F420705

General Info

Members Datasets Scaffolds Average Seq Length
357 213 346 223

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10197267|rootH2_101972672
Length 253
Sequence MFDIICNTLKIDRKYPLICAANQHQYLIFMAIDLEPSWLNVLGEEFDKSYMSDLKKFLQQEKEAGHTVYPRNAEIFNAFKHTPFDQVKVVILGQDPYHGPNQAHGLSFSVQKGIAIPRSLENIYKELATDIPGFVKPSHGNLEGWAKQGVLLLNATLTVRAHTAASHQRRGWETFTDEVIKKLSELRKGIVFILWGSYAQSKIPLIDQSKHYIIKSVHPSPLSVERGFWGSKPFSQANSYLIKEGKTPIDWQI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
5 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
6 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
7 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
8 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
11 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
127 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
128 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
129 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
132 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
133 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
134 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
135 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
136 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
137 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
138 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
139 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
140 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
206 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.84
Nodule 0
Rhizoplane 1.12
Rhizosphere 81.51
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_76631 2162886007 Bacteria 10272
2 JGI25162J39368_1000022 3300002737 Bacteria 239510
3 JGI25162J39368_1003229 3300002737 Bacteria 5005
4 JGI25164J39214_1002222 3300002772 Bacteria 3186
5 rootH1_10174610 3300003316 Bacteria 2195
6 rootH2_10197267 3300003320 Bacteria 2256
7 Ga0065714_10002640 3300005288 Bacteria 19766
8 Ga0065714_10002933 3300005288 Bacteria 54064
9 Ga0065714_10087367 3300005288 Bacteria 2057
10 Ga0065714_10130605 3300005288 Bacteria 1254
11 Ga0065714_10139519 3300005288 Bacteria 1181
12 Ga0065704_10000227 3300005289 Bacteria 66518
13 Ga0070658_10431413 3300005327 Bacteria 1134
14 Ga0070676_10000081 3300005328 Bacteria 32936
15 Ga0070690_100136387 3300005330 Bacteria 1662
16 Ga0068868_100316877 3300005338 Bacteria 1328
17 Ga0070669_100228203 3300005353 Bacteria 1475
18 Ga0070678_100044604 3300005456 Bacteria 3167
19 Ga0068867_100000841 3300005459 Bacteria 20653
20 Ga0068867_100090961 3300005459 Bacteria 2316
21 Ga0070679_100555458 3300005530 Bacteria 1092
22 Ga0068853_100083296 3300005539 Bacteria 2802
23 Ga0068853_100368624 3300005539 Bacteria 1339
24 Ga0070672_100062304 3300005543 Bacteria 2943
25 Ga0070672_100320771 3300005543 Bacteria 1317
26 Ga0070672_100439055 3300005543 Unclassified 1123
27 Ga0070665_100000003 3300005548 Bacteria 811857
28 Ga0068855_100006017 3300005563 Bacteria 14797
29 Ga0068857_100000514 3300005577 Bacteria 27805
30 Ga0068854_100274310 3300005578 Bacteria 1355
31 Ga0068856_100468796 3300005614 Bacteria 1280
32 Ga0068852_100000527 3300005616 Bacteria 25187
33 Ga0068861_100205419 3300005719 Bacteria 1656
34 Ga0068860_100064220 3300005843 Bacteria 3487
35 Ga0081455_10011116 3300005937 Bacteria 9061
36 Ga0081455_10013485 3300005937 Bacteria 8071
37 Ga0081455_10037593 3300005937 Bacteria 4296
38 Ga0081455_10117914 3300005937 Bacteria 2097
39 Ga0081538_10035501 3300005981 Bacteria 3273
40 Ga0075365_10091877 3300006038 Bacteria 2069
41 Ga0075365_10363780 3300006038 Bacteria 1020
42 Ga0075363_100065096 3300006048 Bacteria 1970
43 Ga0075362_10015035 3300006177 Bacteria 3139
44 Ga0075367_10161746 3300006178 Bacteria 1392
45 Ga0097621_100000150 3300006237 Bacteria 42846
46 Ga0097621_100836670 3300006237 Unclassified 854
47 Ga0075370_10275189 3300006353 Bacteria 1000
48 Ga0068871_100000045 3300006358 Bacteria 67014
49 Ga0068871_100119734 3300006358 Bacteria 2222
50 Ga0075428_100001658 3300006844 Bacteria 23704
51 Ga0075428_100022938 3300006844 Bacteria 6908
52 Ga0075428_100221167 3300006844 Bacteria 2045
53 Ga0075428_100367759 3300006844 Bacteria 1542
54 Ga0075428_100469853 3300006844 Bacteria 1346
55 Ga0075430_100048840 3300006846 Bacteria 3572
56 Ga0075430_100052643 3300006846 Bacteria 3429
57 Ga0075430_100220746 3300006846 Bacteria 1573
58 Ga0075430_100394193 3300006846 Bacteria 1143
59 Ga0075431_100016237 3300006847 Bacteria 7554
60 Ga0075431_100110542 3300006847 Bacteria 2836
61 Ga0075431_100183265 3300006847 Bacteria 2148
62 Ga0075431_100193324 3300006847 Bacteria 2084
63 Ga0075431_100227462 3300006847 Bacteria 1901
64 Ga0075429_100023277 3300006880 Bacteria 5372
65 Ga0075429_100224408 3300006880 Bacteria 1646
66 Ga0075429_100256552 3300006880 Bacteria 1531
67 Ga0075429_100291589 3300006880 Bacteria 1428
68 Ga0068865_100000547 3300006881 Bacteria 20866
69 Ga0099794_10116014 3300007265 Bacteria 1344
70 Ga0105240_10017032 3300009093 Bacteria 9816
71 Ga0105240_10163155 3300009093 Bacteria 2645
72 Ga0105240_10352742 3300009093 Bacteria 1669
73 Ga0111539_10013927 3300009094 Bacteria 10053
74 Ga0111539_10047052 3300009094 Bacteria 5158
75 Ga0111539_10162012 3300009094 Bacteria 2616
76 Ga0111539_10169793 3300009094 Bacteria 2548
