_0094107 3300046531 Bacteria 1574
142 Ga0495609_0018750 3300046538 Bacteria 3205
143 Ga0495609_0064048 3300046538 Bacteria 1622
144 Ga0495597_0038372 3300046542 Bacteria 2147
145 Ga0495597_0052812 3300046542 Bacteria 1789
146 Ga0495633_0010546 3300046558 Bacteria 5037
147 Ga0495633_0015349 3300046558 Bacteria 3974
148 Ga0495633_0017469 3300046558 Bacteria 3667
149 Ga0495668_0014763 3300046616 Bacteria 4573
150 Ga0495611_0001423 3300046648 Bacteria 11946
151 Ga0495625_0001337 3300046660 Bacteria 30597
152 Ga0495625_0004295 3300046660 Bacteria 13552
153 Ga0495661_0020992 3300046665 Bacteria 4261
154 Ga0495661_0103446 3300046665 Bacteria 1598
155 Ga0495588_0009036 3300046674 Bacteria 4592
156 Ga0495624_0058384 3300046690 Bacteria 2423
157 Ga0495670_0152921 3300046691 Bacteria 1210
158 Ga0495671_0039577 3300046692 Bacteria 2380
159 Ga0495671_0069800 3300046692 Bacteria 1727
160 Ga0495649_0000223 3300046694 Bacteria 49772
161 Ga0495660_0025447 3300046810 Bacteria 3361
162 Ga0495660_0052739 3300046810 Bacteria 2209
163 Ga0495660_0080746 3300046810 Bacteria 1706
164 Ga0495674_0005169 3300047319 Bacteria 12533
165 Ga0495672_0068243 3300047320 Bacteria 2022
166 Ga0495676_0058416 3300047321 Bacteria 3035
167 Ga0495683_0059177 3300047323 Bacteria 1901
168 Ga0495687_000185 3300047443 Bacteria 91064
169 Ga0495687_000852 3300047443 Bacteria 32567
170 Ga0495687_001963 3300047443 Bacteria 17565
171 Ga0495687_083677 3300047443 Bacteria 1242
172 Ga0495677_0074567 3300047445 Bacteria 1267
173 Ga0495677_0089656 3300047445 Bacteria 1158
174 Ga0495679_000009 3300047446 Bacteria 343637
175 Ga0495673_0046253 3300047469 Bacteria 1929
176 Ga0495673_0063016 3300047469 Bacteria 1582
177 Ga0495673_0152862 3300047469 Bacteria 891
178 Ga0495681_0036849 3300047470 Bacteria 2415
179 Ga0495686_0175458 3300047472 Bacteria 1244
180 Ga0495626_0004797 3300048091 Bacteria 8160
181 Ga0495626_0049949 3300048091 Bacteria 1934
182 Ga0496100_0021120 3300048903 Bacteria 3916
183 Ga0496100_0067403 3300048903 Bacteria 2377
184 Ga0496101_0023736 3300048904 Bacteria 4240
185 Ga0496101_0042654 3300048904 Bacteria 3239
186 Ga0496104_0031735 3300048907 Bacteria 4914
187 Ga0496104_0355949 3300048907 Bacteria 1376
188 Ga0496105_0003489 3300048908 Bacteria 11640
189 Ga0496105_0012297 3300048908 Bacteria 6778
190 Ga0496113_0054836 3300048916 Bacteria 2986
191 Ga0496116_0000692 3300048919 Bacteria 43664
192 Ga0496116_0006995 3300048919 Bacteria 10104
193 Ga0496116_0063056 3300048919 Bacteria 2390
194 Ga0496116_0078685 3300048919 Bacteria 2055
195 Ga0496116_0081359 3300048919 Bacteria 2008
196 Ga0496117_0000002 3300048920 Bacteria 2483758
197 Ga0496117_0005089 3300048920 Bacteria 14059
198 Ga0496117_0014608 3300048920 Bacteria 6754
199 Ga0496117_0016967 3300048920 Bacteria 6101
200 Ga0496117_0039320 3300048920 Bacteria 3493
201 Ga0496117_0076426 3300048920 Bacteria 2220
202 Ga0496118_0001838 3300048921 Bacteria 30388
203 Ga0496118_0003207 3300048921 Bacteria 20877
204 Ga0496118_0003513 3300048921 Bacteria 19652
205 Ga0496119_0000627 3300048922 Bacteria 47668
206 Ga0496119_0001313 3300048922 Bacteria 30608
207 Ga0496119_0004366 3300048922 Bacteria 14111
208 Ga0496119_0011022 3300048922 Bacteria 7537
209 Ga0496119_0080909 3300048922 Bacteria 1872
210 Ga0496120_0000093 3300048923 Bacteria 146905
211 Ga0496120_0000656 3300048923 Bacteria 50861
212 Ga0496120_0077505 3300048923 Bacteria 1809
213 Ga0496120_0078860 3300048923 Bacteria 1789
214 Ga0496121_0000003 3300048924 Bacteria 1191431
215 Ga0496121_0001537 3300048924 Bacteria 38640
216 Ga0496121_0069688 3300048924 Bacteria 2836
217 Ga0496121_0129736 3300048924 Bacteria 1889
218 Ga0496121_0220288 3300048924 Bacteria 1337
