F422697

General Info

Members Datasets Scaffolds Average Seq Length
362 187 355 318

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0016198|Ga0466963_0016198_3229_4278
Length 349
Sequence MVIWQRTRLMAVKTVSARGTHRRALGSPGRMRIGYFLSSEEFSPRELLDQARRAEQAGFHALWISDHYHPWNDEQGHSGFVWSTIGALAQTTSLPVTTGVTCPTVRIHPAVIAQAAATSQLLHEGRFHLGVGTGEALNEHILGDRWPEADVRLEMLEEAVEVIRGLWQGGQYSHHGRHYTVENARIYDLPDEPPPILVSGFGPKAIGVAARIGDGFCTTSPEQEAIGAYREQGGKGPVHAGTKVCFMDDEEEARRTAHRLWPNEALPGELAQILPTPAHFEQACELVRPEQLVTPVGPDLDQHIASLKEYEEAGVDELFVQQIGPEHDRFFSEWAPKVLEEFGVSAARA

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
3 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
4 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
5 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
6 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
98 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
99 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0.83
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 0
Rhizoplane 3.31
Rhizosphere 83.43
Stem 0
Stem Tuber 0
Unclassified 4.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10042605 3300002067 Bacteria 1321
2 JGI25406J46586_10007208 3300003203 Bacteria 5087
3 JGI25406J46586_10055830 3300003203 Bacteria 1299
4 Ga0055540_1000065 3300003792 Bacteria 126812
5 Ga0055540_1002888 3300003792 Bacteria 8715
6 Ga0055540_1010686 3300003792 Bacteria 3033
7 Ga0070683_100002432 3300005329 Bacteria 14804
8 Ga0070683_100087890 3300005329 Bacteria 2915
9 Ga0070683_100222577 3300005329 Bacteria 1793
10 Ga0070683_100278348 3300005329 Bacteria 1592
11 Ga0070680_100005711 3300005336 Bacteria 9437
12 Ga0070687_100048711 3300005343 Bacteria 2180
13 Ga0070692_10005369 3300005345 Bacteria 5457
14 Ga0070674_100098275 3300005356 Bacteria 2127
15 Ga0070688_100066233 3300005365 Bacteria 2298
16 Ga0070688_100164959 3300005365 Bacteria 1525
17 Ga0070659_100032752 3300005366 Bacteria 4033
18 Ga0070667_100025963 3300005367 Bacteria 4872
19 Ga0070714_100037731 3300005435 Bacteria 4062
20 Ga0070714_100042845 3300005435 Bacteria 3825
21 Ga0070714_100063896 3300005435 Bacteria 3167
22 Ga0070714_100194494 3300005435 Bacteria 1853
23 Ga0070713_100274222 3300005436 Bacteria 1546
24 Ga0070700_100007710 3300005441 Bacteria 5830
25 Ga0070681_10025717 3300005458 Bacteria 5919
26 Ga0070681_10026331 3300005458 Bacteria 5846
27 Ga0070681_10349967 3300005458 Bacteria 1388
28 Ga0068867_100035416 3300005459 Bacteria 3620
29 Ga0070679_100001646 3300005530 Bacteria 20121
30 Ga0070679_100015250 3300005530 Bacteria 7383
31 Ga0070679_100052435 3300005530 Bacteria 4063
32 Ga0070679_100143532 3300005530 Bacteria 2366
33 Ga0070679_100147048 3300005530 Bacteria 2334
34 Ga0070684_100003388 3300005535 Bacteria 11952
35 Ga0068853_100139224 3300005539 Bacteria 2178
36 Ga0070686_100186161 3300005544 Bacteria 1479
37 Ga0070665_100134015 3300005548 Bacteria 2479
38 Ga0068855_100238690 3300005563 Bacteria 2032
39 Ga0070664_100073166 3300005564 Bacteria 2940
40 Ga0070664_100253350 3300005564 Bacteria 1583
41 Ga0068856_100129713 3300005614 Bacteria 2526
42 Ga0068852_100010826 3300005616 Bacteria 6832
43 Ga0068852_100040702 3300005616 Bacteria 3922
44 Ga0068866_10009156 3300005718 Bacteria 4198
45 Ga0068870_10019031 3300005840 Bacteria 3326
46 Ga0068860_100003099 3300005843 Bacteria 17183
47 Ga0081539_10000369 3300005985 Bacteria 98527
48 Ga0081539_10005140 3300005985 Bacteria 13643
49 Ga0081539_10007905 3300005985 Bacteria 9479
50 Ga0075365_10003357 3300006038 Bacteria 8233
51 Ga0075365_10003779 3300006038 Bacteria 7888
52 Ga0075365_10066066 3300006038 Bacteria 2426
53 Ga0075363_100082137 3300006048 Bacteria 1763
54 Ga0075364_10009132 3300006051 Bacteria 5938
55 Ga0075364_10013552 3300006051 Bacteria 5016
56 Ga0075364_10023365 3300006051 Bacteria 3915
57 Ga0070716_100066248 3300006173 Bacteria 2106
58 Ga0075369_10012531 3300006186 Bacteria 3350
59 Ga0075370_10036638 3300006353 Bacteria 2756
60 Ga0075428_100005606 3300006844 Bacteria 13945
61 Ga0075430_100030450 3300006846 Bacteria 4584
62 Ga0075431_100022424 3300006847 Bacteria 6454
63 Ga0075429_100007484 3300006880 Bacteria 9477
64 Ga0068865_100035208 3300006881 Bacteria 3365
65 Ga0105240_10110910 3300009093 Bacteria 3319
66 Ga0111539_10058295 3300009094 Bacteria 4582
67 Ga0111539_10241150 3300009094 Bacteria 2105
68 Ga0111539_10643466 3300009094 Bacteria 1235
69 Ga0105245_10023405 3300009098 Bacteria 5422
70 Ga0114129_10031664 3300009147 Bacteria 7476
71 Ga0105243_10287384 3300009148 Bacteria 1484
72 Ga0105242_10174527 3300009176 Bacteria 1891
73 Ga0105248_10286115 3300009177 Bacteria 1856
74 Ga0105249_10320919 3300009553 Bacteria 1560
75 Ga0105239_10013172 3300010375 Bacteria 9189
76 Ga0105239_10021246 3300010375 Bacteria 7157
77 Ga0105246_10067792 3300011119 Bacteria 2501
78 Ga0157371_10039537 3300013102 Bacteria 3373
79 Ga0157370_10007156 3300013104 Bacteria 12169
80 Ga0157369_10073567 3300013105 Bacteria 3666
81 Ga0157374_10449981 3300013296 Bacteria 1289
82 Ga0157372_10004491 3300013307 Bacteria 14885
83 Ga0157372_10172620 3300013307 Bacteria 2501
84 Ga0163163_10066772 3300014325 Bacteria 3574
85 Ga0157380_10135458 3300014326 Bacteria 2107
86 Ga0157380_10260251 3300014326 Bacteria 1575
87 Ga0157377_10042525 3300014745 Bacteria 2523