77 Ga0105245_11134053 3300009098 Bacteria 829
78 Ga0114129_10005888 3300009147 Bacteria 17362
79 Ga0114129_10079670 3300009147 Bacteria 4554
80 Ga0114129_10108245 3300009147 Bacteria 3837
81 Ga0114129_10119446 3300009147 Bacteria 3631
82 Ga0114129_11263189 3300009147 Bacteria 917
83 Ga0105243_11213774 3300009148 Bacteria 768
84 Ga0105241_10003304 3300009174 Bacteria 11996
85 Ga0105242_10185810 3300009176 Bacteria 1837
86 Ga0105242_10802966 3300009176 Bacteria 932
87 Ga0105248_10913704 3300009177 Bacteria 991
88 Ga0105237_10001361 3300009545 Bacteria 32387
89 Ga0105237_10002150 3300009545 Bacteria 24816
90 Ga0105237_10404416 3300009545 Bacteria 1370
91 Ga0105237_10405033 3300009545 Bacteria 1369
92 Ga0105237_10820590 3300009545 Bacteria 937
93 Ga0105238_10024028 3300009551 Bacteria 6215
94 Ga0105238_10704116 3300009551 Bacteria 1022
95 Ga0105239_10000006 3300010375 Bacteria 442319
96 Ga0105239_10002464 3300010375 Bacteria 23582
97 Ga0105239_10059205 3300010375 Bacteria 4204
98 Ga0105239_10258080 3300010375 Bacteria 1958
99 Ga0105239_11295524 3300010375 Bacteria 840
100 Ga0157373_10003418 3300013100 Bacteria 12013
101 Ga0157371_10003818 3300013102 Bacteria 13461
102 Ga0157371_10004077 3300013102 Bacteria 12914
103 Ga0157370_10038254 3300013104 Bacteria 4642
104 Ga0157370_10047307 3300013104 Bacteria 4124
105 Ga0157370_10054770 3300013104 Bacteria 3802
106 Ga0157370_10185119 3300013104 Bacteria 1934
107 Ga0157370_10640161 3300013104 Unclassified 972
108 Ga0157374_10000277 3300013296 Bacteria 47639
109 Ga0157374_10003204 3300013296 Bacteria 13745
110 Ga0157374_11237769 3300013296 Unclassified 768
111 Ga0157378_10051947 3300013297 Bacteria 3647
112 Ga0163162_10000024 3300013306 Bacteria 188515
113 Ga0163162_10000205 3300013306 Bacteria 54827
114 Ga0157372_10063877 3300013307 Bacteria 4130
115 Ga0157375_10201119 3300013308 Bacteria 2148
116 Ga0157380_10000135 3300014326 Bacteria 41225
117 Ga0157380_10012008 3300014326 Bacteria 6269
118 Ga0182008_10000009 3300014497 Bacteria 331416
119 Ga0182008_10000687 3300014497 Bacteria 24388
120 Ga0157379_10286773 3300014968 Bacteria 1499
121 Ga0157376_10003145 3300014969 Bacteria 11334
122 Ga0157376_10008824 3300014969 Bacteria 7295
123 Ga0157376_10134534 3300014969 Bacteria 2211
124 Ga0182006_1005508 3300015261 Bacteria 6017
125 Ga0163161_10001026 3300017792 Bacteria 21295
126 Ga0207427_100090 3300025231 Bacteria 133759
127 Ga0209437_100024 3300025233 Bacteria 592878
128 Ga0209437_100034 3300025233 Bacteria 494007
129 Ga0209233_1000038 3300025261 Bacteria 548972
130 Ga0209233_1009591 3300025261 Bacteria 2940
131 Ga0209233_1019810 3300025261 Bacteria 1779
132 Ga0207647_10061244 3300025904 Bacteria 2297
133 Ga0207645_10000156 3300025907 Bacteria 53492
134 Ga0207645_10128354 3300025907 Bacteria 1649
135 Ga0207645_10236731 3300025907 Bacteria 1206
136 Ga0207705_10348238 3300025909 Unclassified 1141
137 Ga0207654_10033456 3300025911 Bacteria 2850
138 Ga0207695_10021354 3300025913 Bacteria 7388
139 Ga0207671_10001276 3300025914 Bacteria 29637
140 Ga0207671_10003166 3300025914 Bacteria 16626
141 Ga0207671_10008617 3300025914 Bacteria 8617
142 Ga0207671_10136593 3300025914 Bacteria 1886
143 Ga0207652_10365166 3300025921 Bacteria 1303
144 Ga0207694_10446485 3300025924 Bacteria 1079
145 Ga0207687_10244963 3300025927 Bacteria 1422
146 Ga0207686_10013425 3300025934 Bacteria 4533
147 Ga0207704_10000041 3300025938 Bacteria 89976
148 Ga0207691_10076508 3300025940 Bacteria 3016
149 Ga0207667_10052428 3300025949 Bacteria 4296
150 Ga0207667_10358778 3300025949 Bacteria 1486
151 Ga0207639_10133899 3300026041 Bacteria 2055
152 Ga0207639_10436175 3300026041 Bacteria 1187
153 Ga0207702_10107108 3300026078 Bacteria 2478
154 Ga0207702_10578174 3300026078 Bacteria 1101
155 Ga0207648_10077156 3300026089 Bacteria 2904
156 Ga0207674_10001743 3300026116 Bacteria 27824
157 Ga0207675_100261540 3300026118 Bacteria 1677
158 Ga0207683_10057685 3300026121 Bacteria 3408
159 Ga0207698_10004628 3300026142 Bacteria 8405
160 Ga0207428_10055496 3300027907 Bacteria 3150
161 Ga0207428_10157348 3300027907 Bacteria 1727
162 Ga0268266_10000137 3300028379 Bacteria 140685
163 Ga0265319_1032794 3300028563 Unclassified 1798
164 Ga0265318_10020646 3300028577 Bacteria 2656
165 Ga0265323_10005322 3300028653 Bacteria 5468
166 Ga0265323_10100528 3300028653 Bacteria 958
167 Ga0307517_10009539 3300028786 Bacteria 13744
168 Ga0307515_10044126 3300028794 Bacteria 6900
169 Ga0307515_10430902 3300028794 Bacteria 937
170 Ga0265338_10050171 3300028800 Bacteria 3775
171 Ga0316181_1073001 3300030744 Bacteria 2543
172 Ga0265328_10040659 3300031239 Bacteria 1713
173 Ga0265320_10009223 3300031240 Bacteria 5967
174 Ga0265327_10001463 3300031251 Bacteria 29616
175 Ga0265316_10000445 3300031344 Bacteria 47073
176 Ga0265316_10003944 3300031344 Bacteria 14869
177 Ga0265342_10045315 3300031712 Unclassified 2648
178 Ga0265342_10107802 3300031712 Bacteria 1580
179 Ga0307405_10000030 3300031731 Bacteria 99574
180 Ga0316577_10272017 3300031733 Bacteria 959
181 Ga0307407_10000023 3300031903 Bacteria 118352
182 Ga0307412_10000084 3300031911 Bacteria 90908
183 Ga0307409_100452369 3300031995 Bacteria 1240
184 Ga0307416_100000049 3300032002 Bacteria 118358