219 Ga0496122_0000004 3300048925 Bacteria 645283
220 Ga0496122_0006194 3300048925 Bacteria 13883
221 Ga0496122_0006644 3300048925 Bacteria 13185
222 Ga0496122_0049124 3300048925 Bacteria 3235
223 Ga0496122_0134571 3300048925 Bacteria 1561
224 Ga0496122_0215967 3300048925 Bacteria 1105
225 Ga0496123_0000007 3300048926 Bacteria 645283
226 Ga0496123_0003132 3300048926 Bacteria 18980
227 Ga0496123_0004524 3300048926 Bacteria 14533
228 Ga0496123_0029039 3300048926 Bacteria 4082
229 Ga0496123_0039857 3300048926 Bacteria 3280
230 Ga0496123_0045412 3300048926 Bacteria 2993
231 Ga0496123_0147459 3300048926 Bacteria 1275
232 Ga0496124_0001483 3300048927 Bacteria 34488
233 Ga0496124_0051539 3300048927 Bacteria 3501
234 Ga0496124_0061730 3300048927 Bacteria 3140
235 Ga0496125_0000200 3300048928 Bacteria 126369
236 Ga0496125_0006995 3300048928 Bacteria 12073
237 Ga0496125_0010060 3300048928 Bacteria 9598
238 Ga0496125_0029415 3300048928 Bacteria 4936
239 Ga0496125_0079233 3300048928 Bacteria 2521
240 Ga0496125_0110072 3300048928 Bacteria 1998
241 Ga0496125_0220508 3300048928 Bacteria 1222
242 Ga0496126_0029392 3300048929 Bacteria 5221
243 Ga0495678_034676 3300049459 Bacteria 2074
244 Ga0495682_0009251 3300049460 Bacteria 3852
245 Ga0495682_0024221 3300049460 Bacteria 2264
246 Ga0495682_0037404 3300049460 Bacteria 1786
247 Ga0501040_0000202 3300049576 Bacteria 34557
248 Ga0501042_0009531 3300049578 Bacteria 6474
249 Ga0501073_0077455 3300049589 Bacteria 2314
250 nmdc:mga03683_137728_c1 3300050489 Bacteria 1096
251 nmdc:mga03n38_104657_c1 3300050490 Bacteria 1370
252 nmdc:mga00v17_50721_c1 3300050491 Bacteria 2522
253 nmdc:mga00v17_6245_c1 3300050491 Bacteria 6319
254 nmdc:mga0k408_169197_c1 3300050493 Bacteria 1303
255 nmdc:mga06z11_10353_c1 3300050494 Bacteria 3970
256 nmdc:mga06z11_36137_c1 3300050494 Bacteria 2437
257 nmdc:mga0sz30_26_c1 3300050516 Bacteria 59011
258 nmdc:mga0sz30_50638_c1 3300050516 Bacteria 1761
259 nmdc:mga0sz30_65801_c1 3300050516 Bacteria 1554
260 Ga0500610_0082743 3300053079 Bacteria 1672
261 Ga0500643_000355 3300053087 Bacteria 36417
262 Ga0500651_0165249 3300053093 Bacteria 1322
263 Ga0500556_0000119 3300053104 Bacteria 68528
264 Ga0500562_013924 3300053108 Bacteria 2057
265 Ga0500569_001739 3300053109 Bacteria 4171
266 Ga0500594_0001080 3300053118 Bacteria 5847
267 Ga0500658_0003068 3300053134 Bacteria 6390
268 Ga0500658_0010591 3300053134 Bacteria 3401
269 Ga0500561_0003370 3300053137 Bacteria 2786
270 Ga0500568_0002571 3300053139 Bacteria 10570
271 Ga0500590_000970 3300053148 Bacteria 11078
272 Ga0500622_0001242 3300053156 Bacteria 20866
273 Ga0500624_000600 3300053157 Bacteria 9838
274 Ga0500634_0001763 3300053161 Bacteria 8685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046525 Ga0495663_0024023 Ga0495663_0024023_14_682 219
2 3300047445 Ga0495677_0074567 Ga0495677_0074567_13_681 219
3 3300048925 Ga0496122_0049124 Ga0496122_0049124_320_1153 257
4 3300048928 Ga0496125_0000200 Ga0496125_0000200_1137_1970 257
5 3300046492 Ga0495585_0026759 Ga0495585_0026759_2461_3264 264
6 3300046507 Ga0495606_0003990 Ga0495606_0003990_10433_11236 264
7 3300046518 Ga0495631_0037320 Ga0495631_0037320_178_981 264
8 3300046528 Ga0495642_0007588 Ga0495642_0007588_1604_2407 264
9 3300046558 Ga0495633_0015349 Ga0495633_0015349_2793_3596 264
10 3300046665 Ga0495661_0020992 Ga0495661_0020992_673_1476 264
11 3300046692 Ga0495671_0069800 Ga0495671_0069800_490_1293 264
12 3300048091 Ga0495626_0004797 Ga0495626_0004797_2830_3633 264
13 3300003322 rootL2_10132381 rootL2_101323812 265
14 iso_pu_bacteria 2842775625 2842777171 266
15 iso_pu_bacteria 2839989709 2839990780 267
16 iso_pu_bacteria 2511231027 2511389057 269
