metagRoot

F417506

General Info

Members	Datasets	Scaffolds	Average Seq Length
348	260	342	171

Family's Representative Sequence

Representative Sequence	3300009094\|Ga0111539_10000655\|Ga0111539_1000065512
Length	188
Sequence	VRDPLIVSKERRPVNVSELLLDAFGRLPDLVRSAVEGLTPEQLHWAPGPGSNSIGWLVWHLARVQDSHVAELLDAKQVWTSGDWAGRFGLEHADPDDTGYDHVPEQVDAVRPESAEALVEYYDAVAERTNTMLAGLRDADLDRIVDERWDPPVTLGVRLVSVLDDDVQHAGQAGYVRGVLEREALPPA

Samples

	Sample ID	Description	Type	Environment
1	2558860280	Kutzneria sp. 744	Isolate	Unclassified
2	2643221561	Nocardioides sp. Root151	Isolate	Unclassified
3	2643221696	Nocardioides sp. Root140	Isolate	Unclassified
4	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
5	2867302475	Micromonospora globbae WPS1-2	Isolate	Unclassified
6	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
7	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
8	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
11	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
12	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
13	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
14	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
15	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
16	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
17	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
18	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
21	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
22	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
23	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
24	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
25	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
26	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
27	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
28	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
29	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
30	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
31	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
32	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
33	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
34	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
35	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
36	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
37	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
38	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
39	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
40	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
41	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
42	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
43	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
44	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
45	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
46	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
47	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
48	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
49	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
50	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
51	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
52	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
53	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
54	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
55	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
56	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
57	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
58	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
59	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
61	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
62	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
63	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
64	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
65	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
66	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
67	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
68	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
69	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
70	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
71	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
72	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
111	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
112	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
113	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
114	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
115	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
116	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
117	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
118	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
119	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
120	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
121	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
122	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
123	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
124	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
125	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
126	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
127	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
128	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
129	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
130	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
131	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
132	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
133	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
134	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
135	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