88 Ga0157379_10050318 3300014968 Bacteria 3719
89 Ga0206353_11672874 3300020082 Bacteria 3714
90 Ga0213874_10012114 3300021377 Bacteria 2204
91 Ga0213875_10056078 3300021388 Bacteria 1845
92 Ga0224712_10001082 3300022467 Bacteria 6004
93 Ga0224712_10005237 3300022467 Bacteria 3589
94 Ga0207426_1005128 3300025302 Bacteria 6110
95 Ga0209051_1000042 3300025303 Bacteria 308486
96 Ga0209051_1006397 3300025303 Bacteria 6646
97 Ga0209051_1006996 3300025303 Bacteria 6253
98 Ga0207688_10044376 3300025901 Bacteria 2477
99 Ga0207688_10078215 3300025901 Bacteria 1885
100 Ga0207647_10008840 3300025904 Bacteria 7187
101 Ga0207643_10003180 3300025908 Bacteria 8845
102 Ga0207643_10264243 3300025908 Bacteria 1063
103 Ga0207707_10026309 3300025912 Bacteria 5085
104 Ga0207707_10051948 3300025912 Bacteria 3569
105 Ga0207657_10092369 3300025919 Bacteria 2522
106 Ga0207657_10107622 3300025919 Bacteria 2306
107 Ga0207652_10051112 3300025921 Bacteria 3543
108 Ga0207652_10069110 3300025921 Bacteria 3066
109 Ga0207652_10167690 3300025921 Bacteria 1970
110 Ga0207652_10205582 3300025921 Bacteria 1772
111 Ga0207694_10404487 3300025924 Bacteria 1135
112 Ga0207664_10001969 3300025929 Bacteria 13534
113 Ga0207664_10049112 3300025929 Bacteria 3320
114 Ga0207690_10166244 3300025932 Bacteria 1649
115 Ga0207709_10054873 3300025935 Bacteria 2459
116 Ga0207704_10176739 3300025938 Bacteria 1538
117 Ga0207665_10085137 3300025939 Bacteria 2182
118 Ga0207691_10015371 3300025940 Bacteria 7283
119 Ga0207711_10210588 3300025941 Bacteria 1775
120 Ga0207679_10084222 3300025945 Bacteria 2439
121 Ga0207679_10299588 3300025945 Bacteria 1385
122 Ga0207667_10187477 3300025949 Bacteria 2123
123 Ga0207658_10065060 3300025986 Bacteria 2737
124 Ga0207708_10034808 3300026075 Bacteria 3832
125 Ga0207708_10037158 3300026075 Bacteria 3709
126 Ga0207702_10168398 3300026078 Bacteria 2006
127 Ga0207648_10023147 3300026089 Bacteria 5571
128 Ga0207674_10434716 3300026116 Bacteria 1268
129 Ga0207675_100024911 3300026118 Bacteria 5568
130 Ga0207675_100033015 3300026118 Bacteria 4822
131 Ga0207675_100037841 3300026118 Bacteria 4501
132 Ga0207675_100172114 3300026118 Bacteria 2070
133 Ga0207698_10003556 3300026142 Bacteria 9397
134 Ga0207698_10051445 3300026142 Bacteria 3150
135 Ga0207698_10152462 3300026142 Bacteria 2008
136 Ga0207428_10155201 3300027907 Bacteria 1741
137 Ga0268264_10000980 3300028381 Bacteria 29223
138 Ga0316177_1004303 3300030731 Bacteria 1712
139 Ga0316176_1084729 3300030732 Bacteria 2448
140 Ga0316180_1026910 3300030736 Bacteria 1114
141 Ga0307405_10112129 3300031731 Bacteria 1850
142 Ga0307413_10215106 3300031824 Bacteria 1399
143 Ga0307410_10017452 3300031852 Bacteria 4311
144 Ga0307410_10168619 3300031852 Bacteria 1647
145 Ga0307409_100133330 3300031995 Bacteria 2127
146 Ga0307411_10188867 3300032005 Bacteria 1571
147 Ga0307415_100106059 3300032126 Bacteria 2074
148 Ga0307415_100147326 3300032126 Bacteria 1807
149 Ga0373937_0019825 3300036401 Bacteria 6023
150 Ga0395899_0022836 3300037312 Bacteria 4739
151 Ga0395900_0602902 3300037418 Bacteria 1039
152 Ga0436364_0598509 3300037853 Bacteria 4358
153 Ga0436364_0934308 3300037853 Bacteria 3977
154 Ga0436365_0604668 3300039437 Bacteria 2226
155 Ga0436365_1169348 3300039437 Bacteria 2847
156 Ga0436365_1346866 3300039437 Bacteria 1745
157 Ga0436365_1352808 3300039437 Bacteria 1496
158 Ga0436365_1367630 3300039437 Bacteria 7180
159 Ga0436363_1128052 3300039450 Bacteria 2489
160 Ga0436363_1415609 3300039450 Bacteria 1480
161 Ga0436363_1533227 3300039450 Bacteria 3487
162 Ga0436362_0183999 3300039453 Bacteria 1867
163 Ga0439465_0003649 3300041413 Bacteria 5018
164 Ga0439448_0081287 3300042005 Bacteria 1088
165 Ga0466969_0004258 3300044656 Bacteria 7608
166 Ga0466972_0015935 3300044658 Bacteria 3759
167 Ga0466972_0025265 3300044658 Bacteria 2945
168 Ga0466972_0041809 3300044658 Bacteria 2230
169 Ga0466965_0051952 3300044683 Bacteria 2034
170 Ga0466965_0056262 3300044683 Bacteria 1959
171 Ga0466965_0177639 3300044683 Bacteria 1122
172 Ga0466966_0019279 3300044684 Bacteria 4489
173 Ga0466966_0034532 3300044684 Bacteria 3269
174 Ga0466966_0050541 3300044684 Bacteria 2644
175 Ga0466966_0120821 3300044684 Bacteria 1609
176 Ga0466966_0345020 3300044684 Bacteria 895
177 Ga0466961_0030225 3300044693 Bacteria 3481
178 Ga0466961_0086334 3300044693 Unclassified 1983
179 Ga0466963_0001692 3300044694 Bacteria 12018
180 Ga0466963_0005706 3300044694 Bacteria 7314
181 Ga0466963_0016198 3300044694 Bacteria 4633
182 Ga0466963_0019294 3300044694 Bacteria 4274
183 Ga0466963_0046391 3300044694 Bacteria 2865
184 Ga0466963_0054927 3300044694 Bacteria 2648
185 Ga0466963_0070892 3300044694 Bacteria 2345
186 Ga0466963_0084729 3300044694 Bacteria 2151
187 Ga0466963_0174412 3300044694 Bacteria 1500
188 Ga0466963_0210258 3300044694 Bacteria 1361
189 Ga0466963_0292108 3300044694 Bacteria 1146
190 Ga0466963_0346673 3300044694 Bacteria 1046
191 Ga0466964_0036683 3300044706 Bacteria 1967
192 Ga0466964_0060750 3300044706 Bacteria 1572
193 Ga0466971_0013411 3300044719 Bacteria 3600
194 Ga0466971_0036089 3300044719 Bacteria 2217
195 Ga0466971_0039417 3300044719 Bacteria 2120
196 Ga0466971_0063044 3300044719 Bacteria 1678
197 Ga0466968_0028456 3300044735 Bacteria 2304