17 iso_pu_bacteria 2597490356 2599104450 269
18 iso_pu_bacteria 2751185800 2753357268 269
19 iso_pu_bacteria 2758568016 2758639674 269
20 iso_pu_bacteria 2767802442 2770197928 269
21 iso_pu_bacteria 2775506902 2776268999 269
22 iso_pu_bacteria 2775506904 2776283864 269
23 iso_pu_bacteria 2775507049 2776912357 269
24 iso_pu_bacteria 2839993093 2839993845 269
25 iso_pu_bacteria 2840764183 2840766853 269
26 iso_pu_bacteria 2842871566 2842873424 269
27 iso_pu_bacteria 2846952575 2846956763 269
28 iso_pu_bacteria 2848858292 2848862446 269
29 iso_pu_bacteria 2894652903 2894653223 269
30 iso_pu_bacteria 2897803580 2897807685 269
31 iso_pu_bacteria 2928521798 2928522263 269
32 iso_pu_bacteria 2946787523 2946788375 269
33 iso_pu_bacteria 2954011201 2954014313 269
34 3300005327 Ga0070658_10376568 Ga0070658_103765682 271
35 3300005563 Ga0068855_100033703 Ga0068855_1000337037 271
36 3300025949 Ga0207667_10008908 Ga0207667_100089084 271
37 3300046810 Ga0495660_0080746 Ga0495660_0080746_545_1432 271
38 iso_pu_bacteria 2510917021 2511127359 271
39 3300028794 Ga0307515_10005985 Ga0307515_100059858 272
40 iso_pu_bacteria 2508501114 2509074366 272
41 iso_pu_bacteria 2510917030 2511200186 272
42 iso_pu_bacteria 2513237088 2513596030 272
43 iso_pu_bacteria 2513237088 2513598321 272
44 iso_pu_bacteria 2537561587 2537875855 272
45 iso_pu_bacteria 2554235003 2554248620 272
46 iso_pu_bacteria 2558860242 2559295708 272
47 iso_pu_bacteria 2562617112 2563058074 272
48 iso_pu_bacteria 2582581298 2585224917 272
49 iso_pu_bacteria 2582581299 2585230319 272
50 iso_pu_bacteria 2582581304 2585259627 272
51 iso_pu_bacteria 2582581315 2585325132 272
52 iso_pu_bacteria 2582581315 2585327012 272
53 iso_pu_bacteria 2582581867 2585401717 272
54 iso_pu_bacteria 2585427529 2585547473 272
55 iso_pu_bacteria 2585427594 2585842640 272
56 iso_pu_bacteria 2599185156 2599333975 272
57 iso_pu_bacteria 2599185210 2599602032 272
58 iso_pu_bacteria 2600255279 2601611465 272
59 iso_pu_bacteria 2600255308 2601748114 272
60 iso_pu_bacteria 2643221582 2643919973 272
61 iso_pu_bacteria 2643221599 2644005250 272
62 iso_pu_bacteria 2643221623 2644130735 272
63 iso_pu_bacteria 2643221634 2644195760 272
64 iso_pu_bacteria 2643221693 2644523325 272
65 iso_pu_bacteria 2711768613 2713473220 272
66 iso_pu_bacteria 2808606387 2808987557 272
67 iso_pu_bacteria 2818991439 2819559426 272
68 iso_pu_bacteria 2838675328 2838675398 272
69 iso_pu_bacteria 2838714209 2838714279 272
70 iso_pu_bacteria 2838719591 2838721919 272
71 iso_pu_bacteria 2838724970 2838725040 272
72 iso_pu_bacteria 2841846520 2841848899 272
73 iso_pu_bacteria 2841859092 2841862568 272
74 iso_pu_bacteria 2842124991 2842125070 272
75 iso_pu_bacteria 2842130223 2842130293 272
76 iso_pu_bacteria 2842152218 2842154537 272
77 iso_pu_bacteria 2842170452 2842170522 272
78 iso_pu_bacteria 2842175837 2842178157 272
79 iso_pu_bacteria 2842187318 2842187388 272
80 iso_pu_bacteria 2842211629 2842211699 272
81 iso_pu_bacteria 2842224351 2842226681 272
82 iso_pu_bacteria 2842515876 2842519352 272
83 iso_pu_bacteria 2842922631 2842923583 272
84 iso_pu_bacteria 2899792073 2899795749 272
85 iso_pu_bacteria 2899845264 2899848946 272
86 iso_pu_bacteria 2919100787 2919104431 272
87 iso_pu_bacteria 2919114240 2919114310 272
88 iso_pu_bacteria 2923556063 2923559006 272
89 iso_pu_bacteria 2926754445 2926755330 272
90 iso_pu_bacteria 2926760298 2926762440 272
91 iso_pu_bacteria 2929138655 2929141551 272
92 iso_pu_bacteria 2933006813 2933009182 272
93 iso_pu_bacteria 2933011516 2933014477 272
94 iso_pu_bacteria 2933594066 2933599230 272
95 iso_pu_bacteria 2979089926 2979092289 272
96 iso_pu_bacteria 2979095461 2979100322 272
97 iso_pu_bacteria 2979100975 2979104277 272