185 Ga0307414_10000555 3300032004 Bacteria 19494
186 Ga0307414_10001903 3300032004 Bacteria 10798
187 Ga0307414_10403210 3300032004 Bacteria 1188
188 Ga0307414_10662058 3300032004 Bacteria 942
189 Ga0307414_10761145 3300032004 Unclassified 881
190 Ga0307414_10852397 3300032004 Bacteria 833
191 Ga0307411_10754214 3300032005 Bacteria 853
192 Ga0307507_10007067 3300033179 Bacteria 16617
193 Ga0307510_10003250 3300033180 Bacteria 18901
194 Ga0373933_0001922 3300035724 Bacteria 11976
195 Ga0395899_0000002 3300037312 Bacteria 1324310
196 Ga0395905_0000824 3300037471 Bacteria 40601
197 Ga0400490_38345 3300038726 Bacteria 1692
198 Ga0400485_01518 3300038735 Bacteria 2413
199 Ga0400483_035448 3300039062 Bacteria 1099
200 Ga0400483_105220 3300039062 Bacteria 11368
201 Ga0400483_107182 3300039062 Bacteria 14066
202 Ga0400483_166410 3300039062 Bacteria 32354
203 Ga0400483_167502 3300039062 Bacteria 6915
204 Ga0400483_290402 3300039062 Bacteria 9375
205 Ga0400489_39758 3300039093 Bacteria 3798
206 Ga0436361_0410746 3300039447 Bacteria 6222
207 Ga0451789_0969567 3300041443 Bacteria 789
208 Ga0451793_0870834 3300041452 Bacteria 842
209 Ga0451795_1066402 3300041456 Bacteria 765
210 Ga0451837_1461967 3300041494 Bacteria 1105
211 Ga0451855_0135208 3300041511 Bacteria 2829
212 Ga0451855_0902782 3300041511 Bacteria 1128
213 Ga0451855_1095225 3300041511 Bacteria 1465
214 Ga0451855_1339015 3300041511 Bacteria 995
215 Ga0451855_1465831 3300041511 Bacteria 1218
216 Ga0451855_1775197 3300041511 Bacteria 760
217 Ga0439450_047668 3300042008 Bacteria 1010
218 Ga0439451_019855 3300042009 Bacteria 1354
219 Ga0439463_004964 3300042016 Bacteria 3317
220 Ga0439459_0034113 3300042438 Bacteria 1051
221 Ga0439464_0014524 3300042439 Bacteria 2118
222 Ga0451577_0003984 3300042876 Bacteria 15911
223 Ga0451577_0730232 3300042876 Bacteria 896
224 Ga0439440_0008465 3300042993 Bacteria 2112
225 Ga0453683_0015631 3300044673 Bacteria 4911
226 Ga0453683_0061233 3300044673 Bacteria 2353
227 Ga0453683_0069415 3300044673 Bacteria 2203
228 Ga0466966_0216145 3300044684 Bacteria 1158
229 Ga0466961_0172474 3300044693 Bacteria 1345
230 Ga0453684_0000525 3300044712 Bacteria 146588
231 Ga0453684_0001503 3300044712 Bacteria 65630
232 Ga0453684_0009185 3300044712 Bacteria 17385
233 Ga0453684_0014964 3300044712 Bacteria 12330
234 Ga0453684_0274862 3300044712 Bacteria 1923
235 Ga0453684_0892628 3300044712 Bacteria 952
236 Ga0466957_0067592 3300044842 Bacteria 2205
237 Ga0451576_0075496 3300045051 Bacteria 3508
238 Ga0451576_0108526 3300045051 Bacteria 2888
239 Ga0451576_1147258 3300045051 Bacteria 812
240 Ga0495638_0000003 3300046460 Bacteria 888792
241 Ga0495650_0080692 3300046471 Bacteria 1255
242 Ga0495596_0052626 3300046500 Bacteria 1594
243 Ga0495583_0155471 3300046506 Bacteria 946
244 Ga0495606_0045941 3300046507 Bacteria 2890
245 Ga0495606_0056554 3300046507 Bacteria 2531
246 Ga0495606_0241383 3300046507 Bacteria 1007
247 Ga0495644_0060737 3300046523 Bacteria 1421
248 Ga0495648_0163788 3300046524 Bacteria 1146
249 Ga0495633_0000046 3300046558 Bacteria 167647
250 Ga0495668_0000070 3300046616 Bacteria 174051
251 Ga0495625_0076131 3300046660 Bacteria 2347
252 Ga0495625_0209299 3300046660 Unclassified 1283
253 Ga0495661_0004111 3300046665 Bacteria 10601
254 Ga0495670_0278271 3300046691 Bacteria 895
255 Ga0495660_0049893 3300046810 Bacteria 2282
256 Ga0495676_0220432 3300047321 Bacteria 1308
257 Ga0495683_0007503 3300047323 Bacteria 5890
258 Ga0495685_041656 3300047447 Bacteria 1569
259 Ga0496102_0531803 3300048905 Bacteria 1098
260 Ga0496122_0040189 3300048925 Bacteria 3722
261 Ga0496126_0415946 3300048929 Bacteria 1088
262 Ga0496126_0431319 3300048929 Unclassified 1064
263 Ga0501033_0032847 3300049570 Bacteria 3897
264 Ga0501034_0000644 3300049571 Bacteria 54163
265 Ga0501034_0005494 3300049571 Bacteria 13834
266 Ga0501034_0016211 3300049571 Bacteria 7645
267 Ga0501034_0023690 3300049571 Bacteria 6252
268 Ga0501034_0066481 3300049571 Bacteria 3618
269 Ga0501034_0102732 3300049571 Bacteria 2852
270 Ga0501034_0272360 3300049571 Bacteria 1634
271 Ga0501036_0027174 3300049572 Bacteria 4835
272 Ga0501036_0163417 3300049572 Bacteria 1877
273 Ga0501037_0378530 3300049573 Bacteria 973
274 Ga0501038_0468876 3300049574 Bacteria 966
275 Ga0501039_0015809 3300049575 Bacteria 5777
276 Ga0501039_0130122 3300049575 Bacteria 1975
277 Ga0501040_0017096 3300049576 Bacteria 4812
278 Ga0501040_0150393 3300049576 Bacteria 1642
279 Ga0501041_0112286 3300049577 Bacteria 1691
280 Ga0501041_0124145 3300049577 Bacteria 1606
281 Ga0501042_0020741 3300049578 Bacteria 4575
282 Ga0501042_0143125 3300049578 Bacteria 1724
283 Ga0501042_0307862 3300049578 Bacteria 1144
284 Ga0501043_0038651 3300049579 Bacteria 3752
285 Ga0501046_0074050 3300049580 Bacteria 2642
286 Ga0501048_0222349 3300049582 Bacteria 1339
287 Ga0501067_0233361 3300049583 Bacteria 1024
288 Ga0501071_0043280 3300049587 Bacteria 3228
289 Ga0501071_0110558 3300049587 Bacteria 2031
290 Ga0501072_0008166 3300049588 Bacteria 7946
291 Ga0501075_0241479 3300049591 Bacteria 1377
292 Ga0501075_0245907 3300049591 Bacteria 1363
293 Ga0501076_0040454 3300049592 Bacteria 3664
294 Ga0501076_0073007 3300049592 Bacteria 2747
295 Ga0501076_0140738 3300049592 Bacteria 1960
296 Ga0501076_0266290 3300049592 Bacteria 1403