198 Ga0466968_0058043 3300044735 Bacteria 1665
199 Ga0466970_0004131 3300044765 Bacteria 7137
200 Ga0466970_0016081 3300044765 Bacteria 3853
201 Ga0466970_0051313 3300044765 Unclassified 2201
202 Ga0466970_0104095 3300044765 Bacteria 1547
203 Ga0466970_0158062 3300044765 Bacteria 1253
204 Ga0466957_0004714 3300044842 Bacteria 7633
205 Ga0466957_0018233 3300044842 Bacteria 4120
206 Ga0466957_0030765 3300044842 Bacteria 3206
207 Ga0466957_0041300 3300044842 Bacteria 2789
208 Ga0466957_0073726 3300044842 Bacteria 2116
209 Ga0466957_0105644 3300044842 Unclassified 1780
210 Ga0466957_0107303 3300044842 Bacteria 1767
211 Ga0466957_0141466 3300044842 Bacteria 1550
212 Ga0466957_0189722 3300044842 Bacteria 1346
213 Ga0466960_0006413 3300044901 Bacteria 4720
214 Ga0466960_0011839 3300044901 Bacteria 3665
215 Ga0466960_0016843 3300044901 Bacteria 3177
216 Ga0466960_0017167 3300044901 Bacteria 3151
217 Ga0466960_0020089 3300044901 Bacteria 2954
218 Ga0466959_0012804 3300045049 Bacteria 6068
219 Ga0466959_0222112 3300045049 Bacteria 1310
220 Ga0466958_0000348 3300045836 Bacteria 18581
221 Ga0466958_0001540 3300045836 Bacteria 11043
222 Ga0466958_0008868 3300045836 Bacteria 5586
223 Ga0466958_0026952 3300045836 Bacteria 3398
224 Ga0466958_0077302 3300045836 Bacteria 2044
225 Ga0466958_0077947 3300045836 Bacteria 2036
226 Ga0466958_0104476 3300045836 Bacteria 1764
227 Ga0466958_0121867 3300045836 Bacteria 1633
228 Ga0466958_0164808 3300045836 Bacteria 1402
229 Ga0466958_0179283 3300045836 Bacteria 1344
230 Ga0466967_0005011 3300045976 Bacteria 9075
231 Ga0466967_0012504 3300045976 Bacteria 6498
232 Ga0466967_0022045 3300045976 Bacteria 5188
233 Ga0466967_0025652 3300045976 Bacteria 4863
234 Ga0466967_0030125 3300045976 Bacteria 4551
235 Ga0466967_0032770 3300045976 Bacteria 4391
236 Ga0466967_0034260 3300045976 Bacteria 4308
237 Ga0466967_0034645 3300045976 Bacteria 4288
238 Ga0466967_0045776 3300045976 Bacteria 3804
239 Ga0466967_0046201 3300045976 Bacteria 3789
240 Ga0466967_0100104 3300045976 Bacteria 2648
241 Ga0466967_0113898 3300045976 Bacteria 2489
242 Ga0466967_0196228 3300045976 Bacteria 1910
243 Ga0466967_0203039 3300045976 Bacteria 1878
244 Ga0466967_0300509 3300045976 Bacteria 1544
245 Ga0466967_0333101 3300045976 Bacteria 1466
246 Ga0466967_0347821 3300045976 Bacteria 1434
247 Ga0466967_0455128 3300045976 Bacteria 1251
248 Ga0466967_0551138 3300045976 Bacteria 1135
249 Ga0495651_0001154 3300046462 Bacteria 20426
250 Ga0495608_0094854 3300046511 Bacteria 1928
251 Ga0495587_0034518 3300046536 Bacteria 3050
252 Ga0495667_0002387 3300046559 Bacteria 12556
253 Ga0495657_0007647 3300046675 Bacteria 8320
254 Ga0495623_0024395 3300046679 Bacteria 3897
255 Ga0495624_0067764 3300046690 Bacteria 2226
256 Ga0495676_0084375 3300047321 Bacteria 2397
257 Ga0495680_0004487 3300047322 Bacteria 13346
258 Ga0495602_0059141 3300048088 Bacteria 3348
259 Ga0496103_0163538 3300048906 Bacteria 1428
260 Ga0496105_0023538 3300048908 Bacteria 4997
261 Ga0496108_0000245 3300048911 Bacteria 48363
262 Ga0496108_0214870 3300048911 Bacteria 1670
263 Ga0496108_0381866 3300048911 Bacteria 1230
264 Ga0496109_0015521 3300048912 Bacteria 6640
265 Ga0496109_0422048 3300048912 Bacteria 1260
266 Ga0496110_0042247 3300048913 Bacteria 3979
267 Ga0496112_0002250 3300048915 Bacteria 15422
268 Ga0496113_0098862 3300048916 Bacteria 2259
269 Ga0496114_0072087 3300048917 Bacteria 2904
270 Ga0496115_0356774 3300048918 Bacteria 1192
271 Ga0501031_0013439 3300049568 Bacteria 5338
272 Ga0501032_0023260 3300049569 Bacteria 4287
273 Ga0501036_0006192 3300049572 Bacteria 9710
274 Ga0501036_0010127 3300049572 Bacteria 7770
275 Ga0501036_0043246 3300049572 Bacteria 3814
276 Ga0501036_0186500 3300049572 Bacteria 1746
277 Ga0501037_0000365 3300049573 Bacteria 37978
278 Ga0501037_0005952 3300049573 Bacteria 8908
279 Ga0501037_0028255 3300049573 Bacteria 4143
280 Ga0501037_0104519 3300049573 Bacteria 2042
281 Ga0501038_0002259 3300049574 Bacteria 17910
282 Ga0501038_0014918 3300049574 Bacteria 7074
283 Ga0501038_0075663 3300049574 Bacteria 2845
284 Ga0501038_0104018 3300049574 Bacteria 2360
285 Ga0501038_0155344 3300049574 Bacteria 1863
286 Ga0501039_0000118 3300049575 Bacteria 54344
287 Ga0501039_0001126 3300049575 Bacteria 19670
288 Ga0501039_0013149 3300049575 Bacteria 6325
289 Ga0501039_0017227 3300049575 Bacteria 5542
290 Ga0501040_0008774 3300049576 Bacteria 6568
291 Ga0501040_0269339 3300049576 Bacteria 1216
292 Ga0501042_0068327 3300049578 Bacteria 2541
293 Ga0501042_0084394 3300049578 Bacteria 2277
294 Ga0501042_0219426 3300049578 Bacteria 1371
295 Ga0501043_0000931 3300049579 Bacteria 25918
296 Ga0501043_0006905 3300049579 Bacteria 9059
297 Ga0501043_0025852 3300049579 Bacteria 4605
298 Ga0501043_0107801 3300049579 Bacteria 2188
299 Ga0501043_0143599 3300049579 Bacteria 1869
300 Ga0501046_0015912 3300049580 Bacteria 6309
301 Ga0501046_0052444 3300049580 Bacteria 3214
302 Ga0501046_0171927 3300049580 Bacteria 1625
303 Ga0501048_0001793 3300049582 Bacteria 16318
304 Ga0501048_0175678 3300049582 Bacteria 1518
305 Ga0501067_0045657 3300049583 Bacteria 2432
306 Ga0501070_0000548 3300049586 Bacteria 34385
307 Ga0501070_0049196 3300049586 Bacteria 3501
308 Ga0501070_0067824 3300049586 Bacteria 2954