98 iso_pu_bacteria 2984509177 2984511143 272
99 iso_pu_bacteria 2984518228 2984522495 272
100 iso_pu_bacteria 2984537506 2984541799 272
101 iso_pu_bacteria 2984601300 2984604154 272
102 iso_pu_bacteria 2989771324 2989775382 272
103 iso_pu_bacteria 3002141150 3002146151 272
104 iso_pu_bacteria 3005445848 3005449150 272
105 iso_pu_bacteria 3005452660 3005457457 272
106 iso_pu_bacteria 650716007 650740920 272
107 iso_pu_bacteria 8002285264 8002291953 272
108 iso_pu_bacteria 8003570095 8003571993 272
109 3300003323 rootH1_10006849 rootH1_100068493 273
110 3300006048 Ga0075363_100332035 Ga0075363_1003320351 273
111 3300028794 Ga0307515_10007930 Ga0307515_1000793017 273
112 3300028794 Ga0307515_10104148 Ga0307515_101041481 273
113 3300030522 Ga0307512_10035982 Ga0307512_100359824 273
114 3300031456 Ga0307513_10326646 Ga0307513_103266462 273
115 3300031507 Ga0307509_10002009 Ga0307509_1000200932 273
116 3300031616 Ga0307508_10008274 Ga0307508_100082747 273
117 3300031616 Ga0307508_10114705 Ga0307508_101147052 273
118 3300033180 Ga0307510_10058584 Ga0307510_100585842 273
119 3300033180 Ga0307510_10136035 Ga0307510_101360353 273
120 3300033180 Ga0307510_10136158 Ga0307510_101361583 273
121 3300046454 Ga0495592_0276281 Ga0495592_0276281_29_859 273
122 3300046474 Ga0495605_0005610 Ga0495605_0005610_1518_2348 273
123 3300046491 Ga0495584_0047891 Ga0495584_0047891_1142_1972 273
124 3300046515 Ga0495620_0077488 Ga0495620_0077488_135_959 273
125 3300046518 Ga0495631_0000475 Ga0495631_0000475_22039_22869 273
126 3300046519 Ga0495632_0002316 Ga0495632_0002316_5589_6413 273
127 3300046519 Ga0495632_0014372 Ga0495632_0014372_1500_2330 273
128 3300046542 Ga0495597_0038372 Ga0495597_0038372_1240_2064 273
129 3300046616 Ga0495668_0014763 Ga0495668_0014763_234_1064 273
130 3300046648 Ga0495611_0001423 Ga0495611_0001423_3585_4415 273
131 3300046660 Ga0495625_0004295 Ga0495625_0004295_3872_4702 273
132 3300046694 Ga0495649_0000223 Ga0495649_0000223_21250_22074 273
133 3300046810 Ga0495660_0025447 Ga0495660_0025447_284_1108 273
134 3300046810 Ga0495660_0052739 Ga0495660_0052739_149_979 273
135 3300047443 Ga0495687_000852 Ga0495687_000852_23215_24057 273
136 3300047443 Ga0495687_001963 Ga0495687_001963_8229_9053 273
137 3300047445 Ga0495677_0089656 Ga0495677_0089656_307_1137 273
138 3300048922 Ga0496119_0011022 Ga0496119_0011022_6152_6976 273
139 3300048928 Ga0496125_0110072 Ga0496125_0110072_30_854 273
140 3300049460 Ga0495682_0024221 Ga0495682_0024221_1106_1936 273
141 3300053079 Ga0500610_0082743 Ga0500610_0082743_727_1557 273
142 3300053109 Ga0500569_001739 Ga0500569_001739_1317_2147 273
143 3300053118 Ga0500594_0001080 Ga0500594_0001080_797_1627 273
144 3300053134 Ga0500658_0010591 Ga0500658_0010591_2379_3221 273
145 3300005439 Ga0070711_100092976 Ga0070711_1000929762 274
146 3300006028 Ga0070717_10205228 Ga0070717_102052282 274
147 3300006173 Ga0070716_100287865 Ga0070716_1002878652 274
148 3300006175 Ga0070712_100256777 Ga0070712_1002567772 274
149 3300006353 Ga0075370_10178003 Ga0075370_101780031 274
150 3300025916 Ga0207663_10230606 Ga0207663_102306062 274
151 3300025939 Ga0207665_10210953 Ga0207665_102109531 274
152 3300028794 Ga0307515_10009401 Ga0307515_1000940123 274
153 3300041491 Ga0451833_0192702 Ga0451833_0192702_7269_8093 274
154 3300041501 Ga0451845_0170680 Ga0451845_0170680_1719_2543 274
155 3300041505 Ga0451849_0711469 Ga0451849_0711469_146_970 274
156 3300046691 Ga0495670_0152921 Ga0495670_0152921_78_908 274
157 3300053087 Ga0500643_000355 Ga0500643_000355_9349_10176 274
158 3300002987 JGI25159J45721_1021014 JGI25159J45721_10210141 275
159 3300003187 JGI25151J46595_10002780 JGI25151J46595_100027802 275