297 Ga0501077_0030625 3300049593 Bacteria 3424
298 Ga0501079_0036498 3300049741 Bacteria 3786
299 Ga0501079_0067898 3300049741 Bacteria 2752
300 Ga0501080_0060743 3300049742 Bacteria 3519
301 Ga0501081_0056467 3300049743 Bacteria 2713
302 Ga0501044_0021428 3300049823 Bacteria 6894
303 Ga0501045_0047742 3300049824 Bacteria 3119
304 Ga0501045_0250708 3300049824 Bacteria 1318
305 nmdc:mga03683_350386_c1 3300050489 Bacteria 699
306 nmdc:mga03n38_379178_c1 3300050490 Bacteria 775
307 nmdc:mga00v17_12406_c2 3300050491 Bacteria 3944
308 nmdc:mga0yw44_30467_c1 3300050492 Bacteria 2405
309 nmdc:mga0yw44_470546_c1 3300050492 Bacteria 852
310 nmdc:mga06z11_193356_c1 3300050494 Bacteria 1179
311 nmdc:mga05p37_128441_c1 3300050507 Bacteria 3112
312 nmdc:mga05p37_187541_c1 3300050507 Bacteria 2514
313 nmdc:mga05p37_410542_c1 3300050507 Bacteria 1578
314 nmdc:mga05p37_460636_c1 3300050507 Bacteria 1469
315 nmdc:mga05p37_678684_c1 3300050507 Bacteria 1149
316 nmdc:mga09592_101827_c1 3300050508 Bacteria 2461
317 nmdc:mga09592_234909_c1 3300050508 Bacteria 1588
318 nmdc:mga0qj67_326134_c1 3300050509 Bacteria 1243
319 nmdc:mga0qj67_333_c1 3300050509 Bacteria 32503
320 nmdc:mga0qj67_359818_c1 3300050509 Bacteria 1176
321 nmdc:mga0qj67_363075_c1 3300050509 Bacteria 1170
322 nmdc:mga06r32_22481_c1 3300050510 Bacteria 5831
323 nmdc:mga06r32_307496_c1 3300050510 Bacteria 1571
324 nmdc:mga06r32_424129_c1 3300050510 Bacteria 1311
325 nmdc:mga06r32_46840_c1 3300050510 Bacteria 4127
326 nmdc:mga06r32_571377_c1 3300050510 Bacteria 1103
327 nmdc:mga08y16_137202_c1 3300050511 Bacteria 2543
328 nmdc:mga08y16_159317_c1 3300050511 Bacteria 2345
329 nmdc:mga08y16_21573_c1 3300050511 Bacteria 6801
330 nmdc:mga08y16_308889_c1 3300050511 Bacteria 1629
331 Ga0500647_0145309 3300053091 Bacteria 1110
332 Ga0500583_0000018 3300053092 Bacteria 138148
333 Ga0500651_0000446 3300053093 Bacteria 22055
334 Ga0500595_000034 3300053119 Bacteria 106740
335 Ga0500614_018446 3300053123 Bacteria 1588
336 Ga0500564_030084 3300053138 Bacteria 2501
337 Ga0500622_0008830 3300053156 Bacteria 5611
338 Ga0501084_0176813 3300054114 Bacteria 1802
339 Ga0501084_0220152 3300054114 Bacteria 1602
340 Ga0501084_0457703 3300054114 Bacteria 1079
341 Ga0590071_049335 3300059421 Bacteria 1020
342 Ga0590075_026785 3300059424 Bacteria 1452
343 Ga0501082_0181377 3300060353 Bacteria 1831
344 Ga0501082_0215166 3300060353 Bacteria 1672
345 Ga0530510_0061892 3300061734 Bacteria 2710
346 Ga0530510_0096776 3300061734 Bacteria 2157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_1147258 Ga0451576_1147258_11_544 177
2 3300050490 nmdc:mga03n38_379178_c1 nmdc:mga03n38_379178_c1_17_574 184
3 3300013102 Ga0157371_10004077 Ga0157371_100040779 192
4 3300013307 Ga0157372_10063877 Ga0157372_100638776 192
5 3300013104 Ga0157370_10640161 Ga0157370_106401612 195
6 3300013296 Ga0157374_10000277 Ga0157374_1000027743 196
7 3300044684 Ga0466966_0216145 Ga0466966_0216145_528_1142 197
8 3300046507 Ga0495606_0045941 Ga0495606_0045941_2251_2868 197
9 3300046524 Ga0495648_0163788 Ga0495648_0163788_516_1130 197
10 3300005530 Ga0070679_100555458 Ga0070679_1005554582 199
11 3300025921 Ga0207652_10365166 Ga0207652_103651662 199
12 3300005577 Ga0068857_100000514 Ga0068857_10000051427 202
13 3300026116 Ga0207674_10001743 Ga0207674_1000174327 202
14 3300025907 Ga0207645_10128354 Ga0207645_101283542 204
15 iso_pu_bacteria 2739367866 2740031109 205
16 3300009094 Ga0111539_10047052 Ga0111539_100470523 206
17 3300048905 Ga0496102_0531803 Ga0496102_0531803_389_1045 206
18 3300049578 Ga0501042_0143125 Ga0501042_0143125_169_825 206
19 3300049587 Ga0501071_0110558 Ga0501071_0110558_1336_1992 206
20 3300049591 Ga0501075_0241479 Ga0501075_0241479_588_1244 206
21 3300049592 Ga0501076_0266290 Ga0501076_0266290_498_1154 206
22 3300049741 Ga0501079_0067898 Ga0501079_0067898_2077_2733 206
23 3300050511 nmdc:mga08y16_159317_c1 nmdc:mga08y16_159317_c1_902_1558 206
24 3300053093 Ga0500651_0000446 Ga0500651_0000446_18023_18700 206
25 3300054114 Ga0501084_0176813 Ga0501084_0176813_514_1170 206
26 3300061734 Ga0530510_0061892 Ga0530510_0061892_204_860 206
27 iso_pu_bacteria 2929206907 2929210201 206
28 iso_pu_bacteria 2936361878 2936364114 206
29 3300005330 Ga0070690_100136387 Ga0070690_1001363872 207
30 3300005843 Ga0068860_100064220 Ga0068860_1000642203 207
31 3300005937 Ga0081455_10011116 Ga0081455_100111168 207
32 3300005937 Ga0081455_10013485 Ga0081455_100134856 207
33 3300005937 Ga0081455_10037593 Ga0081455_100375932 207
34 3300005937 Ga0081455_10117914 Ga0081455_101179142 207
35 3300005981 Ga0081538_10035501 Ga0081538_100355012 207
36 3300006038 Ga0075365_10363780 Ga0075365_103637802 207
37 3300006048 Ga0075363_100065096 Ga0075363_1000650962 207
38 3300006177 Ga0075362_10015035 Ga0075362_100150352 207
39 3300006178 Ga0075367_10161746 Ga0075367_101617462 207
40 3300006353 Ga0075370_10275189 Ga0075370_102751892 207
41 3300006844 Ga0075428_100001658 Ga0075428_1000016582 207
42 3300006844 Ga0075428_100221167 Ga0075428_1002211672 207
43 3300006844 Ga0075428_100367759 Ga0075428_1003677594 207
44 3300006844 Ga0075428_100469853 Ga0075428_1004698532 207
45 3300006846 Ga0075430_100052643 Ga0075430_1000526432 207
46 3300006846 Ga0075430_100220746 Ga0075430_1002207462 207