309 Ga0501071_0050206 3300049587 Bacteria 3005
310 Ga0501071_0057989 3300049587 Bacteria 2799
311 Ga0501072_0011917 3300049588 Bacteria 6640
312 Ga0501072_0022122 3300049588 Bacteria 4932
313 Ga0501073_0008790 3300049589 Bacteria 7473
314 Ga0501073_0010116 3300049589 Bacteria 6934
315 Ga0501073_0189679 3300049589 Bacteria 1422
316 Ga0501074_0184073 3300049590 Bacteria 1490
317 Ga0501076_0048784 3300049592 Bacteria 3346
318 Ga0501077_0004777 3300049593 Bacteria 8235
319 Ga0501079_0105943 3300049741 Bacteria 2182
320 Ga0501035_0005416 3300049822 Bacteria 12065
321 Ga0501035_0022702 3300049822 Bacteria 5763
322 Ga0501035_0079727 3300049822 Bacteria 2891
323 Ga0501035_0291541 3300049822 Bacteria 1377
324 Ga0501044_0012869 3300049823 Bacteria 9056
325 Ga0501044_0031316 3300049823 Bacteria 5599
326 Ga0501045_0028032 3300049824 Bacteria 4061
327 Ga0501045_0107133 3300049824 Bacteria 2071
328 Ga0501045_0186908 3300049824 Bacteria 1544
329 nmdc:mga03n38_55085_c1 3300050490 Bacteria 1790
330 nmdc:mga00v17_111868_c1 3300050491 Bacteria 1733
331 nmdc:mga00v17_115733_c1 3300050491 Bacteria 1704
332 nmdc:mga00v17_255289_c1 3300050491 Bacteria 1137
333 nmdc:mga0yw44_11755_c1 3300050492 Bacteria 4536
334 nmdc:mga0yw44_2556_c1 3300050492 Bacteria 7809
335 nmdc:mga0yw44_30823_c1 3300050492 Bacteria 3113
336 nmdc:mga0yw44_43341_c1 3300050492 Bacteria 2686
337 nmdc:mga0yw44_8960_c1 3300050492 Bacteria 5023
338 nmdc:mga07m45_27206_c2 3300050496 Bacteria 2777
339 nmdc:mga07m45_32417_c1 3300050496 Bacteria 2898
340 nmdc:mga07m45_94707_c1 3300050496 Bacteria 1712
341 nmdc:mga05p37_4906_c2 3300050507 Bacteria 7449
342 nmdc:mga09592_8560_c1 3300050508 Bacteria 6017
343 nmdc:mga0qj67_11730_c1 3300050509 Bacteria 6577
344 nmdc:mga06r32_69382_c1 3300050510 Bacteria 3407
345 nmdc:mga08y16_21254_c1 3300050511 Bacteria 6853
346 nmdc:mga08y16_480513_c1 3300050511 Bacteria 1264
347 Ga0495595_0001677 3300053084 Bacteria 8667
348 Ga0500644_0000029 3300053088 Bacteria 90532
349 Ga0500616_0058646 3300053153 Bacteria 2002
350 Ga0501084_0036039 3300054114 Bacteria 4134
351 Ga0501082_0014598 3300060353 Bacteria 6765
352 Ga0501082_0085394 3300060353 Bacteria 2722
353 Ga0466962_0017032 3300061719 Bacteria 3501
354 Ga0466962_0052094 3300061719 Bacteria 1956
355 Ga0530510_0381663 3300061734 Bacteria 1061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0179283 Ga0466958_0179283_30_821 254
2 3300044842 Ga0466957_0189722 Ga0466957_0189722_544_1335 261
3 3300044684 Ga0466966_0345020 Ga0466966_0345020_81_884 265
4 3300031852 Ga0307410_10017452 Ga0307410_100174522 290
5 3300046511 Ga0495608_0094854 Ga0495608_0094854_235_1212 293
6 3300046690 Ga0495624_0067764 Ga0495624_0067764_1175_2152 293
7 3300047321 Ga0495676_0084375 Ga0495676_0084375_1238_2215 293
8 3300045976 Ga0466967_0551138 Ga0466967_0551138_178_1101 296
9 3300025901 Ga0207688_10078215 Ga0207688_100782152 309
10 3300031824 Ga0307413_10215106 Ga0307413_102151062 309
11 3300005329 Ga0070683_100278348 Ga0070683_1002783482 311
12 3300005530 Ga0070679_100147048 Ga0070679_1001470482 311
13 3300005985 Ga0081539_10005140 Ga0081539_1000514018 311
14 3300025302 Ga0207426_1005128 Ga0207426_10051288 311
15 3300025919 Ga0207657_10107622 Ga0207657_101076222 311
16 3300025921 Ga0207652_10069110 Ga0207652_100691103 311
17 3300031731 Ga0307405_10112129 Ga0307405_101121292 311
18 3300048912 Ga0496109_0422048 Ga0496109_0422048_172_1110 311
19 3300053153 Ga0500616_0058646 Ga0500616_0058646_441_1379 311
20 iso_pu_bacteria 2902810491 2902816022 311
21 3300014968 Ga0157379_10050318 Ga0157379_100503183 312
22 3300031852 Ga0307410_10168619 Ga0307410_101686191 312
23 3300032126 Ga0307415_100106059 Ga0307415_1001060592 312
24 3300044901 Ga0466960_0016843 Ga0466960_0016843_1809_2750 312
25 3300048912 Ga0496109_0015521 Ga0496109_0015521_2302_3294 312
26 3300048913 Ga0496110_0042247 Ga0496110_0042247_1295_2287 312
27 3300048916 Ga0496113_0098862 Ga0496113_0098862_43_984 312
28 3300049573 Ga0501037_0028255 Ga0501037_0028255_2532_3473 312
29 3300049574 Ga0501038_0155344 Ga0501038_0155344_700_1641 312
30 3300049575 Ga0501039_0017227 Ga0501039_0017227_2495_3436 312
31 3300049579 Ga0501043_0025852 Ga0501043_0025852_2855_3796 312
32 3300049580 Ga0501046_0171927 Ga0501046_0171927_417_1358 312
33 3300049583 Ga0501067_0045657 Ga0501067_0045657_1275_2216 312
34 3300049586 Ga0501070_0067824 Ga0501070_0067824_1947_2888 312
35 3300049587 Ga0501071_0057989 Ga0501071_0057989_679_1620 312
36 3300049588 Ga0501072_0022122 Ga0501072_0022122_2523_3464 312
37 3300049589 Ga0501073_0008790 Ga0501073_0008790_859_1800 312
38 3300049741 Ga0501079_0105943 Ga0501079_0105943_950_1891 312
39 3300049822 Ga0501035_0022702 Ga0501035_0022702_430_1371 312
40 3300049823 Ga0501044_0031316 Ga0501044_0031316_208_1149 312
41 3300049824 Ga0501045_0186908 Ga0501045_0186908_512_1453 312
42 3300060353 Ga0501082_0014598 Ga0501082_0014598_5004_5945 312
43 iso_pu_bacteria 2816332139 2816503701 312
44 iso_pu_bacteria 2915358134 2915362625 312
45 3300003203 JGI25406J46586_10007208 JGI25406J46586_100072084 313
46 3300005329 Ga0070683_100087890 Ga0070683_1000878902 313
47 3300005336 Ga0070680_100005711 Ga0070680_1000057116 313
48 3300005356 Ga0070674_100098275 Ga0070674_1000982752 313