160 3300003320 rootH2_10141006 rootH2_101410063 275
161 3300003354 JGI25160J50197_1007628 JGI25160J50197_10076283 275
162 3300005262 Ga0065165_1009775 Ga0065165_10097755 275
163 3300025284 Ga0209130_1000473 Ga0209130_10004738 275
164 3300025294 Ga0209025_1005472 Ga0209025_10054729 275
165 3300025297 Ga0209758_1014204 Ga0209758_10142043 275
166 3300025302 Ga0207426_1000317 Ga0207426_100031781 275
167 3300046500 Ga0495596_0000147 Ga0495596_0000147_30918_31748 275
168 3300046506 Ga0495583_0037099 Ga0495583_0037099_72_902 275
169 3300046507 Ga0495606_0010402 Ga0495606_0010402_1222_2052 275
170 3300046519 Ga0495632_0017784 Ga0495632_0017784_2132_2962 275
171 3300046522 Ga0495643_0005395 Ga0495643_0005395_918_1748 275
172 3300046522 Ga0495643_0009944 Ga0495643_0009944_100_930 275
173 3300046538 Ga0495609_0018750 Ga0495609_0018750_1108_1938 275
174 3300046660 Ga0495625_0001337 Ga0495625_0001337_23206_24036 275
175 3300053108 Ga0500562_013924 Ga0500562_013924_432_1262 275
176 iso_pu_bacteria 2844533157 2844535410 275
177 3300002773 JGI25152J39213_1001126 JGI25152J39213_10011262 276
178 3300002774 JGI25150J39212_1000219 JGI25150J39212_10002198 276
179 3300002774 JGI25150J39212_1009186 JGI25150J39212_10091862 276
180 3300002987 JGI25159J45721_1000451 JGI25159J45721_100045110 276
181 3300003187 JGI25151J46595_10000007 JGI25151J46595_10000007132 276
182 3300003187 JGI25151J46595_10025566 JGI25151J46595_100255662 276
183 3300003215 JGI25153J46596_10000254 JGI25153J46596_1000025417 276
184 3300003215 JGI25153J46596_10003776 JGI25153J46596_100037764 276
185 3300003215 JGI25153J46596_10015608 JGI25153J46596_100156082 276
186 3300003322 rootL2_10272801 rootL2_102728011 276
187 3300003374 JGI25161J50226_1000211 JGI25161J50226_10002119 276
188 3300003771 Ga0055526_1004787 Ga0055526_10047877 276
189 3300003790 Ga0055528_1001376 Ga0055528_10013768 276
190 3300003792 Ga0055540_1022043 Ga0055540_10220432 276
191 3300003856 Ga0058692_1001275 Ga0058692_10012752 276
192 3300003856 Ga0058692_1004320 Ga0058692_10043204 276
193 3300004625 Ga0055543_1000328 Ga0055543_10003289 276
194 3300005262 Ga0065165_1014389 Ga0065165_10143894 276
195 3300005548 Ga0070665_100005758 Ga0070665_10000575811 276
196 3300006042 Ga0075368_10026537 Ga0075368_100265372 276
197 3300006177 Ga0075362_10080905 Ga0075362_100809052 276
198 3300006178 Ga0075367_10019987 Ga0075367_100199874 276
199 3300006186 Ga0075369_10003451 Ga0075369_100034512 276
200 3300006186 Ga0075369_10010064 Ga0075369_100100642 276
201 3300006948 Ga0099826_10000063 Ga0099826_1000006328 276
202 3300006948 Ga0099826_10130721 Ga0099826_101307212 276
203 3300009093 Ga0105240_10000298 Ga0105240_1000029849 276
204 3300009148 Ga0105243_10056939 Ga0105243_100569392 276
205 3300010375 Ga0105239_10000044 Ga0105239_10000044124 276
206 3300013100 Ga0157373_10045600 Ga0157373_100456002 276
207 3300013102 Ga0157371_10000966 Ga0157371_1000096613 276
208 3300013104 Ga0157370_10000338 Ga0157370_1000033812 276
209 3300025208 Ga0209436_100027 Ga0209436_10002712 276
210 3300025245 Ga0207425_1000018 Ga0207425_1000018198 276
211 3300025245 Ga0207425_1006794 Ga0207425_10067942 276
212 3300025258 Ga0209129_1000026 Ga0209129_1000026131 276
213 3300025258 Ga0209129_1001033 Ga0209129_100103310 276
214 3300025258 Ga0209129_1003149 Ga0209129_10031497 276
215 3300025273 Ga0209673_1002532 Ga0209673_100253211 276
216 3300025273 Ga0209673_1003179 Ga0209673_10031793 276
217 3300025284 Ga0209130_1000030 Ga0209130_1000030298 276
218 3300025294 Ga0209025_1000035 Ga0209025_1000035131 276
219 3300025294 Ga0209025_1000662 Ga0209025_100066268 276
220 3300025294 Ga0209025_1024560 Ga0209025_10245602 276
221 3300025295 Ga0209564_1000364 Ga0209564_100036479 276