47 3300006846 Ga0075430_100394193 Ga0075430_1003941932 207
48 3300006847 Ga0075431_100110542 Ga0075431_1001105422 207
49 3300006847 Ga0075431_100183265 Ga0075431_1001832653 207
50 3300006847 Ga0075431_100193324 Ga0075431_1001933242 207
51 3300006847 Ga0075431_100227462 Ga0075431_1002274623 207
52 3300006880 Ga0075429_100224408 Ga0075429_1002244082 207
53 3300006880 Ga0075429_100256552 Ga0075429_1002565522 207
54 3300006880 Ga0075429_100291589 Ga0075429_1002915891 207
55 3300009094 Ga0111539_10013927 Ga0111539_1001392710 207
56 3300009094 Ga0111539_10162012 Ga0111539_101620122 207
57 3300009094 Ga0111539_10169793 Ga0111539_101697934 207
58 3300009147 Ga0114129_10005888 Ga0114129_100058882 207
59 3300009147 Ga0114129_10079670 Ga0114129_100796704 207
60 3300009147 Ga0114129_10119446 Ga0114129_101194463 207
61 3300009148 Ga0105243_11213774 Ga0105243_112137741 207
62 3300010375 Ga0105239_11295524 Ga0105239_112955241 207
63 3300027907 Ga0207428_10055496 Ga0207428_100554963 207
64 3300027907 Ga0207428_10157348 Ga0207428_101573482 207
65 3300041443 Ga0451789_0969567 Ga0451789_0969567_18_677 207
66 3300042008 Ga0439450_047668 Ga0439450_047668_298_963 207
67 3300042009 Ga0439451_019855 Ga0439451_019855_443_1108 207
68 3300042016 Ga0439463_004964 Ga0439463_004964_1166_1831 207
69 3300042439 Ga0439464_0014524 Ga0439464_0014524_1246_1911 207
70 3300042993 Ga0439440_0008465 Ga0439440_0008465_279_944 207
71 3300049571 Ga0501034_0066481 Ga0501034_0066481_2602_3273 207
72 3300049572 Ga0501036_0163417 Ga0501036_0163417_413_1075 207
73 3300049575 Ga0501039_0130122 Ga0501039_0130122_305_970 207
74 3300049577 Ga0501041_0124145 Ga0501041_0124145_258_923 207
75 3300049592 Ga0501076_0073007 Ga0501076_0073007_376_1041 207
76 3300049592 Ga0501076_0140738 Ga0501076_0140738_722_1384 207
77 3300049593 Ga0501077_0030625 Ga0501077_0030625_2619_3284 207
78 3300049824 Ga0501045_0250708 Ga0501045_0250708_289_951 207
79 3300050489 nmdc:mga03683_350386_c1 nmdc:mga03683_350386_c1_14_676 207
80 3300050491 nmdc:mga00v17_12406_c2 nmdc:mga00v17_12406_c2_3200_3862 207
81 3300050492 nmdc:mga0yw44_30467_c1 nmdc:mga0yw44_30467_c1_40_702 207
82 3300050494 nmdc:mga06z11_193356_c1 nmdc:mga06z11_193356_c1_460_1122 207
83 3300050507 nmdc:mga05p37_128441_c1 nmdc:mga05p37_128441_c1_2273_2938 207
84 3300050507 nmdc:mga05p37_187541_c1 nmdc:mga05p37_187541_c1_894_1559 207
85 3300050507 nmdc:mga05p37_410542_c1 nmdc:mga05p37_410542_c1_272_934 207
86 3300050507 nmdc:mga05p37_460636_c1 nmdc:mga05p37_460636_c1_256_921 207
87 3300050507 nmdc:mga05p37_678684_c1 nmdc:mga05p37_678684_c1_349_1017 207
88 3300050508 nmdc:mga09592_101827_c1 nmdc:mga09592_101827_c1_985_1650 207
89 3300050508 nmdc:mga09592_234909_c1 nmdc:mga09592_234909_c1_714_1382 207
90 3300050509 nmdc:mga0qj67_326134_c1 nmdc:mga0qj67_326134_c1_287_952 207
91 3300050509 nmdc:mga0qj67_333_c1 nmdc:mga0qj67_333_c1_31044_31709 207
92 3300050509 nmdc:mga0qj67_359818_c1 nmdc:mga0qj67_359818_c1_183_851 207
93 3300050509 nmdc:mga0qj67_363075_c1 nmdc:mga0qj67_363075_c1_283_948 207
94 3300050510 nmdc:mga06r32_22481_c1 nmdc:mga06r32_22481_c1_226_891 207
95 3300050510 nmdc:mga06r32_307496_c1 nmdc:mga06r32_307496_c1_816_1481 207
96 3300050510 nmdc:mga06r32_424129_c1 nmdc:mga06r32_424129_c1_197_865 207
97 3300050511 nmdc:mga08y16_137202_c1 nmdc:mga08y16_137202_c1_1240_1905 207
98 3300050511 nmdc:mga08y16_21573_c1 nmdc:mga08y16_21573_c1_1167_1835 207
99 3300050511 nmdc:mga08y16_308889_c1 nmdc:mga08y16_308889_c1_694_1362 207
100 3300059421 Ga0590071_049335 Ga0590071_049335_253_948 207
101 3300059424 Ga0590075_026785 Ga0590075_026785_455_1135 207
102 3300061734 Ga0530510_0096776 Ga0530510_0096776_1364_2029 207
103 iso_pu_bacteria 8007375930 8007377264 207
104 3300005353 Ga0070669_100228203 Ga0070669_1002282031 208
105 3300005543 Ga0070672_100439055 Ga0070672_1004390552 208
106 3300005719 Ga0068861_100205419 Ga0068861_1002054193 208
107 3300006844 Ga0075428_100022938 Ga0075428_1000229383 208
108 3300006846 Ga0075430_100048840 Ga0075430_1000488403 208
109 3300006847 Ga0075431_100016237 Ga0075431_1000162376 208
110 3300006880 Ga0075429_100023277 Ga0075429_1000232775 208
111 3300009147 Ga0114129_10108245 Ga0114129_101082453 208
112 3300009147 Ga0114129_11263189 Ga0114129_112631892 208
113 3300009545 Ga0105237_10820590 Ga0105237_108205901 208
114 3300014326 Ga0157380_10012008 Ga0157380_100120081 208
115 3300025907 Ga0207645_10236731 Ga0207645_102367312 208
116 3300026118 Ga0207675_100261540 Ga0207675_1002615401 208
117 3300028563 Ga0265319_1032794 Ga0265319_10327942 208
118 3300028800 Ga0265338_10050171 Ga0265338_100501712 208
119 3300031240 Ga0265320_10009223 Ga0265320_100092235 208
120 3300031733 Ga0316577_10272017 Ga0316577_102720172 208
121 3300032004 Ga0307414_10852397 Ga0307414_108523972 208
122 3300038735 Ga0400485_01518 Ga0400485_01518_1183_1875 208
123 3300039062 Ga0400483_035448 Ga0400483_035448_157_840 208
124 3300039062 Ga0400483_105220 Ga0400483_105220_10526_11206 208
125 3300039062 Ga0400483_107182 Ga0400483_107182_4353_5039 208
126 3300039062 Ga0400483_166410 Ga0400483_166410_28042_28728 208
127 3300039062 Ga0400483_167502 Ga0400483_167502_1036_1716 208
128 3300039062 Ga0400483_290402 Ga0400483_290402_6711_7394 208