136	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
137	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
138	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
139	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
140	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
141	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
142	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
143	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
144	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
145	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
146	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
147	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
148	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
149	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
150	3300033547	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1	Metagenome	Unclassified
151	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
152	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
153	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
154	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
155	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
156	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
157	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
158	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
159	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
160	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
161	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
162	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
163	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
164	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
165	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
166	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
167	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
168	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
169	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
170	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
171	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
172	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
173	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
174	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
175	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
176	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
177	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
178	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
179	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
180	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
181	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
182	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
183	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
184	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
185	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
186	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
187	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
188	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
189	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
190	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
191	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
192	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
193	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
194	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
195	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
196	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
197	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
198	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
199	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
200	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
201	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
202	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
203	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
204	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
205	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
206	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
207	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
208	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
209	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
210	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
211	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
212	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
215	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
216	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
227	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
228	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
230	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
233	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
234	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
235	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
236	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
238	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
242	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
243	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
244	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
245	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
246	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
247	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
248	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
249	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
250	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
251	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
252	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
253	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
254	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
255	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
256	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
257	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
258	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
259	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
260	8003314358	Amycolatopsis sp. MtRt-6	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	97.7
Metatranscriptomes	0.57
Isolates	1.72

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.47
Nodule	0
Rhizoplane	2.01
Rhizosphere	81.03
Stem	0
Stem Tuber	0
Unclassified	9.48

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10080807	3300003203	Bacteria	997
2	JGI25406J46586_10096496	3300003203	Bacteria	886
3	rootH2_10030828	3300003320	Bacteria	1329
4	Ga0070676_10019974	3300005328	Bacteria	3733
5	Ga0070683_100092612	3300005329	Bacteria	2839
6	Ga0070670_100051131	3300005331	Bacteria	3550
7	Ga0068869_100012530	3300005334	Bacteria	5608
8	Ga0070682_100303899	3300005337	Bacteria	1172
9	Ga0070687_100042405	3300005343	Bacteria	2305
10	Ga0070661_100042804	3300005344	Bacteria	3307
11	Ga0070692_10072543	3300005345	Bacteria	1837
12	Ga0070668_100000603	3300005347	Bacteria	24049
13	Ga0070668_100069984	3300005347	Bacteria	2731
14	Ga0070669_100076976	3300005353	Unclassified	2477
15	Ga0070675_100000690	3300005354	Bacteria	23436
16	Ga0070671_100000001	3300005355	Bacteria	1228151
17	Ga0070671_100171486	3300005355	Bacteria	1835
18	Ga0070659_100005881	3300005366	Bacteria	8838
19	Ga0070659_100701238	3300005366	Bacteria	875
20	Ga0070714_100003468	3300005435	Bacteria	11760
21	Ga0070714_100211539	3300005435	Bacteria	1778
22	Ga0070714_100349430	3300005435	Bacteria	1388
23	Ga0070714_100542599	3300005435	Bacteria	1112
24	Ga0070714_100843523	3300005435	Bacteria	888
25	Ga0070713_100015146	3300005436	Bacteria	5749
26	Ga0070713_100024160	3300005436	Bacteria	4730
27	Ga0070713_100259576	3300005436	Bacteria	1587
28	Ga0070713_101096097	3300005436	Bacteria	769
29	Ga0070713_101101735	3300005436	Bacteria	767
30	Ga0070710_10028496	3300005437	Bacteria	2988
31	Ga0070711_100029533	3300005439	Bacteria	3619
32	Ga0070711_100483758	3300005439	Bacteria	1018
33	Ga0070700_100002864	3300005441	Bacteria	8853
34	Ga0070663_100010484	3300005455	Bacteria	5775
35	Ga0070678_100133620	3300005456	Bacteria	1975
36	Ga0070662_100007836	3300005457	Bacteria	6937
37	Ga0070707_100028590	3300005468	Bacteria	5306
38	Ga0070698_100085490	3300005471	Bacteria	3141
39	Ga0070699_100358872	3300005518	Bacteria	1314
40	Ga0070684_100014067	3300005535	Bacteria	6471
41	Ga0068853_100012417	3300005539	Bacteria	6928
42	Ga0070664_100000074	3300005564	Bacteria	63200
43	Ga0068857_100002088	3300005577	Bacteria	16234
44	Ga0068854_100374086	3300005578	Bacteria	1172
45	Ga0070702_100111905	3300005615	Bacteria	1694
46	Ga0068852_100031923	3300005616	Bacteria	4355
47	Ga0068859_100647891	3300005617	Bacteria	1148
48	Ga0068864_100104832	3300005618	Bacteria	2512
49	Ga0068863_101287382	3300005841	Bacteria	738
50	Ga0068858_100000193	3300005842	Bacteria	65241
51	Ga0068858_100165673	3300005842	Bacteria	2082
52	Ga0068860_100390475	3300005843	Bacteria	1375
53	Ga0068862_100045454	3300005844	Bacteria	3747
54	Ga0081540_1064608	3300005983	Bacteria	1726
55	Ga0081539_10000889	3300005985	Bacteria	57153
56	Ga0070717_10153685	3300006028	Bacteria	1992
57	Ga0070717_10319420	3300006028	Bacteria	1383
58	Ga0075365_10158926	3300006038	Bacteria	1574
59	Ga0075368_10123350	3300006042	Bacteria	1074
60	Ga0075363_100024207	3300006048	Bacteria	3084
61	Ga0075363_100164110	3300006048	Bacteria	1259
62	Ga0075364_10020570	3300006051	Unclassified	4151
63	Ga0075364_10027963	3300006051	Bacteria	3606
64	Ga0075364_10136838	3300006051	Bacteria	1646
65	Ga0075364_10554557	3300006051	Bacteria	785
66	Ga0070712_100046274	3300006175	Bacteria	3007
67	Ga0070712_100101964	3300006175	Bacteria	2124
68	Ga0070712_100511625	3300006175	Bacteria	1008
69	Ga0075362_10112208	3300006177	Bacteria	1284
70	Ga0075367_10116324	3300006178	Bacteria	1645
71	Ga0075370_10032996	3300006353	Bacteria	2897
72	Ga0075428_101331026	3300006844	Bacteria	755
73	Ga0075430_100112586	3300006846	Bacteria	2269
74	Ga0097620_100647886	3300006931	Bacteria	1148
75	Ga0111539_10000655	3300009094	Bacteria	44755
76	Ga0105245_10014793	3300009098	Bacteria	6795
77	Ga0105247_10000436	3300009101	Bacteria	35491
78	Ga0105243_10201294	3300009148	Bacteria	1746
79	Ga0105238_10080385	3300009551	Bacteria	3249
80	Ga0105239_12653831	3300010375	Bacteria	584
81	Ga0157369_11666019	3300013105	Bacteria	648
82	Ga0157374_10335233	3300013296	Bacteria	1501
83	Ga0163163_12662977	3300014325	Bacteria	557
84	Ga0157380_10320579	3300014326	Bacteria	1436
85	Ga0157377_10001684	3300014745	Bacteria	9643
86	Ga0157379_10000332	3300014968	Bacteria	37863
87	Ga0224712_10080615	3300022467	Bacteria	1342
88	Ga0207692_10044504	3300025898	Bacteria	2215
89	Ga0207692_10455822	3300025898	Bacteria	806
90	Ga0207710_10000043	3300025900	Bacteria	223494
91	Ga0207685_10034702	3300025905	Bacteria	1835
92	Ga0207699_10019561	3300025906	Bacteria	3614
93	Ga0207699_10254604	3300025906	Bacteria	1211
94	Ga0207645_10063807	3300025907	Bacteria	2354
95	Ga0207643_10362950	3300025908	Bacteria	911
96	Ga0207693_10003188	3300025915	Bacteria	14094
97	Ga0207693_10085381	3300025915	Bacteria	2472
98	Ga0207693_10109601	3300025915	Bacteria	2165
99	Ga0207663_10020709	3300025916	Bacteria	3729
100	Ga0207663_10608502	3300025916	Bacteria	859
101	Ga0207662_10048612	3300025918	Bacteria	2513
102	Ga0207657_10891247	3300025919	Bacteria	685
103	Ga0207649_10142707	3300025920	Bacteria	1641
104	Ga0207646_10037692	3300025922	Bacteria	4357
105	Ga0207681_10094147	3300025923	Unclassified	2146