222 3300025297 Ga0209758_1000040 Ga0209758_1000040131 276
223 3300025297 Ga0209758_1002926 Ga0209758_100292610 276
224 3300025297 Ga0209758_1009631 Ga0209758_10096317 276
225 3300025299 Ga0209256_1004405 Ga0209256_10044053 276
226 3300025302 Ga0207426_1000047 Ga0207426_1000047102 276
227 3300025303 Ga0209051_1002867 Ga0209051_100286710 276
228 3300025304 Ga0209257_1024730 Ga0209257_10247301 276
229 3300025913 Ga0207695_10000294 Ga0207695_1000029462 276
230 3300025923 Ga0207681_10102811 Ga0207681_101028112 276
231 3300027312 Ga0209371_1000022 Ga0209371_1000022449 276
232 3300027312 Ga0209371_1000370 Ga0209371_100037019 276
233 3300027312 Ga0209371_1000723 Ga0209371_10007232 276
234 3300027666 Ga0209282_1000959 Ga0209282_100095916 276
235 3300027666 Ga0209282_1043953 Ga0209282_10439532 276
236 3300030500 Ga0268256_1000019 Ga0268256_100001971 276
237 3300030500 Ga0268256_1001434 Ga0268256_100143417 276
238 3300031456 Ga0307513_10080192 Ga0307513_100801923 276
239 3300031731 Ga0307405_10000522 Ga0307405_100005229 276
240 3300031901 Ga0307406_10019136 Ga0307406_100191363 276
241 3300031911 Ga0307412_10003550 Ga0307412_100035506 276
242 3300042004 Ga0439445_0042905 Ga0439445_0042905_349_1182 276
243 3300046457 Ga0495590_0002841 Ga0495590_0002841_2891_3727 276
244 3300046457 Ga0495590_0029603 Ga0495590_0029603_1045_1875 276
245 3300046460 Ga0495638_0006659 Ga0495638_0006659_6027_6863 276
246 3300046471 Ga0495650_0005382 Ga0495650_0005382_4956_5792 276
247 3300046472 Ga0495580_0005607 Ga0495580_0005607_4923_5759 276
248 3300046474 Ga0495605_0010851 Ga0495605_0010851_375_1211 276
249 3300046500 Ga0495596_0116212 Ga0495596_0116212_130_966 276
250 3300046501 Ga0495607_0065682 Ga0495607_0065682_230_1063 276
251 3300046506 Ga0495583_0004125 Ga0495583_0004125_9579_10412 276
252 3300046506 Ga0495583_0006615 Ga0495583_0006615_4826_5659 276
253 3300046506 Ga0495583_0022147 Ga0495583_0022147_2080_2916 276
254 3300046512 Ga0495610_0031367 Ga0495610_0031367_1757_2587 276
255 3300046514 Ga0495618_0243008 Ga0495618_0243008_142_987 276
256 3300046515 Ga0495620_0014316 Ga0495620_0014316_2033_2866 276
257 3300046515 Ga0495620_0052792 Ga0495620_0052792_130_966 276
258 3300046516 Ga0495628_0102061 Ga0495628_0102061_190_1026 276
259 3300046517 Ga0495630_0034046 Ga0495630_0034046_2460_3296 276
260 3300046519 Ga0495632_0097122 Ga0495632_0097122_328_1161 276
261 3300046524 Ga0495648_0079859 Ga0495648_0079859_461_1300 276
262 3300046531 Ga0495665_0094107 Ga0495665_0094107_565_1401 276
263 3300046538 Ga0495609_0064048 Ga0495609_0064048_486_1322 276
264 3300046542 Ga0495597_0052812 Ga0495597_0052812_55_891 276
265 3300046558 Ga0495633_0010546 Ga0495633_0010546_4015_4848 276
266 3300046558 Ga0495633_0017469 Ga0495633_0017469_29_862 276
267 3300046665 Ga0495661_0103446 Ga0495661_0103446_211_1047 276
268 3300046674 Ga0495588_0009036 Ga0495588_0009036_598_1431 276
269 3300046690 Ga0495624_0058384 Ga0495624_0058384_1278_2114 276
270 3300046692 Ga0495671_0039577 Ga0495671_0039577_1036_1869 276
271 3300047319 Ga0495674_0005169 Ga0495674_0005169_3085_3921 276
272 3300047320 Ga0495672_0068243 Ga0495672_0068243_478_1326 276
273 3300047321 Ga0495676_0058416 Ga0495676_0058416_1066_1902 276
274 3300047323 Ga0495683_0059177 Ga0495683_0059177_677_1513 276
275 3300047443 Ga0495687_000185 Ga0495687_000185_80750_81583 276
276 3300047443 Ga0495687_083677 Ga0495687_083677_185_1021 276
277 3300047446 Ga0495679_000009 Ga0495679_000009_223494_224330 276
278 3300047469 Ga0495673_0046253 Ga0495673_0046253_144_980 276
279 3300047469 Ga0495673_0063016 Ga0495673_0063016_642_1475 276
280 3300047469 Ga0495673_0152862 Ga0495673_0152862_26_865 276
281 3300047470 Ga0495681_0036849 Ga0495681_0036849_572_1405 276