129 3300041456 Ga0451795_1066402 Ga0451795_1066402_89_754 208
130 3300041511 Ga0451855_0902782 Ga0451855_0902782_308_973 208
131 3300041511 Ga0451855_1095225 Ga0451855_1095225_436_1101 208
132 3300041511 Ga0451855_1339015 Ga0451855_1339015_274_939 208
133 3300041511 Ga0451855_1465831 Ga0451855_1465831_484_1149 208
134 3300041511 Ga0451855_1775197 Ga0451855_1775197_53_718 208
135 3300042876 Ga0451577_0003984 Ga0451577_0003984_6960_7622 208
136 3300042876 Ga0451577_0730232 Ga0451577_0730232_113_775 208
137 3300044673 Ga0453683_0015631 Ga0453683_0015631_4200_4862 208
138 3300044673 Ga0453683_0061233 Ga0453683_0061233_314_976 208
139 3300044673 Ga0453683_0069415 Ga0453683_0069415_49_711 208
140 3300044693 Ga0466961_0172474 Ga0466961_0172474_59_757 208
141 3300044712 Ga0453684_0000525 Ga0453684_0000525_130424_131086 208
142 3300044712 Ga0453684_0274862 Ga0453684_0274862_857_1519 208
143 3300044712 Ga0453684_0892628 Ga0453684_0892628_164_826 208
144 3300044842 Ga0466957_0067592 Ga0466957_0067592_1007_1687 208
145 3300045051 Ga0451576_0108526 Ga0451576_0108526_2064_2726 208
146 3300046460 Ga0495638_0000003 Ga0495638_0000003_48415_49128 208
147 3300046660 Ga0495625_0209299 Ga0495625_0209299_549_1211 208
148 3300049570 Ga0501033_0032847 Ga0501033_0032847_2921_3601 208
149 3300049572 Ga0501036_0027174 Ga0501036_0027174_2637_3317 208
150 3300049573 Ga0501037_0378530 Ga0501037_0378530_275_955 208
151 3300049575 Ga0501039_0015809 Ga0501039_0015809_3411_4091 208
152 3300049576 Ga0501040_0150393 Ga0501040_0150393_297_977 208
153 3300049578 Ga0501042_0307862 Ga0501042_0307862_230_910 208
154 3300049580 Ga0501046_0074050 Ga0501046_0074050_296_976 208
155 3300049583 Ga0501067_0233361 Ga0501067_0233361_312_995 208
156 3300049588 Ga0501072_0008166 Ga0501072_0008166_6304_6984 208
157 3300049591 Ga0501075_0245907 Ga0501075_0245907_606_1286 208
158 3300049592 Ga0501076_0040454 Ga0501076_0040454_1407_2087 208
159 3300049741 Ga0501079_0036498 Ga0501079_0036498_824_1504 208
160 3300049742 Ga0501080_0060743 Ga0501080_0060743_1259_1939 208
161 3300049743 Ga0501081_0056467 Ga0501081_0056467_1852_2532 208
162 3300049824 Ga0501045_0047742 Ga0501045_0047742_935_1615 208
163 3300050492 nmdc:mga0yw44_470546_c1 nmdc:mga0yw44_470546_c1_15_677 208
164 3300050510 nmdc:mga06r32_46840_c1 nmdc:mga06r32_46840_c1_3189_3857 208
165 3300060353 Ga0501082_0181377 Ga0501082_0181377_532_1212 208
166 iso_pu_bacteria 2852623160 2852624138 208
167 3300003316 rootH1_10174610 rootH1_101746101 209
168 3300013102 Ga0157371_10003818 Ga0157371_1000381811 209
169 3300028577 Ga0265318_10020646 Ga0265318_100206463 209
170 3300031239 Ga0265328_10040659 Ga0265328_100406592 209
171 3300031712 Ga0265342_10107802 Ga0265342_101078023 209
172 3300032005 Ga0307411_10754214 Ga0307411_107542141 209
173 3300038726 Ga0400490_38345 Ga0400490_38345_245_916 209
174 3300041494 Ga0451837_1461967 Ga0451837_1461967_151_825 209
175 3300042438 Ga0439459_0034113 Ga0439459_0034113_91_798 209
176 3300044712 Ga0453684_0001503 Ga0453684_0001503_50521_51198 209
177 3300044712 Ga0453684_0009185 Ga0453684_0009185_8352_9017 209
178 3300049571 Ga0501034_0005494 Ga0501034_0005494_7360_8031 209
179 3300049571 Ga0501034_0023690 Ga0501034_0023690_496_1164 209
180 3300049571 Ga0501034_0272360 Ga0501034_0272360_492_1163 209
181 3300054114 Ga0501084_0457703 Ga0501084_0457703_138_809 209
182 iso_pu_bacteria 2738541284 2738762847 209
183 iso_pu_bacteria 2738543023 2739304705 209
184 iso_pu_bacteria 2775506987 2776614409 209
185 iso_pu_bacteria 2857627736 2857628712 209
186 iso_pu_bacteria 2904445276 2904446095 209
187 iso_pu_bacteria 2919437846 2919442153 209
188 3300005288 Ga0065714_10002933 Ga0065714_1000293316 210
189 3300006038 Ga0075365_10091877 Ga0075365_100918772 210
190 3300009098 Ga0105245_11134053 Ga0105245_111340531 210
191 3300028653 Ga0265323_10005322 Ga0265323_100053222 210
192 3300028653 Ga0265323_10100528 Ga0265323_101005281 210
193 3300031344 Ga0265316_10000445 Ga0265316_100004457 210
194 3300031344 Ga0265316_10003944 Ga0265316_100039443 210
195 3300031712 Ga0265342_10045315 Ga0265342_100453153 210
196 3300037471 Ga0395905_0000824 Ga0395905_0000824_30168_30839 210
197 3300044712 Ga0453684_0014964 Ga0453684_0014964_1387_2061 210
198 3300045051 Ga0451576_0075496 Ga0451576_0075496_191_859 210
199 3300047321 Ga0495676_0220432 Ga0495676_0220432_563_1237 210
200 3300049571 Ga0501034_0000644 Ga0501034_0000644_29319_29999 210
201 3300049571 Ga0501034_0016211 Ga0501034_0016211_2163_2831 210
202 3300049574 Ga0501038_0468876 Ga0501038_0468876_94_771 210
203 3300049576 Ga0501040_0017096 Ga0501040_0017096_524_1201 210
204 3300049577 Ga0501041_0112286 Ga0501041_0112286_548_1225 210
205 3300049578 Ga0501042_0020741 Ga0501042_0020741_430_1107 210
206 3300049582 Ga0501048_0222349 Ga0501048_0222349_128_805 210
207 3300049587 Ga0501071_0043280 Ga0501071_0043280_45_722 210
208 3300049823 Ga0501044_0021428 Ga0501044_0021428_3589_4257 210
209 3300054114 Ga0501084_0220152 Ga0501084_0220152_402_1079 210
210 3300060353 Ga0501082_0215166 Ga0501082_0215166_127_804 210
211 3300005288 Ga0065714_10130605 Ga0065714_101306052 211
212 3300005543 Ga0070672_100320771 Ga0070672_1003207712 211
213 3300006358 Ga0068871_100119734 Ga0068871_1001197342 211