106	Ga0207650_10059742	3300025925	Bacteria	2843
107	Ga0207659_10256740	3300025926	Bacteria	1420
108	Ga0207687_10045503	3300025927	Bacteria	3034
109	Ga0207700_10029934	3300025928	Bacteria	3849
110	Ga0207700_10043977	3300025928	Bacteria	3284
111	Ga0207700_10070571	3300025928	Bacteria	2686
112	Ga0207700_10098928	3300025928	Bacteria	2321
113	Ga0207700_10663053	3300025928	Bacteria	930
114	Ga0207664_10056292	3300025929	Bacteria	3123
115	Ga0207664_10258835	3300025929	Bacteria	1521
116	Ga0207664_10502923	3300025929	Bacteria	1085
117	Ga0207664_10649763	3300025929	Bacteria	948
118	Ga0207644_10000001	3300025931	Bacteria	1243214
119	Ga0207690_10038428	3300025932	Bacteria	3115
120	Ga0207706_10014864	3300025933	Bacteria	7048
121	Ga0207689_10073086	3300025942	Bacteria	2817
122	Ga0207661_10059019	3300025944	Bacteria	3090
123	Ga0207679_10039332	3300025945	Bacteria	3376
124	Ga0207668_10011889	3300025972	Bacteria	5308
125	Ga0207640_10647114	3300025981	Bacteria	900
126	Ga0207640_11621957	3300025981	Bacteria	583
127	Ga0207703_10000047	3300026035	Bacteria	151177
128	Ga0207703_10023482	3300026035	Bacteria	4844
129	Ga0207639_10020745	3300026041	Bacteria	4708
130	Ga0207678_10000089	3300026067	Bacteria	75976
131	Ga0207678_10062828	3300026067	Bacteria	3191
132	Ga0207708_10024399	3300026075	Bacteria	4574
133	Ga0207702_10982194	3300026078	Bacteria	837
134	Ga0207641_11056657	3300026088	Bacteria	810
135	Ga0207674_10004076	3300026116	Bacteria	17703
136	Ga0207674_10266013	3300026116	Bacteria	1662
137	Ga0207675_100017058	3300026118	Bacteria	6784
138	Ga0207683_10044889	3300026121	Bacteria	3864
139	Ga0209813_10110503	3300027866	Bacteria	946
140	Ga0268265_10004808	3300028380	Bacteria	9311
141	Ga0268264_10317568	3300028381	Bacteria	1472
142	Ga0268264_10325604	3300028381	Bacteria	1455
143	Ga0265337_1000162	3300028556	Bacteria	34505
144	Ga0265337_1001232	3300028556	Bacteria	12952
145	Ga0265326_10003654	3300028558	Bacteria	5024
146	Ga0265319_1001687	3300028563	Bacteria	12760
147	Ga0265319_1006198	3300028563	Bacteria	5575
148	Ga0265334_10000385	3300028573	Bacteria	23543
149	Ga0265334_10012686	3300028573	Bacteria	3539
150	Ga0265318_10112129	3300028577	Bacteria	1002
151	Ga0265323_10016531	3300028653	Bacteria	2878
152	Ga0265322_10020160	3300028654	Bacteria	1911
153	Ga0265336_10003723	3300028666	Bacteria	5914
154	Ga0265336_10035256	3300028666	Bacteria	1543
155	Ga0307517_10033129	3300028786	Bacteria	5948
156	Ga0307515_10000478	3300028794	Bacteria	95304
157	Ga0307515_10013912	3300028794	Bacteria	14979
158	Ga0307515_10083370	3300028794	Bacteria	4121
159	Ga0265338_10000127	3300028800	Bacteria	139864
160	Ga0265338_10002077	3300028800	Bacteria	30928
161	Ga0265338_10002757	3300028800	Bacteria	25769
162	Ga0265338_10006762	3300028800	Bacteria	14462
163	Ga0265338_10007576	3300028800	Bacteria	13413
164	Ga0265324_10006149	3300029957	Bacteria	5061
165	Ga0307511_10000059	3300030521	Bacteria	93044
166	Ga0307512_10009183	3300030522	Bacteria	9555
167	Ga0307512_10014487	3300030522	Bacteria	7343
168	Ga0265332_10002082	3300031238	Bacteria	10421
169	Ga0265332_10002214	3300031238	Bacteria	9973
170	Ga0265320_10004531	3300031240	Bacteria	9099
171	Ga0265320_10118858	3300031240	Bacteria	1206
172	Ga0265325_10008158	3300031241	Bacteria	6204
173	Ga0265325_10021704	3300031241	Bacteria	3523
174	Ga0265340_10004538	3300031247	Bacteria	7739
175	Ga0265340_10004963	3300031247	Bacteria	7395
176	Ga0265339_10063018	3300031249	Bacteria	1992
177	Ga0265339_10065874	3300031249	Bacteria	1941
178	Ga0265316_10030985	3300031344	Bacteria	4378
179	Ga0307513_10050634	3300031456	Bacteria	4487
180	Ga0307509_10107344	3300031507	Bacteria	2808
181	Ga0265313_10010566	3300031595	Bacteria	5821
182	Ga0307508_10025164	3300031616	Bacteria	5398
183	Ga0307508_10560212	3300031616	Bacteria	741
184	Ga0316575_10001698	3300031665	Bacteria	7209
185	Ga0265314_10003884	3300031711	Bacteria	14218
186	Ga0265314_10064932	3300031711	Bacteria	2468
187	Ga0265342_10001644	3300031712	Bacteria	20591
188	Ga0265342_10001978	3300031712	Bacteria	18294
189	Ga0316576_10172741	3300031727	Bacteria	1631
190	Ga0307516_10000433	3300031730	Bacteria	54987
191	Ga0307516_10059116	3300031730	Bacteria	3729
192	Ga0307516_10130731	3300031730	Bacteria	2290
193	Ga0307516_10186238	3300031730	Bacteria	1805
194	Ga0307516_10212886	3300031730	Bacteria	1646
195	Ga0307405_10065055	3300031731	Bacteria	2320
196	Ga0307405_10237113	3300031731	Bacteria	1349
197	Ga0316577_10020420	3300031733	Bacteria	3671
198	Ga0316577_10096584	3300031733	Bacteria	1655
199	Ga0316577_10358134	3300031733	Unclassified	828
200	Ga0307413_10370624	3300031824	Bacteria	1112
201	Ga0307413_10681461	3300031824	Bacteria	852
202	Ga0307518_10003518	3300031838	Bacteria	11278
203	Ga0307410_10405358	3300031852	Bacteria	1103
204	Ga0307406_10204472	3300031901	Bacteria	1456
205	Ga0307409_101603778	3300031995	Bacteria	679
206	Ga0307416_100446584	3300032002	Bacteria	1345
207	Ga0307415_100073766	3300032126	Bacteria	2409
208	Ga0307415_100173755	3300032126	Bacteria	1683
209	Ga0307415_100341989	3300032126	Bacteria	1256
210	Ga0307415_101068085	3300032126	Bacteria	754
211	Ga0307507_10053763	3300033179	Bacteria	3842
212	Ga0307510_10017084	3300033180	Bacteria	8560
213	Ga0316212_1003552	3300033547	Bacteria	2250
214	Ga0373934_0094220	3300035086	Bacteria	1208
215	Ga0373954_0024684	3300035118	Bacteria	2742
216	Ga0373956_0014363	3300035119	Bacteria	3308
217	Ga0373957_0032321	3300035120	Bacteria	1926
218	Ga0373955_0198021	3300035172	Bacteria	1195
219	Ga0316574_0014959	3300035398	Bacteria	4495
220	Ga0316574_0664996	3300035398	Bacteria	640
221	Ga0373924_0089788	3300035410	Bacteria	1314
222	Ga0373935_1152893	3300035692	Bacteria	577
223	Ga0373933_0033905	3300035724	Bacteria	2972
224	Ga0373933_0420752	3300035724	Bacteria	873