282 3300047472 Ga0495686_0175458 Ga0495686_0175458_402_1232 276
283 3300048091 Ga0495626_0049949 Ga0495626_0049949_190_1026 276
284 3300048903 Ga0496100_0021120 Ga0496100_0021120_1231_2061 276
285 3300048903 Ga0496100_0067403 Ga0496100_0067403_805_1653 276
286 3300048904 Ga0496101_0023736 Ga0496101_0023736_3131_3979 276
287 3300048904 Ga0496101_0042654 Ga0496101_0042654_2004_2834 276
288 3300048907 Ga0496104_0031735 Ga0496104_0031735_304_1152 276
289 3300048907 Ga0496104_0355949 Ga0496104_0355949_472_1305 276
290 3300048908 Ga0496105_0003489 Ga0496105_0003489_2816_3664 276
291 3300048908 Ga0496105_0012297 Ga0496105_0012297_3866_4705 276
292 3300048916 Ga0496113_0054836 Ga0496113_0054836_2019_2852 276
293 3300048919 Ga0496116_0000692 Ga0496116_0000692_29029_29859 276
294 3300048919 Ga0496116_0006995 Ga0496116_0006995_2146_3108 276
295 3300048919 Ga0496116_0063056 Ga0496116_0063056_445_1278 276
296 3300048919 Ga0496116_0078685 Ga0496116_0078685_281_1120 276
297 3300048919 Ga0496116_0081359 Ga0496116_0081359_976_1806 276
298 3300048920 Ga0496117_0000002 Ga0496117_0000002_100935_101768 276
299 3300048920 Ga0496117_0005089 Ga0496117_0005089_1779_2609 276
300 3300048920 Ga0496117_0014608 Ga0496117_0014608_4686_5537 276
301 3300048920 Ga0496117_0016967 Ga0496117_0016967_4541_5380 276
302 3300048920 Ga0496117_0039320 Ga0496117_0039320_477_1313 276
303 3300048920 Ga0496117_0076426 Ga0496117_0076426_108_941 276
304 3300048921 Ga0496118_0001838 Ga0496118_0001838_19898_20749 276
305 3300048921 Ga0496118_0003207 Ga0496118_0003207_6094_6924 276
306 3300048921 Ga0496118_0003513 Ga0496118_0003513_14889_15722 276
307 3300048922 Ga0496119_0000627 Ga0496119_0000627_8231_9088 276
308 3300048922 Ga0496119_0001313 Ga0496119_0001313_18855_19694 276
309 3300048922 Ga0496119_0004366 Ga0496119_0004366_1166_1999 276
310 3300048922 Ga0496119_0080909 Ga0496119_0080909_751_1584 276
311 3300048923 Ga0496120_0000093 Ga0496120_0000093_45450_46283 276
312 3300048923 Ga0496120_0000656 Ga0496120_0000656_18863_19702 276
313 3300048923 Ga0496120_0077505 Ga0496120_0077505_925_1755 276
314 3300048923 Ga0496120_0078860 Ga0496120_0078860_358_1191 276
315 3300048924 Ga0496121_0000003 Ga0496121_0000003_1188202_1189035 276
316 3300048924 Ga0496121_0001537 Ga0496121_0001537_26888_27736 276
317 3300048924 Ga0496121_0069688 Ga0496121_0069688_1332_2162 276
318 3300048924 Ga0496121_0129736 Ga0496121_0129736_804_1640 276
319 3300048924 Ga0496121_0220288 Ga0496121_0220288_132_983 276
320 3300048925 Ga0496122_0000004 Ga0496122_0000004_543908_544741 276
321 3300048925 Ga0496122_0006194 Ga0496122_0006194_5729_6580 276
322 3300048925 Ga0496122_0006644 Ga0496122_0006644_11834_12664 276
323 3300048925 Ga0496122_0134571 Ga0496122_0134571_711_1541 276
324 3300048925 Ga0496122_0215967 Ga0496122_0215967_34_867 276
325 3300048926 Ga0496123_0000007 Ga0496123_0000007_543908_544741 276
326 3300048926 Ga0496123_0003132 Ga0496123_0003132_2831_3688 276
327 3300048926 Ga0496123_0004524 Ga0496123_0004524_6406_7236 276
328 3300048926 Ga0496123_0029039 Ga0496123_0029039_31_864 276
329 3300048926 Ga0496123_0039857 Ga0496123_0039857_1411_2241 276
330 3300048926 Ga0496123_0045412 Ga0496123_0045412_166_1017 276
331 3300048926 Ga0496123_0147459 Ga0496123_0147459_73_906 276
332 3300048927 Ga0496124_0001483 Ga0496124_0001483_20765_21616 276
333 3300048927 Ga0496124_0051539 Ga0496124_0051539_2251_3084 276
334 3300048927 Ga0496124_0061730 Ga0496124_0061730_1418_2248 276
335 3300048928 Ga0496125_0006995 Ga0496125_0006995_6877_7707 276
336 3300048928 Ga0496125_0010060 Ga0496125_0010060_416_1246 276
337 3300048928 Ga0496125_0029415 Ga0496125_0029415_2123_2956 276