49 3300005366 Ga0070659_100032752 Ga0070659_1000327523 313
50 3300005458 Ga0070681_10025717 Ga0070681_100257176 313
51 3300005530 Ga0070679_100015250 Ga0070679_1000152505 313
52 3300005535 Ga0070684_100003388 Ga0070684_1000033886 313
53 3300005539 Ga0068853_100139224 Ga0068853_1001392242 313
54 3300005563 Ga0068855_100238690 Ga0068855_1002386902 313
55 3300005564 Ga0070664_100073166 Ga0070664_1000731663 313
56 3300005616 Ga0068852_100040702 Ga0068852_1000407022 313
57 3300005985 Ga0081539_10000369 Ga0081539_1000036962 313
58 3300009093 Ga0105240_10110910 Ga0105240_101109102 313
59 3300013102 Ga0157371_10039537 Ga0157371_100395372 313
60 3300013104 Ga0157370_10007156 Ga0157370_1000715612 313
61 3300013105 Ga0157369_10073567 Ga0157369_100735674 313
62 3300013307 Ga0157372_10004491 Ga0157372_100044915 313
63 3300022467 Ga0224712_10001082 Ga0224712_100010826 313
64 3300025912 Ga0207707_10051948 Ga0207707_100519482 313
65 3300025921 Ga0207652_10051112 Ga0207652_100511122 313
66 3300025949 Ga0207667_10187477 Ga0207667_101874772 313
67 3300026118 Ga0207675_100172114 Ga0207675_1001721142 313
68 3300026142 Ga0207698_10003556 Ga0207698_100035563 313
69 3300026142 Ga0207698_10051445 Ga0207698_100514452 313
70 3300044694 Ga0466963_0174412 Ga0466963_0174412_498_1442 313
71 iso_pu_bacteria 2643221715 2644639366 313
72 iso_pu_bacteria 2902810491 2902816209 313
73 iso_pu_bacteria 2902837492 2902839681 313
74 3300003203 JGI25406J46586_10055830 JGI25406J46586_100558302 314
75 3300005329 Ga0070683_100222577 Ga0070683_1002225773 314
76 3300005614 Ga0068856_100129713 Ga0068856_1001297132 314
77 3300005985 Ga0081539_10007905 Ga0081539_100079054 314
78 3300009553 Ga0105249_10320919 Ga0105249_103209192 314
79 3300011119 Ga0105246_10067792 Ga0105246_100677922 314
80 3300013296 Ga0157374_10449981 Ga0157374_104499811 314
81 3300025908 Ga0207643_10264243 Ga0207643_102642431 314
82 3300025932 Ga0207690_10166244 Ga0207690_101662442 314
83 3300025945 Ga0207679_10084222 Ga0207679_100842221 314
84 3300026078 Ga0207702_10168398 Ga0207702_101683983 314
85 3300026116 Ga0207674_10434716 Ga0207674_104347161 314
86 3300036401 Ga0373937_0019825 Ga0373937_0019825_365_1318 314
87 3300039437 Ga0436365_1352808 Ga0436365_1352808_192_1142 314
88 3300042005 Ga0439448_0081287 Ga0439448_0081287_20_970 314
89 3300044684 Ga0466966_0120821 Ga0466966_0120821_201_1151 314
90 3300044694 Ga0466963_0016198 Ga0466963_0016198_3229_4278 314
91 3300044694 Ga0466963_0054927 Ga0466963_0054927_1413_2372 314
92 3300044694 Ga0466963_0084729 Ga0466963_0084729_101_1060 314
93 3300044694 Ga0466963_0210258 Ga0466963_0210258_200_1159 314
94 3300044706 Ga0466964_0060750 Ga0466964_0060750_604_1548 314
95 3300044719 Ga0466971_0039417 Ga0466971_0039417_57_1013 314
96 3300044765 Ga0466970_0104095 Ga0466970_0104095_342_1304 314
97 3300044842 Ga0466957_0018233 Ga0466957_0018233_1406_2455 314
98 3300044842 Ga0466957_0105644 Ga0466957_0105644_246_1217 314
99 3300045976 Ga0466967_0022045 Ga0466967_0022045_1370_2323 314
100 3300045976 Ga0466967_0025652 Ga0466967_0025652_3618_4577 314
101 3300045976 Ga0466967_0032770 Ga0466967_0032770_1808_2755 314
102 3300045976 Ga0466967_0034260 Ga0466967_0034260_1311_2255 314
103 3300045976 Ga0466967_0100104 Ga0466967_0100104_624_1574 314
104 3300045976 Ga0466967_0203039 Ga0466967_0203039_51_1010 314
105 3300045976 Ga0466967_0333101 Ga0466967_0333101_404_1363 314
106 3300045976 Ga0466967_0347821 Ga0466967_0347821_103_1056 314
107 3300046462 Ga0495651_0001154 Ga0495651_0001154_8200_9153 314
108 3300046536 Ga0495587_0034518 Ga0495587_0034518_1310_2263 314
109 3300046559 Ga0495667_0002387 Ga0495667_0002387_1903_2856 314
110 3300046675 Ga0495657_0007647 Ga0495657_0007647_3025_3978 314
111 3300046679 Ga0495623_0024395 Ga0495623_0024395_486_1439 314
112 3300047322 Ga0495680_0004487 Ga0495680_0004487_2646_3599 314
113 3300048088 Ga0495602_0059141 Ga0495602_0059141_251_1204 314
114 3300048911 Ga0496108_0000245 Ga0496108_0000245_4888_5841 314
115 3300053084 Ga0495595_0001677 Ga0495595_0001677_3223_4176 314
116 3300061719 Ga0466962_0017032 Ga0466962_0017032_726_1682 314
117 iso_pu_bacteria 2731639228 2731907951 314
118 3300005329 Ga0070683_100002432 Ga0070683_1000024323 315
119 3300005343 Ga0070687_100048711 Ga0070687_1000487112 315
120 3300005345 Ga0070692_10005369 Ga0070692_100053693 315
121 3300005365 Ga0070688_100066233 Ga0070688_1000662331 315
122 3300005367 Ga0070667_100025963 Ga0070667_1000259636 315
123 3300005435 Ga0070714_100063896 Ga0070714_1000638962 315
124 3300005435 Ga0070714_100194494 Ga0070714_1001944942 315
125 3300005441 Ga0070700_100007710 Ga0070700_1000077102 315
126 3300005458 Ga0070681_10349967 Ga0070681_103499672 315
127 3300005459 Ga0068867_100035416 Ga0068867_1000354162 315
128 3300005530 Ga0070679_100052435 Ga0070679_1000524352 315
129 3300005530 Ga0070679_100143532 Ga0070679_1001435321 315
130 3300005544 Ga0070686_100186161 Ga0070686_1001861611 315
131 3300005564 Ga0070664_100253350 Ga0070664_1002533502 315
132 3300005616 Ga0068852_100010826 Ga0068852_1000108263 315
133 3300005718 Ga0068866_10009156 Ga0068866_100091563 315
134 3300005840 Ga0068870_10019031 Ga0068870_100190313 315
135 3300005843 Ga0068860_100003099 Ga0068860_1000030994 315