225	Ga0373933_0604331	3300035724	Bacteria	720
226	Ga0373937_0038658	3300036401	Bacteria	4348
227	Ga0373937_0463423	3300036401	Bacteria	1204
228	Ga0372808_003544	3300036459	Bacteria	1926
229	Ga0373925_0258828	3300037068	Bacteria	1397
230	Ga0373925_0711675	3300037068	Bacteria	828
231	Ga0451791_0676636	3300041451	Bacteria	700
232	Ga0451802_0435202	3300041460	Bacteria	803
233	Ga0451837_1546774	3300041494	Bacteria	745
234	Ga0451843_1719880	3300041509	Bacteria	634
235	Ga0451853_2028690	3300041512	Bacteria	1302
236	Ga0451853_2705154	3300041512	Bacteria	915
237	Ga0466969_0001420	3300044656	Bacteria	12919
238	Ga0466969_0006621	3300044656	Bacteria	6158
239	Ga0466972_0003823	3300044658	Bacteria	7488
240	Ga0466966_0000652	3300044684	Bacteria	22095
241	Ga0466961_0001477	3300044693	Bacteria	14607
242	Ga0466961_0049221	3300044693	Bacteria	2694
243	Ga0466961_0249200	3300044693	Bacteria	1091
244	Ga0466970_0017654	3300044765	Bacteria	3688
245	Ga0466957_0093312	3300044842	Bacteria	1889
246	Ga0466960_0606367	3300044901	Bacteria	650
247	Ga0466959_0000441	3300045049	Bacteria	24148
248	Ga0466958_0951053	3300045836	Bacteria	560
249	Ga0466967_0274812	3300045976	Bacteria	1615
250	Ga0495592_0080365	3300046454	Bacteria	2359
251	Ga0495592_0445432	3300046454	Bacteria	812
252	Ga0495651_0114244	3300046462	Bacteria	1992
253	Ga0495651_0606955	3300046462	Bacteria	690
254	Ga0495653_0080526	3300046463	Bacteria	2409
255	Ga0495664_0196593	3300046477	Bacteria	1222
256	Ga0495608_0106210	3300046511	Bacteria	1807
257	Ga0495618_0030726	3300046514	Bacteria	3356
258	Ga0495628_0189617	3300046516	Bacteria	1552
259	Ga0495630_0129675	3300046517	Bacteria	1915
260	Ga0495632_0073153	3300046519	Bacteria	1644
261	Ga0495652_0269071	3300046529	Bacteria	1253
262	Ga0495652_0506385	3300046529	Bacteria	836
263	Ga0495652_0688180	3300046529	Bacteria	689
264	Ga0495586_0294101	3300046535	Bacteria	930
265	Ga0495587_0047298	3300046536	Bacteria	2551
266	Ga0495645_0302418	3300046543	Bacteria	1044
267	Ga0495667_0075483	3300046559	Bacteria	2193
268	Ga0495634_0109049	3300046642	Bacteria	1781
269	Ga0495635_0158455	3300046663	Bacteria	1540
270	Ga0495635_0311889	3300046663	Bacteria	1054
271	Ga0495599_0160714	3300046678	Bacteria	1388
272	Ga0495646_0159560	3300046680	Bacteria	1249
273	Ga0495613_0085729	3300046689	Bacteria	2285
274	Ga0495624_0586570	3300046690	Bacteria	665
275	Ga0495600_0168275	3300046809	Bacteria	1415
276	Ga0495604_0130710	3300047317	Bacteria	1805
277	Ga0495674_0206887	3300047319	Bacteria	1627
278	Ga0495680_0139685	3300047322	Bacteria	1773
279	Ga0495675_0164871	3300047444	Bacteria	1363
280	Ga0495684_0077026	3300047471	Bacteria	2532
281	Ga0495602_0044559	3300048088	Bacteria	4023
282	Ga0496104_0250986	3300048907	Bacteria	1682
283	Ga0496106_0287202	3300048909	Bacteria	1318
284	Ga0496112_0120331	3300048915	Bacteria	2595
285	Ga0496112_0500173	3300048915	Bacteria	1151
286	Ga0496113_0487948	3300048916	Bacteria	989
287	Ga0496119_0068632	3300048922	Bacteria	2086
288	Ga0496121_0003465	3300048924	Bacteria	22487
289	Ga0501031_0000505	3300049568	Bacteria	22808
290	Ga0501032_0024976	3300049569	Bacteria	4122
291	Ga0501033_0132483	3300049570	Bacteria	1805
292	Ga0501034_0187025	3300049571	Bacteria	2034
293	Ga0501036_0006371	3300049572	Bacteria	9577
294	Ga0501037_0020480	3300049573	Bacteria	4884
295	Ga0501038_0020002	3300049574	Bacteria	6025
296	Ga0501039_0006473	3300049575	Bacteria	8904
297	Ga0501040_0095109	3300049576	Bacteria	2073
298	Ga0501041_0001684	3300049577	Bacteria	12389
299	Ga0501042_0003033	3300049578	Bacteria	10450
300	Ga0501043_0426515	3300049579	Bacteria	999
301	Ga0501046_0005824	3300049580	Bacteria	10993
302	Ga0501048_0089576	3300049582	Bacteria	2170
303	Ga0501068_0026854	3300049584	Bacteria	3396
304	Ga0501069_0144532	3300049585	Bacteria	1365
305	Ga0501070_0082910	3300049586	Bacteria	2654
306	Ga0501071_0008779	3300049587	Bacteria	6695
307	Ga0501072_0041779	3300049588	Bacteria	3601
308	Ga0501073_0043161	3300049589	Bacteria	3180
309	Ga0501074_0112457	3300049590	Bacteria	1948
310	Ga0501074_0242088	3300049590	Bacteria	1283
311	Ga0501075_0001935	3300049591	Bacteria	13656
312	Ga0501076_0012436	3300049592	Bacteria	6362
313	Ga0501077_0028245	3300049593	Bacteria	3565
314	Ga0501079_0091890	3300049741	Bacteria	2351
315	Ga0501080_0049654	3300049742	Bacteria	3905
316	Ga0501081_0056942	3300049743	Bacteria	2702
317	Ga0501035_0057936	3300049822	Bacteria	3453
318	Ga0501044_0568679	3300049823	Bacteria	1029
319	Ga0501045_0001268	3300049824	Bacteria	16749
320	nmdc:mga00v17_151528_c1	3300050491	Bacteria	1490
321	nmdc:mga00v17_31728_c1	3300050491	Unclassified	3118
322	nmdc:mga00v17_491353_c1	3300050491	Bacteria	796
323	nmdc:mga0yw44_33229_c1	3300050492	Bacteria	1782
324	nmdc:mga0yw44_72618_c1	3300050492	Bacteria	2139
325	nmdc:mga0k408_139313_c1	3300050493	Bacteria	1442
326	nmdc:mga06z11_474808_c1	3300050494	Bacteria	757
327	nmdc:mga06z11_65458_c1	3300050494	Bacteria	1907
328	nmdc:mga04h51_270488_c1	3300050495	Bacteria	686
329	nmdc:mga07m45_41873_c1	3300050496	Bacteria	2566
330	nmdc:mga09592_83797_c1	3300050508	Bacteria	2717
331	nmdc:mga0qj67_233301_c1	3300050509	Bacteria	1493
332	nmdc:mga08y16_59780_c1	3300050511	Bacteria	3981
333	Ga0495601_0055684	3300053077	Bacteria	2504
334	Ga0495619_0150568	3300053085	Bacteria	1605
335	Ga0500646_0000240	3300053090	Bacteria	16745
336	Ga0500621_168618	3300053126	Bacteria	805
337	Ga0500568_0048752	3300053139	Bacteria	1673
338	Ga0500616_0000492	3300053153	Bacteria	50958
339	Ga0501084_0089122	3300054114	Bacteria	2589
340	Ga0501082_0044479	3300060353	Bacteria	3830
341	Ga0466962_0054177	3300061719	Bacteria	1917
342	Ga0530510_0052787	3300061734	Bacteria	2936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300013296	Ga0157374_10335233	Ga0157374_103352332	129