214 3300014326 Ga0157380_10000135 Ga0157380_1000013518 211
215 3300014968 Ga0157379_10286773 Ga0157379_102867732 211
216 3300014969 Ga0157376_10003145 Ga0157376_100031455 211
217 3300014969 Ga0157376_10008824 Ga0157376_100088243 211
218 3300025927 Ga0207687_10244963 Ga0207687_102449631 211
219 3300035724 Ga0373933_0001922 Ga0373933_0001922_8601_9278 211
220 3300039093 Ga0400489_39758 Ga0400489_39758_3102_3779 211
221 3300041511 Ga0451855_0135208 Ga0451855_0135208_1466_2155 211
222 3300048925 Ga0496122_0040189 Ga0496122_0040189_2872_3549 211
223 3300048929 Ga0496126_0415946 Ga0496126_0415946_43_729 211
224 3300049579 Ga0501043_0038651 Ga0501043_0038651_337_1017 211
225 3300050510 nmdc:mga06r32_571377_c1 nmdc:mga06r32_571377_c1_171_851 211
226 3300053091 Ga0500647_0145309 Ga0500647_0145309_119_802 211
227 3300053092 Ga0500583_0000018 Ga0500583_0000018_104270_104941 211
228 3300053119 Ga0500595_000034 Ga0500595_000034_64338_65021 211
229 3300003320 rootH2_10197267 rootH2_101972672 212
230 3300005288 Ga0065714_10139519 Ga0065714_101395192 212
231 3300005459 Ga0068867_100090961 Ga0068867_1000909613 212
232 3300006237 Ga0097621_100836670 Ga0097621_1008366701 212
233 3300007265 Ga0099794_10116014 Ga0099794_101160141 212
234 3300028794 Ga0307515_10430902 Ga0307515_104309021 212
235 3300031251 Ga0265327_10001463 Ga0265327_100014635 212
236 3300032004 Ga0307414_10001903 Ga0307414_1000190310 212
237 3300048929 Ga0496126_0431319 Ga0496126_0431319_294_995 212
238 3300049571 Ga0501034_0102732 Ga0501034_0102732_237_947 212
239 2162886007 SwRhRL2b_contig_76631 SwRhRL2b_0824.00003030 213
240 3300002737 JGI25162J39368_1000022 JGI25162J39368_1000022118 213
241 3300002737 JGI25162J39368_1003229 JGI25162J39368_10032294 213
242 3300002772 JGI25164J39214_1002222 JGI25164J39214_10022222 213
243 3300005288 Ga0065714_10002640 Ga0065714_100026405 213
244 3300005288 Ga0065714_10087367 Ga0065714_100873675 213
245 3300005289 Ga0065704_10000227 Ga0065704_100002279 213
246 3300005327 Ga0070658_10431413 Ga0070658_104314132 213
247 3300005328 Ga0070676_10000081 Ga0070676_1000008113 213
248 3300005338 Ga0068868_100316877 Ga0068868_1003168772 213
249 3300005456 Ga0070678_100044604 Ga0070678_1000446045 213
250 3300005459 Ga0068867_100000841 Ga0068867_10000084119 213
251 3300005539 Ga0068853_100083296 Ga0068853_1000832962 213
252 3300005539 Ga0068853_100368624 Ga0068853_1003686242 213
253 3300005543 Ga0070672_100062304 Ga0070672_1000623043 213
254 3300005548 Ga0070665_100000003 Ga0070665_100000003109 213
255 3300005563 Ga0068855_100006017 Ga0068855_10000601710 213
256 3300005578 Ga0068854_100274310 Ga0068854_1002743101 213
257 3300005614 Ga0068856_100468796 Ga0068856_1004687962 213
258 3300005616 Ga0068852_100000527 Ga0068852_1000005274 213
259 3300006237 Ga0097621_100000150 Ga0097621_10000015028 213
260 3300006358 Ga0068871_100000045 Ga0068871_1000000456 213
261 3300006881 Ga0068865_100000547 Ga0068865_1000005471 213
262 3300009093 Ga0105240_10017032 Ga0105240_100170322 213
263 3300009093 Ga0105240_10163155 Ga0105240_101631552 213
264 3300009093 Ga0105240_10352742 Ga0105240_103527423 213
265 3300009174 Ga0105241_10003304 Ga0105241_100033044 213
266 3300009176 Ga0105242_10185810 Ga0105242_101858102 213
267 3300009176 Ga0105242_10802966 Ga0105242_108029661 213
268 3300009177 Ga0105248_10913704 Ga0105248_109137042 213
269 3300009545 Ga0105237_10001361 Ga0105237_1000136123 213
270 3300009545 Ga0105237_10002150 Ga0105237_1000215025 213
271 3300009545 Ga0105237_10404416 Ga0105237_104044161 213
272 3300009545 Ga0105237_10405033 Ga0105237_104050331 213
273 3300009551 Ga0105238_10024028 Ga0105238_100240283 213
274 3300009551 Ga0105238_10704116 Ga0105238_107041162 213
275 3300010375 Ga0105239_10000006 Ga0105239_1000000695 213
276 3300010375 Ga0105239_10002464 Ga0105239_100024642 213
277 3300010375 Ga0105239_10059205 Ga0105239_100592052 213
278 3300010375 Ga0105239_10258080 Ga0105239_102580802 213
279 3300013100 Ga0157373_10003418 Ga0157373_100034184 213
280 3300013104 Ga0157370_10038254 Ga0157370_100382543 213
281 3300013104 Ga0157370_10047307 Ga0157370_100473074 213
282 3300013104 Ga0157370_10054770 Ga0157370_100547703 213
283 3300013104 Ga0157370_10185119 Ga0157370_101851193 213
284 3300013296 Ga0157374_10003204 Ga0157374_1000320412 213
285 3300013296 Ga0157374_11237769 Ga0157374_112377691 213
286 3300013297 Ga0157378_10051947 Ga0157378_100519473 213
287 3300013306 Ga0163162_10000024 Ga0163162_1000002481 213
288 3300013306 Ga0163162_10000205 Ga0163162_1000020541 213
289 3300013308 Ga0157375_10201119 Ga0157375_102011193 213
290 3300014497 Ga0182008_10000009 Ga0182008_10000009114 213
291 3300014497 Ga0182008_10000687 Ga0182008_1000068713 213
292 3300014969 Ga0157376_10134534 Ga0157376_101345342 213
293 3300015261 Ga0182006_1005508 Ga0182006_10055084 213
294 3300017792 Ga0163161_10001026 Ga0163161_1000102612 213
295 3300025231 Ga0207427_100090 Ga0207427_10009043 213
296 3300025233 Ga0209437_100024 Ga0209437_100024432 213
297 3300025233 Ga0209437_100034 Ga0209437_100034252 213
298 3300025261 Ga0209233_1000038 Ga0209233_1000038252 213
299 3300025261 Ga0209233_1009591 Ga0209233_10095914 213
300 3300025261 Ga0209233_1019810 Ga0209233_10198102 213
301 3300025904 Ga0207647_10061244 Ga0207647_100612443 213