136 3300006038 Ga0075365_10003357 Ga0075365_100033575 315
137 3300006038 Ga0075365_10003779 Ga0075365_1000377911 315
138 3300006048 Ga0075363_100082137 Ga0075363_1000821372 315
139 3300006051 Ga0075364_10009132 Ga0075364_100091324 315
140 3300006051 Ga0075364_10013552 Ga0075364_100135524 315
141 3300006051 Ga0075364_10023365 Ga0075364_100233656 315
142 3300006173 Ga0070716_100066248 Ga0070716_1000662482 315
143 3300006353 Ga0075370_10036638 Ga0075370_100366382 315
144 3300006881 Ga0068865_100035208 Ga0068865_1000352084 315
145 3300009094 Ga0111539_10058295 Ga0111539_100582953 315
146 3300009094 Ga0111539_10643466 Ga0111539_106434662 315
147 3300009098 Ga0105245_10023405 Ga0105245_100234056 315
148 3300009176 Ga0105242_10174527 Ga0105242_101745272 315
149 3300009177 Ga0105248_10286115 Ga0105248_102861151 315
150 3300013307 Ga0157372_10172620 Ga0157372_101726202 315
151 3300014325 Ga0163163_10066772 Ga0163163_100667722 315
152 3300014326 Ga0157380_10135458 Ga0157380_101354583 315
153 3300014326 Ga0157380_10260251 Ga0157380_102602512 315
154 3300014745 Ga0157377_10042525 Ga0157377_100425252 315
155 3300021377 Ga0213874_10012114 Ga0213874_100121141 315
156 3300021388 Ga0213875_10056078 Ga0213875_100560782 315
157 3300022467 Ga0224712_10005237 Ga0224712_100052372 315
158 3300025901 Ga0207688_10044376 Ga0207688_100443764 315
159 3300025908 Ga0207643_10003180 Ga0207643_100031803 315
160 3300025921 Ga0207652_10167690 Ga0207652_101676902 315
161 3300025921 Ga0207652_10205582 Ga0207652_102055822 315
162 3300025924 Ga0207694_10404487 Ga0207694_104044871 315
163 3300025935 Ga0207709_10054873 Ga0207709_100548732 315
164 3300025938 Ga0207704_10176739 Ga0207704_101767392 315
165 3300025939 Ga0207665_10085137 Ga0207665_100851372 315
166 3300025940 Ga0207691_10015371 Ga0207691_100153714 315
167 3300025941 Ga0207711_10210588 Ga0207711_102105882 315
168 3300025945 Ga0207679_10299588 Ga0207679_102995882 315
169 3300025986 Ga0207658_10065060 Ga0207658_100650601 315
170 3300026075 Ga0207708_10034808 Ga0207708_100348082 315
171 3300026075 Ga0207708_10037158 Ga0207708_100371585 315
172 3300026089 Ga0207648_10023147 Ga0207648_100231474 315
173 3300026118 Ga0207675_100024911 Ga0207675_1000249112 315
174 3300026118 Ga0207675_100033015 Ga0207675_1000330154 315
175 3300026118 Ga0207675_100037841 Ga0207675_1000378412 315
176 3300026142 Ga0207698_10152462 Ga0207698_101524621 315
177 3300027907 Ga0207428_10155201 Ga0207428_101552012 315
178 3300028381 Ga0268264_10000980 Ga0268264_1000098015 315
179 3300030731 Ga0316177_1004303 Ga0316177_10043032 315
180 3300030732 Ga0316176_1084729 Ga0316176_10847292 315
181 3300030736 Ga0316180_1026910 Ga0316180_10269102 315
182 3300032126 Ga0307415_100147326 Ga0307415_1001473262 315
183 3300037853 Ga0436364_0598509 Ga0436364_0598509_1978_2934 315
184 3300037853 Ga0436364_0934308 Ga0436364_0934308_946_1899 315
185 3300039437 Ga0436365_1367630 Ga0436365_1367630_3822_4775 315
186 3300039450 Ga0436363_1128052 Ga0436363_1128052_491_1444 315
187 3300039450 Ga0436363_1415609 Ga0436363_1415609_39_992 315
188 3300039450 Ga0436363_1533227 Ga0436363_1533227_435_1388 315
189 3300044658 Ga0466972_0015935 Ga0466972_0015935_448_1419 315
190 3300044658 Ga0466972_0025265 Ga0466972_0025265_1599_2552 315
191 3300044658 Ga0466972_0041809 Ga0466972_0041809_288_1241 315
192 3300044683 Ga0466965_0051952 Ga0466965_0051952_691_1644 315
193 3300044684 Ga0466966_0019279 Ga0466966_0019279_1511_2464 315
194 3300044684 Ga0466966_0034532 Ga0466966_0034532_2293_3249 315
195 3300044694 Ga0466963_0005706 Ga0466963_0005706_5126_6079 315
196 3300044694 Ga0466963_0046391 Ga0466963_0046391_1771_2727 315
197 3300044694 Ga0466963_0346673 Ga0466963_0346673_58_1011 315
198 3300044706 Ga0466964_0036683 Ga0466964_0036683_25_978 315
199 3300044719 Ga0466971_0013411 Ga0466971_0013411_1609_2565 315
200 3300044719 Ga0466971_0036089 Ga0466971_0036089_845_1798 315
201 3300044735 Ga0466968_0028456 Ga0466968_0028456_1327_2280 315
202 3300044765 Ga0466970_0004131 Ga0466970_0004131_4251_5204 315
203 3300044765 Ga0466970_0158062 Ga0466970_0158062_175_1122 315
204 3300044842 Ga0466957_0030765 Ga0466957_0030765_2047_3018 315
205 3300044842 Ga0466957_0041300 Ga0466957_0041300_566_1519 315
206 3300044842 Ga0466957_0107303 Ga0466957_0107303_18_971 315
207 3300044901 Ga0466960_0006413 Ga0466960_0006413_72_1025 315
208 3300044901 Ga0466960_0020089 Ga0466960_0020089_33_986 315
209 3300045049 Ga0466959_0012804 Ga0466959_0012804_943_1899 315
210 3300045049 Ga0466959_0222112 Ga0466959_0222112_242_1195 315
211 3300045836 Ga0466958_0001540 Ga0466958_0001540_8583_9536 315
212 3300045836 Ga0466958_0008868 Ga0466958_0008868_4148_5104 315
213 3300045836 Ga0466958_0026952 Ga0466958_0026952_811_1764 315
214 3300045836 Ga0466958_0104476 Ga0466958_0104476_257_1210 315
215 3300045836 Ga0466958_0121867 Ga0466958_0121867_391_1344 315
216 3300045976 Ga0466967_0012504 Ga0466967_0012504_3705_4658 315
217 3300045976 Ga0466967_0045776 Ga0466967_0045776_1059_2012 315
218 3300045976 Ga0466967_0113898 Ga0466967_0113898_1345_2298 315
219 3300045976 Ga0466967_0196228 Ga0466967_0196228_100_1053 315
220 3300045976 Ga0466967_0300509 Ga0466967_0300509_541_1497 315
221 3300048906 Ga0496103_0163538 Ga0496103_0163538_254_1207 315