2	3300045836	Ga0466958_0951053	Ga0466958_0951053_96_509	133
3	3300049569	Ga0501032_0024976	Ga0501032_0024976_3647_4108	149
4	3300049582	Ga0501048_0089576	Ga0501048_0089576_23_484	149
5	3300046543	Ga0495645_0302418	Ga0495645_0302418_363_881	150
6	3300036401	Ga0373937_0463423	Ga0373937_0463423_348_872	152
7	3300005435	Ga0070714_100843523	Ga0070714_1008435232	153
8	3300005436	Ga0070713_101096097	Ga0070713_1010960972	153
9	3300006028	Ga0070717_10319420	Ga0070717_103194202	153
10	3300025905	Ga0207685_10034702	Ga0207685_100347022	153
11	3300025916	Ga0207663_10020709	Ga0207663_100207092	153
12	3300025929	Ga0207664_10258835	Ga0207664_102588352	153
13	3300005439	Ga0070711_100483758	Ga0070711_1004837582	157
14	3300006175	Ga0070712_100101964	Ga0070712_1001019643	157
15	3300025898	Ga0207692_10455822	Ga0207692_104558222	157
16	3300025915	Ga0207693_10109601	Ga0207693_101096012	157
17	3300025916	Ga0207663_10608502	Ga0207663_106085022	157
18	3300025928	Ga0207700_10043977	Ga0207700_100439773	157
19	3300035724	Ga0373933_0604331	Ga0373933_0604331_112_633	157
20	iso_pu_bacteria	2867302475	2867308303	160
21	iso_pu_bacteria	2558860280	2559424103	161
22	iso_pu_bacteria	2643221561	2643827866	161
23	iso_pu_bacteria	2643221696	2644532366	161
24	iso_pu_bacteria	2744054611	2744956087	161
25	3300028800	Ga0265338_10000127	Ga0265338_10000127120	162
26	iso_pu_bacteria	8003314358	8003318655	162
27	3300005435	Ga0070714_100003468	Ga0070714_1000034683	163
28	3300005436	Ga0070713_100024160	Ga0070713_1000241603	163
29	3300025928	Ga0207700_10098928	Ga0207700_100989281	163
30	3300025929	Ga0207664_10056292	Ga0207664_100562921	163
31	3300006051	Ga0075364_10020570	Ga0075364_100205703	164
32	3300050491	nmdc:mga00v17_31728_c1	nmdc:mga00v17_31728_c1_854_1372	164
33	3300003320	rootH2_10030828	rootH2_100308282	165
34	3300005353	Ga0070669_100076976	Ga0070669_1000769762	165
35	3300005355	Ga0070671_100000001	Ga0070671_100000001273	165
36	3300005539	Ga0068853_100012417	Ga0068853_1000124176	165
37	3300005616	Ga0068852_100031923	Ga0068852_1000319231	165
38	3300006038	Ga0075365_10158926	Ga0075365_101589262	165
39	3300006042	Ga0075368_10123350	Ga0075368_101233502	165
40	3300006048	Ga0075363_100024207	Ga0075363_1000242072	165
41	3300006051	Ga0075364_10027963	Ga0075364_100279634	165
42	3300006178	Ga0075367_10116324	Ga0075367_101163242	165
43	3300006353	Ga0075370_10032996	Ga0075370_100329964	165
44	3300009551	Ga0105238_10080385	Ga0105238_100803854	165
45	3300013105	Ga0157369_11666019	Ga0157369_116660191	165
46	3300025923	Ga0207681_10094147	Ga0207681_100941472	165
47	3300025931	Ga0207644_10000001	Ga0207644_100000011164	165
48	3300025981	Ga0207640_11621957	Ga0207640_116219571	165
49	3300026041	Ga0207639_10020745	Ga0207639_100207455	165
50	3300026078	Ga0207702_10982194	Ga0207702_109821942	165
51	3300027866	Ga0209813_10110503	Ga0209813_101105032	165
52	3300030521	Ga0307511_10000059	Ga0307511_100000595	165
53	3300031665	Ga0316575_10001698	Ga0316575_100016985	165
54	3300031731	Ga0307405_10065055	Ga0307405_100650552	165
55	3300035086	Ga0373934_0094220	Ga0373934_0094220_191_706	165
56	3300035118	Ga0373954_0024684	Ga0373954_0024684_1823_2338	165
57	3300035119	Ga0373956_0014363	Ga0373956_0014363_1280_1795	165
58	3300035120	Ga0373957_0032321	Ga0373957_0032321_1298_1813	165
59	3300035172	Ga0373955_0198021	Ga0373955_0198021_78_593	165
60	3300035398	Ga0316574_0664996	Ga0316574_0664996_88_597	165
61	3300035410	Ga0373924_0089788	Ga0373924_0089788_337_852	165
62	3300035692	Ga0373935_1152893	Ga0373935_1152893_14_529	165
63	3300035724	Ga0373933_0033905	Ga0373933_0033905_387_902	165
64	3300036401	Ga0373937_0038658	Ga0373937_0038658_2930_3445	165
65	3300037068	Ga0373925_0258828	Ga0373925_0258828_54_557	165
66	3300044656	Ga0466969_0001420	Ga0466969_0001420_373_876	165
67	3300044656	Ga0466969_0006621	Ga0466969_0006621_3531_4031	165
68	3300044684	Ga0466966_0000652	Ga0466966_0000652_14843_15346	165
69	3300044693	Ga0466961_0001477	Ga0466961_0001477_13845_14348	165
70	3300044693	Ga0466961_0049221	Ga0466961_0049221_1946_2449	165
71	3300045049	Ga0466959_0000441	Ga0466959_0000441_19302_19805	165
72	3300046454	Ga0495592_0080365	Ga0495592_0080365_738_1253	165
73	3300046454	Ga0495592_0445432	Ga0495592_0445432_92_595	165
74	3300046462	Ga0495651_0114244	Ga0495651_0114244_498_1013	165
75	3300046463	Ga0495653_0080526	Ga0495653_0080526_458_973	165
76	3300046477	Ga0495664_0196593	Ga0495664_0196593_148_663	165
77	3300046511	Ga0495608_0106210	Ga0495608_0106210_833_1348	165
78	3300046514	Ga0495618_0030726	Ga0495618_0030726_1036_1551	165
79	3300046516	Ga0495628_0189617	Ga0495628_0189617_323_838	165
80	3300046517	Ga0495630_0129675	Ga0495630_0129675_874_1389	165
81	3300046529	Ga0495652_0269071	Ga0495652_0269071_346_861	165
82	3300046529	Ga0495652_0688180	Ga0495652_0688180_23_526	165
83	3300046535	Ga0495586_0294101	Ga0495586_0294101_177_692	165
84	3300046536	Ga0495587_0047298	Ga0495587_0047298_1933_2448	165
85	3300046559	Ga0495667_0075483	Ga0495667_0075483_1207_1722	165
86	3300046642	Ga0495634_0109049	Ga0495634_0109049_850_1365	165
87	3300046663	Ga0495635_0158455	Ga0495635_0158455_738_1253	165
88	3300046663	Ga0495635_0311889	Ga0495635_0311889_101_613	165
89	3300046678	Ga0495599_0160714	Ga0495599_0160714_697_1212	165
90	3300046680	Ga0495646_0159560	Ga0495646_0159560_719_1234	165
91	3300046689	Ga0495613_0085729	Ga0495613_0085729_385_900	165
92	3300046690	Ga0495624_0586570	Ga0495624_0586570_44_559	165
93	3300046809	Ga0495600_0168275	Ga0495600_0168275_191_706	165
94	3300047317	Ga0495604_0130710	Ga0495604_0130710_1038_1553	165
95	3300047319	Ga0495674_0206887	Ga0495674_0206887_335_850	165
96	3300047322	Ga0495680_0139685	Ga0495680_0139685_924_1439	165
97	3300047444	Ga0495675_0164871	Ga0495675_0164871_763_1278	165