302 3300025907 Ga0207645_10000156 Ga0207645_1000015617 213
303 3300025909 Ga0207705_10348238 Ga0207705_103482382 213
304 3300025911 Ga0207654_10033456 Ga0207654_100334563 213
305 3300025913 Ga0207695_10021354 Ga0207695_100213544 213
306 3300025914 Ga0207671_10001276 Ga0207671_100012769 213
307 3300025914 Ga0207671_10003166 Ga0207671_100031663 213
308 3300025914 Ga0207671_10008617 Ga0207671_100086178 213
309 3300025914 Ga0207671_10136593 Ga0207671_101365932 213
310 3300025924 Ga0207694_10446485 Ga0207694_104464852 213
311 3300025934 Ga0207686_10013425 Ga0207686_100134252 213
312 3300025938 Ga0207704_10000041 Ga0207704_1000004145 213
313 3300025940 Ga0207691_10076508 Ga0207691_100765083 213
314 3300025949 Ga0207667_10052428 Ga0207667_100524285 213
315 3300025949 Ga0207667_10358778 Ga0207667_103587781 213
316 3300026041 Ga0207639_10133899 Ga0207639_101338993 213
317 3300026041 Ga0207639_10436175 Ga0207639_104361751 213
318 3300026078 Ga0207702_10107108 Ga0207702_101071082 213
319 3300026078 Ga0207702_10578174 Ga0207702_105781741 213
320 3300026089 Ga0207648_10077156 Ga0207648_100771564 213
321 3300026121 Ga0207683_10057685 Ga0207683_100576855 213
322 3300026142 Ga0207698_10004628 Ga0207698_100046284 213
323 3300028379 Ga0268266_10000137 Ga0268266_10000137106 213
324 3300028786 Ga0307517_10009539 Ga0307517_1000953915 213
325 3300028794 Ga0307515_10044126 Ga0307515_100441262 213
326 3300030744 Ga0316181_1073001 Ga0316181_10730013 213
327 3300031731 Ga0307405_10000030 Ga0307405_1000003050 213
328 3300031903 Ga0307407_10000023 Ga0307407_1000002369 213
329 3300031911 Ga0307412_10000084 Ga0307412_1000008476 213
330 3300031995 Ga0307409_100452369 Ga0307409_1004523692 213
331 3300032002 Ga0307416_100000049 Ga0307416_10000004942 213
332 3300032004 Ga0307414_10000555 Ga0307414_1000055520 213
333 3300032004 Ga0307414_10403210 Ga0307414_104032102 213
334 3300032004 Ga0307414_10662058 Ga0307414_106620582 213
335 3300032004 Ga0307414_10761145 Ga0307414_107611451 213
336 3300033179 Ga0307507_10007067 Ga0307507_100070677 213
337 3300033180 Ga0307510_10003250 Ga0307510_100032509 213
338 3300037312 Ga0395899_0000002 Ga0395899_0000002_621986_622669 213
339 3300039447 Ga0436361_0410746 Ga0436361_0410746_2651_3328 213
340 3300041452 Ga0451793_0870834 Ga0451793_0870834_87_764 213
341 3300046471 Ga0495650_0080692 Ga0495650_0080692_438_1118 213
342 3300046500 Ga0495596_0052626 Ga0495596_0052626_626_1303 213
343 3300046506 Ga0495583_0155471 Ga0495583_0155471_159_836 213
344 3300046507 Ga0495606_0056554 Ga0495606_0056554_600_1277 213
345 3300046507 Ga0495606_0241383 Ga0495606_0241383_216_893 213
346 3300046523 Ga0495644_0060737 Ga0495644_0060737_56_733 213
347 3300046558 Ga0495633_0000046 Ga0495633_0000046_162049_162726 213
348 3300046616 Ga0495668_0000070 Ga0495668_0000070_73954_74631 213
349 3300046660 Ga0495625_0076131 Ga0495625_0076131_928_1605 213
350 3300046665 Ga0495661_0004111 Ga0495661_0004111_5857_6534 213
351 3300046691 Ga0495670_0278271 Ga0495670_0278271_120_797 213
352 3300046810 Ga0495660_0049893 Ga0495660_0049893_1412_2089 213
353 3300047323 Ga0495683_0007503 Ga0495683_0007503_158_835 213
354 3300047447 Ga0495685_041656 Ga0495685_041656_568_1245 213
355 3300053123 Ga0500614_018446 Ga0500614_018446_640_1317 213
356 3300053138 Ga0500564_030084 Ga0500564_030084_287_964 213
357 3300053156 Ga0500622_0008830 Ga0500622_0008830_2057_2734 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

79

242

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jhq-assembly1.cif.gz_A crystal structure of uracil dna-glycosylase from vibrio cholerae 0.9466 9 213
5eug-assembly1.cif.gz_A crystallographic and enzymatic studies of an active site variant h187q of escherichia coli uracil dna glycosylase: crystal structures of mutant h187q and its uracil complex 0.943 9 213
2ssp-assembly1.cif.gz_E leucine-272-alanine uracil-dna glycosylase bound to abasic site-containing dna 0.9405 9 213
2uug-assembly2.cif.gz_B escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi 0.9381 9 213
6lye-assembly1.cif.gz_A crystal structure of mimivirus ung y322f in complex with ugi 0.9355 9 212
ID Description Score Start End Superfamily
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9495 9 213 3.40.470.10
3a7nA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9352 15 213 3.40.470.10
4l5nB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9264 9 212 3.40.470.10
af_Q8ILU6_89_322_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9169 5 213 3.40.470.10
af_Q1ZXM2_175_429_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9152 6 212 3.40.470.10
ID Description Score Start End GO Terms
AF-E4UBG0-F1-model_v4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9723 66 213 GO:0004844
GO:0097510
AF-M1BR93-F1-model_v4 Uracil-DNA glycosylase 0.9716 64 212 GO:0004844
GO:0006284
AF-A0A7V6ILG9-F1-model_v4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9689 67 212 GO:0004844
GO:0097510
AF-A0A7S0D8Z2-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9671 19 213 GO:0004844
GO:0005634
GO:0005739
GO:0097510
AF-S8DI70-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9662 53 212 GO:0004844
GO:0097510

Feature Viewer

pLDDT pTM Quality
83.72 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map