222 3300048911 Ga0496108_0214870 Ga0496108_0214870_685_1638 315
223 3300048911 Ga0496108_0381866 Ga0496108_0381866_246_1199 315
224 3300048915 Ga0496112_0002250 Ga0496112_0002250_7580_8533 315
225 3300048918 Ga0496115_0356774 Ga0496115_0356774_44_997 315
226 3300049572 Ga0501036_0006192 Ga0501036_0006192_6047_7000 315
227 3300049573 Ga0501037_0000365 Ga0501037_0000365_21076_22029 315
228 3300049574 Ga0501038_0002259 Ga0501038_0002259_1978_2931 315
229 3300049575 Ga0501039_0000118 Ga0501039_0000118_15157_16110 315
230 3300049579 Ga0501043_0000931 Ga0501043_0000931_4254_5207 315
231 3300049586 Ga0501070_0000548 Ga0501070_0000548_22423_23376 315
232 3300049589 Ga0501073_0010116 Ga0501073_0010116_1891_2844 315
233 3300050490 nmdc:mga03n38_55085_c1 nmdc:mga03n38_55085_c1_674_1621 315
234 3300050491 nmdc:mga00v17_111868_c1 nmdc:mga00v17_111868_c1_317_1264 315
235 3300050491 nmdc:mga00v17_115733_c1 nmdc:mga00v17_115733_c1_174_1163 315
236 3300050491 nmdc:mga00v17_255289_c1 nmdc:mga00v17_255289_c1_141_1088 315
237 3300050492 nmdc:mga0yw44_2556_c1 nmdc:mga0yw44_2556_c1_41_988 315
238 3300050492 nmdc:mga0yw44_30823_c1 nmdc:mga0yw44_30823_c1_745_1698 315
239 3300050492 nmdc:mga0yw44_43341_c1 nmdc:mga0yw44_43341_c1_266_1213 315
240 3300050496 nmdc:mga07m45_27206_c2 nmdc:mga07m45_27206_c2_479_1426 315
241 3300050496 nmdc:mga07m45_32417_c1 nmdc:mga07m45_32417_c1_1872_2819 315
242 3300050511 nmdc:mga08y16_21254_c1 nmdc:mga08y16_21254_c1_5132_6085 315
243 3300050511 nmdc:mga08y16_480513_c1 nmdc:mga08y16_480513_c1_235_1188 315
244 3300053088 Ga0500644_0000029 Ga0500644_0000029_74249_75196 315
245 3300061719 Ga0466962_0052094 Ga0466962_0052094_512_1468 315
246 3300061734 Ga0530510_0381663 Ga0530510_0381663_99_1046 315
247 3300003792 Ga0055540_1002888 Ga0055540_100288811 316
248 3300003792 Ga0055540_1010686 Ga0055540_10106865 316
249 3300005436 Ga0070713_100274222 Ga0070713_1002742222 316
250 3300005548 Ga0070665_100134015 Ga0070665_1001340152 316
251 3300006038 Ga0075365_10066066 Ga0075365_100660663 316
252 3300006186 Ga0075369_10012531 Ga0075369_100125312 316
253 3300009094 Ga0111539_10241150 Ga0111539_102411502 316
254 3300025303 Ga0209051_1006397 Ga0209051_10063973 316
255 3300025303 Ga0209051_1006996 Ga0209051_10069966 316
256 3300031995 Ga0307409_100133330 Ga0307409_1001333302 316
257 3300032005 Ga0307411_10188867 Ga0307411_101888672 316
258 3300037312 Ga0395899_0022836 Ga0395899_0022836_308_1261 316
259 3300037418 Ga0395900_0602902 Ga0395900_0602902_62_1012 316
260 3300039437 Ga0436365_0604668 Ga0436365_0604668_1179_2135 316
261 3300039437 Ga0436365_1346866 Ga0436365_1346866_774_1730 316
262 3300041413 Ga0439465_0003649 Ga0439465_0003649_125_1081 316
263 3300044683 Ga0466965_0056262 Ga0466965_0056262_139_1095 316
264 3300044684 Ga0466966_0050541 Ga0466966_0050541_494_1450 316
265 3300044693 Ga0466961_0030225 Ga0466961_0030225_1662_2618 316
266 3300044694 Ga0466963_0019294 Ga0466963_0019294_189_1145 316
267 3300044694 Ga0466963_0070892 Ga0466963_0070892_772_1728 316
268 3300044694 Ga0466963_0292108 Ga0466963_0292108_96_1052 316
269 3300044842 Ga0466957_0004714 Ga0466957_0004714_3553_4509 316
270 3300044842 Ga0466957_0141466 Ga0466957_0141466_543_1499 316
271 3300044901 Ga0466960_0011839 Ga0466960_0011839_2436_3392 316
272 3300045836 Ga0466958_0077947 Ga0466958_0077947_164_1120 316
273 3300045836 Ga0466958_0164808 Ga0466958_0164808_230_1186 316
274 3300045976 Ga0466967_0005011 Ga0466967_0005011_7186_8142 316
275 3300045976 Ga0466967_0030125 Ga0466967_0030125_2734_3690 316
276 3300045976 Ga0466967_0034645 Ga0466967_0034645_1844_2800 316
277 3300045976 Ga0466967_0046201 Ga0466967_0046201_188_1144 316
278 3300050492 nmdc:mga0yw44_11755_c1 nmdc:mga0yw44_11755_c1_1790_2764 316
279 3300002067 JGI24735J21928_10042605 JGI24735J21928_100426052 317
280 3300003792 Ga0055540_1000065 Ga0055540_10000659 317
281 3300005365 Ga0070688_100164959 Ga0070688_1001649592 317
282 3300005435 Ga0070714_100037731 Ga0070714_1000377315 317
283 3300005435 Ga0070714_100042845 Ga0070714_1000428455 317
284 3300005458 Ga0070681_10026331 Ga0070681_100263313 317
285 3300005530 Ga0070679_100001646 Ga0070679_1000016465 317
286 3300006844 Ga0075428_100005606 Ga0075428_1000056064 317
287 3300006846 Ga0075430_100030450 Ga0075430_1000304503 317
288 3300006847 Ga0075431_100022424 Ga0075431_1000224242 317
289 3300006880 Ga0075429_100007484 Ga0075429_1000074846 317
290 3300009147 Ga0114129_10031664 Ga0114129_100316642 317
291 3300009148 Ga0105243_10287384 Ga0105243_102873841 317
292 3300010375 Ga0105239_10013172 Ga0105239_1001317210 317
293 3300010375 Ga0105239_10021246 Ga0105239_100212468 317
294 3300020082 Ga0206353_11672874 Ga0206353_116728743 317
295 3300025303 Ga0209051_1000042 Ga0209051_10000429 317
296 3300025904 Ga0207647_10008840 Ga0207647_100088406 317
297 3300025912 Ga0207707_10026309 Ga0207707_100263093 317
298 3300025919 Ga0207657_10092369 Ga0207657_100923693 317
299 3300025929 Ga0207664_10001969 Ga0207664_100019695 317
300 3300025929 Ga0207664_10049112 Ga0207664_100491126 317
301 3300039437 Ga0436365_1169348 Ga0436365_1169348_1393_2352 317
302 3300039453 Ga0436362_0183999 Ga0436362_0183999_533_1507 317
303 3300044656 Ga0466969_0004258 Ga0466969_0004258_6225_7205 317
304 3300044683 Ga0466965_0177639 Ga0466965_0177639_120_1103 317