98	3300047471	Ga0495684_0077026	Ga0495684_0077026_83_598	165
99	3300048088	Ga0495602_0044559	Ga0495602_0044559_1474_1989	165
100	3300049585	Ga0501069_0144532	Ga0501069_0144532_176_685	165
101	3300049589	Ga0501073_0043161	Ga0501073_0043161_231_740	165
102	3300049590	Ga0501074_0242088	Ga0501074_0242088_601_1110	165
103	3300050492	nmdc:mga0yw44_33229_c1	nmdc:mga0yw44_33229_c1_304_813	165
104	3300050492	nmdc:mga0yw44_72618_c1	nmdc:mga0yw44_72618_c1_588_1091	165
105	3300050494	nmdc:mga06z11_474808_c1	nmdc:mga06z11_474808_c1_31_540	165
106	3300050495	nmdc:mga04h51_270488_c1	nmdc:mga04h51_270488_c1_133_642	165
107	3300050496	nmdc:mga07m45_41873_c1	nmdc:mga07m45_41873_c1_202_711	165
108	3300053077	Ga0495601_0055684	Ga0495601_0055684_1074_1589	165
109	3300053085	Ga0495619_0150568	Ga0495619_0150568_497_1012	165
110	3300061719	Ga0466962_0054177	Ga0466962_0054177_643_1146	165
111	3300003203	JGI25406J46586_10080807	JGI25406J46586_100808071	166
112	3300003203	JGI25406J46586_10096496	JGI25406J46586_100964961	166
113	3300005328	Ga0070676_10019974	Ga0070676_100199743	166
114	3300005329	Ga0070683_100092612	Ga0070683_1000926123	166
115	3300005331	Ga0070670_100051131	Ga0070670_1000511313	166
116	3300005334	Ga0068869_100012530	Ga0068869_1000125302	166
117	3300005337	Ga0070682_100303899	Ga0070682_1003038991	166
118	3300005343	Ga0070687_100042405	Ga0070687_1000424051	166
119	3300005344	Ga0070661_100042804	Ga0070661_1000428042	166
120	3300005345	Ga0070692_10072543	Ga0070692_100725432	166
121	3300005347	Ga0070668_100000603	Ga0070668_10000060327	166
122	3300005347	Ga0070668_100069984	Ga0070668_1000699842	166
123	3300005354	Ga0070675_100000690	Ga0070675_10000069012	166
124	3300005355	Ga0070671_100171486	Ga0070671_1001714862	166
125	3300005366	Ga0070659_100005881	Ga0070659_1000058813	166
126	3300005366	Ga0070659_100701238	Ga0070659_1007012381	166
127	3300005435	Ga0070714_100211539	Ga0070714_1002115392	166
128	3300005435	Ga0070714_100349430	Ga0070714_1003494301	166
129	3300005435	Ga0070714_100542599	Ga0070714_1005425992	166
130	3300005436	Ga0070713_100015146	Ga0070713_1000151463	166
131	3300005436	Ga0070713_100259576	Ga0070713_1002595762	166
132	3300005436	Ga0070713_101101735	Ga0070713_1011017351	166
133	3300005437	Ga0070710_10028496	Ga0070710_100284962	166
134	3300005439	Ga0070711_100029533	Ga0070711_1000295332	166
135	3300005441	Ga0070700_100002864	Ga0070700_1000028645	166
136	3300005455	Ga0070663_100010484	Ga0070663_1000104847	166
137	3300005456	Ga0070678_100133620	Ga0070678_1001336202	166
138	3300005457	Ga0070662_100007836	Ga0070662_1000078365	166
139	3300005468	Ga0070707_100028590	Ga0070707_1000285906	166
140	3300005471	Ga0070698_100085490	Ga0070698_1000854901	166
141	3300005518	Ga0070699_100358872	Ga0070699_1003588721	166
142	3300005535	Ga0070684_100014067	Ga0070684_1000140673	166
143	3300005564	Ga0070664_100000074	Ga0070664_10000007416	166
144	3300005577	Ga0068857_100002088	Ga0068857_1000020888	166
145	3300005578	Ga0068854_100374086	Ga0068854_1003740862	166
146	3300005615	Ga0070702_100111905	Ga0070702_1001119053	166
147	3300005617	Ga0068859_100647891	Ga0068859_1006478912	166
148	3300005618	Ga0068864_100104832	Ga0068864_1001048323	166
149	3300005841	Ga0068863_101287382	Ga0068863_1012873821	166
150	3300005842	Ga0068858_100000193	Ga0068858_10000019354	166
151	3300005842	Ga0068858_100165673	Ga0068858_1001656733	166
152	3300005843	Ga0068860_100390475	Ga0068860_1003904752	166
153	3300005844	Ga0068862_100045454	Ga0068862_1000454543	166
154	3300005983	Ga0081540_1064608	Ga0081540_10646082	166
155	3300005985	Ga0081539_10000889	Ga0081539_100008897	166
156	3300006028	Ga0070717_10153685	Ga0070717_101536852	166
157	3300006048	Ga0075363_100164110	Ga0075363_1001641103	166
158	3300006051	Ga0075364_10136838	Ga0075364_101368382	166
159	3300006051	Ga0075364_10554557	Ga0075364_105545571	166
160	3300006175	Ga0070712_100046274	Ga0070712_1000462742	166
161	3300006175	Ga0070712_100511625	Ga0070712_1005116252	166
162	3300006177	Ga0075362_10112208	Ga0075362_101122082	166
163	3300006844	Ga0075428_101331026	Ga0075428_1013310261	166
164	3300006846	Ga0075430_100112586	Ga0075430_1001125863	166
165	3300006931	Ga0097620_100647886	Ga0097620_1006478862	166
166	3300009094	Ga0111539_10000655	Ga0111539_1000065512	166
167	3300009098	Ga0105245_10014793	Ga0105245_100147935	166
168	3300009101	Ga0105247_10000436	Ga0105247_1000043626	166
169	3300009148	Ga0105243_10201294	Ga0105243_102012941	166
170	3300010375	Ga0105239_12653831	Ga0105239_126538311	166
171	3300014325	Ga0163163_12662977	Ga0163163_126629771	166
172	3300014326	Ga0157380_10320579	Ga0157380_103205792	166
173	3300014745	Ga0157377_10001684	Ga0157377_100016847	166
174	3300014968	Ga0157379_10000332	Ga0157379_100003323	166
175	3300022467	Ga0224712_10080615	Ga0224712_100806152	166
176	3300025898	Ga0207692_10044504	Ga0207692_100445042	166
177	3300025900	Ga0207710_10000043	Ga0207710_1000004335	166
178	3300025906	Ga0207699_10019561	Ga0207699_100195614	166
179	3300025906	Ga0207699_10254604	Ga0207699_102546042	166
180	3300025907	Ga0207645_10063807	Ga0207645_100638073	166
181	3300025908	Ga0207643_10362950	Ga0207643_103629502	166
182	3300025915	Ga0207693_10003188	Ga0207693_1000318815	166
183	3300025915	Ga0207693_10085381	Ga0207693_100853813	166
184	3300025918	Ga0207662_10048612	Ga0207662_100486124	166
185	3300025919	Ga0207657_10891247	Ga0207657_108912472	166
186	3300025920	Ga0207649_10142707	Ga0207649_101427072	166
187	3300025922	Ga0207646_10037692	Ga0207646_100376921	166
188	3300025925	Ga0207650_10059742	Ga0207650_100597423	166
189	3300025926	Ga0207659_10256740	Ga0207659_102567403	166
190	3300025927	Ga0207687_10045503	Ga0207687_100455032	166
191	3300025928	Ga0207700_10029934	Ga0207700_100299342	166
192	3300025928	Ga0207700_10070571	Ga0207700_100705712	166