338 3300048928 Ga0496125_0079233 Ga0496125_0079233_41_874 276
339 3300048928 Ga0496125_0220508 Ga0496125_0220508_114_947 276
340 3300048929 Ga0496126_0029392 Ga0496126_0029392_1037_1870 276
341 3300049459 Ga0495678_034676 Ga0495678_034676_77_913 276
342 3300049460 Ga0495682_0009251 Ga0495682_0009251_2574_3422 276
343 3300049460 Ga0495682_0037404 Ga0495682_0037404_877_1713 276
344 3300049576 Ga0501040_0000202 Ga0501040_0000202_31338_32195 276
345 3300049578 Ga0501042_0009531 Ga0501042_0009531_4660_5517 276
346 3300049589 Ga0501073_0077455 Ga0501073_0077455_1089_1919 276
347 3300050489 nmdc:mga03683_137728_c1 nmdc:mga03683_137728_c1_144_977 276
348 3300050490 nmdc:mga03n38_104657_c1 nmdc:mga03n38_104657_c1_252_1085 276
349 3300050491 nmdc:mga00v17_50721_c1 nmdc:mga00v17_50721_c1_717_1550 276
350 3300050491 nmdc:mga00v17_6245_c1 nmdc:mga00v17_6245_c1_2581_3414 276
351 3300050493 nmdc:mga0k408_169197_c1 nmdc:mga0k408_169197_c1_135_968 276
352 3300050494 nmdc:mga06z11_10353_c1 nmdc:mga06z11_10353_c1_2959_3792 276
353 3300050494 nmdc:mga06z11_36137_c1 nmdc:mga06z11_36137_c1_1449_2282 276
354 3300050516 nmdc:mga0sz30_26_c1 nmdc:mga0sz30_26_c1_15594_16427 276
355 3300050516 nmdc:mga0sz30_50638_c1 nmdc:mga0sz30_50638_c1_858_1691 276
356 3300050516 nmdc:mga0sz30_65801_c1 nmdc:mga0sz30_65801_c1_514_1344 276
357 3300053093 Ga0500651_0165249 Ga0500651_0165249_459_1289 276
358 3300053104 Ga0500556_0000119 Ga0500556_0000119_54331_55188 276
359 3300053134 Ga0500658_0003068 Ga0500658_0003068_3350_4180 276
360 3300053137 Ga0500561_0003370 Ga0500561_0003370_806_1639 276
361 3300053139 Ga0500568_0002571 Ga0500568_0002571_5324_6154 276
362 3300053148 Ga0500590_000970 Ga0500590_000970_6022_6867 276
363 3300053156 Ga0500622_0001242 Ga0500622_0001242_5283_6113 276
364 3300053157 Ga0500624_000600 Ga0500624_000600_6622_7455 276
365 3300053161 Ga0500634_0001763 Ga0500634_0001763_3587_4420 276
366 iso_pu_bacteria 2744054901 2746096956 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

56

301

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3up8-assembly2.cif.gz_B crystal structure of a putative 2,5-diketo-d-gluconic acid reductase b 0.9914 1 273
3up8-assembly2.cif.gz_B crystal structure of a putative 2,5-diketo-d-gluconic acid reductase b 0.9771 1 273
3h4g-assembly1.cif.gz_A structure of aldehyde reductase holoenzyme in complex with potent aldose reductase inhibitor fidarestat: implications for inhibitor binding and selectivity 0.9684 2 266
3f7j-assembly2.cif.gz_B b.subtilis yvgn 0.967 7 267
2wzt-assembly1.cif.gz_B crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form 0.9657 1 255
ID Description Score Start End Superfamily
3up8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9857 3 273 3.20.20.100
af_P30863_1_265_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9716 9 271 3.20.20.100
af_Q9NAI5_1_316_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9693 2 256 3.20.20.100
af_Q9VTL0_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9638 3 256 3.20.20.100
af_P30863_1_265_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9608 9 271 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A656Z380-F1-model_v4 2,5-didehydrogluconate reductase 0.9987 60 273 GO:0004033
GO:0051596
GO:1990002
AF-K5BWD9-F1-model_v4 deleted 0.9979 31 273
AF-A0A4R2C648-F1-model_v4 Diketogulonate reductase-like aldo/keto reductase 0.9969 1 202 GO:0004033
GO:0051596
GO:1990002
AF-A0A7G8BGH2-F1-model_v4 Aldo/keto reductase 0.9947 5 276 GO:0004033
GO:0051596
GO:1990002
AF-H0GB21-F1-model_v4 2,5-didehydrogluconate reductase 0.9929 1 273 GO:0004033
GO:0051596
GO:1990002

Feature Viewer

pLDDT pTM Quality
97.03 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map