305 3300044693 Ga0466961_0086334 Ga0466961_0086334_941_1921 317
306 3300044694 Ga0466963_0001692 Ga0466963_0001692_319_1299 317
307 3300044719 Ga0466971_0063044 Ga0466971_0063044_624_1607 317
308 3300044735 Ga0466968_0058043 Ga0466968_0058043_552_1532 317
309 3300044765 Ga0466970_0016081 Ga0466970_0016081_2782_3765 317
310 3300044765 Ga0466970_0051313 Ga0466970_0051313_319_1299 317
311 3300044842 Ga0466957_0073726 Ga0466957_0073726_115_1083 317
312 3300044901 Ga0466960_0017167 Ga0466960_0017167_153_1109 317
313 3300045836 Ga0466958_0000348 Ga0466958_0000348_10221_11201 317
314 3300045836 Ga0466958_0077302 Ga0466958_0077302_63_1025 317
315 3300045976 Ga0466967_0455128 Ga0466967_0455128_77_1045 317
316 3300048908 Ga0496105_0023538 Ga0496105_0023538_2611_3588 317
317 3300048917 Ga0496114_0072087 Ga0496114_0072087_54_1031 317
318 3300049568 Ga0501031_0013439 Ga0501031_0013439_3727_4713 317
319 3300049569 Ga0501032_0023260 Ga0501032_0023260_577_1563 317
320 3300049572 Ga0501036_0010127 Ga0501036_0010127_3445_4434 317
321 3300049572 Ga0501036_0043246 Ga0501036_0043246_589_1575 317
322 3300049572 Ga0501036_0186500 Ga0501036_0186500_163_1125 317
323 3300049573 Ga0501037_0005952 Ga0501037_0005952_3347_4333 317
324 3300049573 Ga0501037_0104519 Ga0501037_0104519_864_1856 317
325 3300049574 Ga0501038_0014918 Ga0501038_0014918_1202_2191 317
326 3300049574 Ga0501038_0075663 Ga0501038_0075663_1076_2068 317
327 3300049574 Ga0501038_0104018 Ga0501038_0104018_302_1288 317
328 3300049575 Ga0501039_0001126 Ga0501039_0001126_2088_3074 317
329 3300049575 Ga0501039_0013149 Ga0501039_0013149_1646_2638 317
330 3300049576 Ga0501040_0008774 Ga0501040_0008774_2743_3735 317
331 3300049576 Ga0501040_0269339 Ga0501040_0269339_78_1064 317
332 3300049578 Ga0501042_0068327 Ga0501042_0068327_1513_2472 317
333 3300049578 Ga0501042_0084394 Ga0501042_0084394_978_1967 317
334 3300049578 Ga0501042_0219426 Ga0501042_0219426_209_1195 317
335 3300049579 Ga0501043_0006905 Ga0501043_0006905_556_1542 317
336 3300049579 Ga0501043_0107801 Ga0501043_0107801_788_1780 317
337 3300049579 Ga0501043_0143599 Ga0501043_0143599_769_1758 317
338 3300049580 Ga0501046_0015912 Ga0501046_0015912_984_1973 317
339 3300049580 Ga0501046_0052444 Ga0501046_0052444_1745_2731 317
340 3300049582 Ga0501048_0001793 Ga0501048_0001793_2862_3848 317
341 3300049582 Ga0501048_0175678 Ga0501048_0175678_426_1388 317
342 3300049586 Ga0501070_0049196 Ga0501070_0049196_710_1696 317
343 3300049587 Ga0501071_0050206 Ga0501071_0050206_873_1865 317
344 3300049588 Ga0501072_0011917 Ga0501072_0011917_2642_3634 317
345 3300049589 Ga0501073_0189679 Ga0501073_0189679_276_1265 317
346 3300049590 Ga0501074_0184073 Ga0501074_0184073_213_1172 317
347 3300049592 Ga0501076_0048784 Ga0501076_0048784_360_1319 317
348 3300049593 Ga0501077_0004777 Ga0501077_0004777_654_1646 317
349 3300049822 Ga0501035_0005416 Ga0501035_0005416_9845_10834 317
350 3300049822 Ga0501035_0079727 Ga0501035_0079727_107_1093 317
351 3300049822 Ga0501035_0291541 Ga0501035_0291541_48_1040 317
352 3300049823 Ga0501044_0012869 Ga0501044_0012869_2614_3603 317
353 3300049824 Ga0501045_0028032 Ga0501045_0028032_2147_3139 317
354 3300049824 Ga0501045_0107133 Ga0501045_0107133_44_1006 317
355 3300050492 nmdc:mga0yw44_8960_c1 nmdc:mga0yw44_8960_c1_2364_3320 317
356 3300050496 nmdc:mga07m45_94707_c1 nmdc:mga07m45_94707_c1_385_1341 317
357 3300050507 nmdc:mga05p37_4906_c2 nmdc:mga05p37_4906_c2_4384_5358 317
358 3300050508 nmdc:mga09592_8560_c1 nmdc:mga09592_8560_c1_1069_2043 317
359 3300050509 nmdc:mga0qj67_11730_c1 nmdc:mga0qj67_11730_c1_3526_4500 317
360 3300050510 nmdc:mga06r32_69382_c1 nmdc:mga06r32_69382_c1_1996_2970 317
361 3300054114 Ga0501084_0036039 Ga0501084_0036039_2967_3926 317
362 3300060353 Ga0501082_0085394 Ga0501082_0085394_116_1108 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

31

317

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9355 1 315
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9316 1 315
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.927 1 315
3c8n-assembly1.cif.gz_A crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9255 1 315
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.9249 2 315
ID Description Score Start End Superfamily
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9249 2 315 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9137 2 315 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9091 1 315 3.20.20.30
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9079 2 312 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9009 1 315 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A7Z0CIT4-F1-model_v4 G6PDH family F420-dependent oxidoreductase 0.994 1 314 GO:0016705
AF-A0A7Y9RYV3-F1-model_v4 G6PDH family F420-dependent oxidoreductase 0.9929 1 316 GO:0016705
AF-E4NA47-F1-model_v4 Putative oxidoreductase 0.9898 1 315 GO:0016705
GO:0050660
AF-A0A7W1B0L6-F1-model_v4 TIGR03557 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.9888 1 203 GO:0016705
AF-A0A3N5S6F1-F1-model_v4 TIGR03557 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.9884 1 186 GO:0016705

Feature Viewer

pLDDT pTM Quality
95.22 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map