193	3300025928	Ga0207700_10663053	Ga0207700_106630531	166
194	3300025929	Ga0207664_10502923	Ga0207664_105029232	166
195	3300025929	Ga0207664_10649763	Ga0207664_106497631	166
196	3300025932	Ga0207690_10038428	Ga0207690_100384283	166
197	3300025933	Ga0207706_10014864	Ga0207706_100148645	166
198	3300025942	Ga0207689_10073086	Ga0207689_100730863	166
199	3300025944	Ga0207661_10059019	Ga0207661_100590193	166
200	3300025945	Ga0207679_10039332	Ga0207679_100393322	166
201	3300025972	Ga0207668_10011889	Ga0207668_100118895	166
202	3300025981	Ga0207640_10647114	Ga0207640_106471141	166
203	3300026035	Ga0207703_10000047	Ga0207703_1000004797	166
204	3300026035	Ga0207703_10023482	Ga0207703_100234824	166
205	3300026067	Ga0207678_10000089	Ga0207678_1000008959	166
206	3300026067	Ga0207678_10062828	Ga0207678_100628283	166
207	3300026075	Ga0207708_10024399	Ga0207708_100243993	166
208	3300026088	Ga0207641_11056657	Ga0207641_110566572	166
209	3300026116	Ga0207674_10004076	Ga0207674_1000407612	166
210	3300026116	Ga0207674_10266013	Ga0207674_102660132	166
211	3300026118	Ga0207675_100017058	Ga0207675_1000170585	166
212	3300026121	Ga0207683_10044889	Ga0207683_100448894	166
213	3300028380	Ga0268265_10004808	Ga0268265_100048083	166
214	3300028381	Ga0268264_10317568	Ga0268264_103175682	166
215	3300028381	Ga0268264_10325604	Ga0268264_103256042	166
216	3300028556	Ga0265337_1000162	Ga0265337_100016221	166
217	3300028556	Ga0265337_1001232	Ga0265337_10012322	166
218	3300028558	Ga0265326_10003654	Ga0265326_100036545	166
219	3300028563	Ga0265319_1001687	Ga0265319_10016878	166
220	3300028563	Ga0265319_1006198	Ga0265319_10061984	166
221	3300028573	Ga0265334_10000385	Ga0265334_1000038512	166
222	3300028573	Ga0265334_10012686	Ga0265334_100126862	166
223	3300028577	Ga0265318_10112129	Ga0265318_101121291	166
224	3300028653	Ga0265323_10016531	Ga0265323_100165313	166
225	3300028654	Ga0265322_10020160	Ga0265322_100201602	166
226	3300028666	Ga0265336_10003723	Ga0265336_100037235	166
227	3300028666	Ga0265336_10035256	Ga0265336_100352562	166
228	3300028786	Ga0307517_10033129	Ga0307517_100331294	166
229	3300028794	Ga0307515_10000478	Ga0307515_1000047876	166
230	3300028794	Ga0307515_10013912	Ga0307515_100139126	166
231	3300028794	Ga0307515_10083370	Ga0307515_100833704	166
232	3300028800	Ga0265338_10002077	Ga0265338_1000207722	166
233	3300028800	Ga0265338_10002757	Ga0265338_1000275723	166
234	3300028800	Ga0265338_10006762	Ga0265338_1000676215	166
235	3300028800	Ga0265338_10007576	Ga0265338_100075768	166
236	3300029957	Ga0265324_10006149	Ga0265324_100061494	166
237	3300030522	Ga0307512_10009183	Ga0307512_100091837	166
238	3300030522	Ga0307512_10014487	Ga0307512_100144872	166
239	3300031238	Ga0265332_10002082	Ga0265332_100020828	166
240	3300031238	Ga0265332_10002214	Ga0265332_100022142	166
241	3300031240	Ga0265320_10004531	Ga0265320_100045313	166
242	3300031240	Ga0265320_10118858	Ga0265320_101188582	166
243	3300031241	Ga0265325_10008158	Ga0265325_100081587	166
244	3300031241	Ga0265325_10021704	Ga0265325_100217042	166
245	3300031247	Ga0265340_10004538	Ga0265340_100045388	166
246	3300031247	Ga0265340_10004963	Ga0265340_100049634	166
247	3300031249	Ga0265339_10063018	Ga0265339_100630182	166
248	3300031249	Ga0265339_10065874	Ga0265339_100658742	166
249	3300031344	Ga0265316_10030985	Ga0265316_100309851	166
250	3300031456	Ga0307513_10050634	Ga0307513_100506343	166
251	3300031507	Ga0307509_10107344	Ga0307509_101073444	166
252	3300031595	Ga0265313_10010566	Ga0265313_100105663	166
253	3300031616	Ga0307508_10025164	Ga0307508_100251641	166
254	3300031616	Ga0307508_10560212	Ga0307508_105602121	166
255	3300031711	Ga0265314_10003884	Ga0265314_100038844	166
256	3300031711	Ga0265314_10064932	Ga0265314_100649322	166
257	3300031712	Ga0265342_10001644	Ga0265342_1000164416	166
258	3300031712	Ga0265342_10001978	Ga0265342_100019788	166
259	3300031727	Ga0316576_10172741	Ga0316576_101727412	166
260	3300031730	Ga0307516_10000433	Ga0307516_1000043339	166
261	3300031730	Ga0307516_10059116	Ga0307516_100591163	166
262	3300031730	Ga0307516_10130731	Ga0307516_101307312	166
263	3300031730	Ga0307516_10186238	Ga0307516_101862383	166
264	3300031730	Ga0307516_10212886	Ga0307516_102128863	166
265	3300031731	Ga0307405_10237113	Ga0307405_102371132	166
266	3300031733	Ga0316577_10020420	Ga0316577_100204203	166
267	3300031733	Ga0316577_10096584	Ga0316577_100965841	166
268	3300031733	Ga0316577_10358134	Ga0316577_103581341	166
269	3300031824	Ga0307413_10370624	Ga0307413_103706241	166
270	3300031824	Ga0307413_10681461	Ga0307413_106814612	166
271	3300031838	Ga0307518_10003518	Ga0307518_100035186	166
272	3300031852	Ga0307410_10405358	Ga0307410_104053581	166
273	3300031901	Ga0307406_10204472	Ga0307406_102044721	166
274	3300031995	Ga0307409_101603778	Ga0307409_1016037781	166
275	3300032002	Ga0307416_100446584	Ga0307416_1004465842	166
276	3300032126	Ga0307415_100073766	Ga0307415_1000737663	166
277	3300032126	Ga0307415_100173755	Ga0307415_1001737551	166
278	3300032126	Ga0307415_100341989	Ga0307415_1003419892	166
279	3300032126	Ga0307415_101068085	Ga0307415_1010680852	166
280	3300033179	Ga0307507_10053763	Ga0307507_100537633	166
281	3300033180	Ga0307510_10017084	Ga0307510_100170847	166
282	3300033547	Ga0316212_1003552	Ga0316212_10035521	166
283	3300035398	Ga0316574_0014959	Ga0316574_0014959_1795_2301	166
284	3300035724	Ga0373933_0420752	Ga0373933_0420752_221_739	166
285	3300036459	Ga0372808_003544	Ga0372808_003544_946_1470	166
286	3300037068	Ga0373925_0711675	Ga0373925_0711675_253_771	166
287	3300041451	Ga0451791_0676636	Ga0451791_0676636_65_574	166
288	3300041460	Ga0451802_0435202	Ga0451802_0435202_77_589	166
289	3300041494	Ga0451837_1546774	Ga0451837_1546774_65_571	166
290	3300041509	Ga0451843_1719880	Ga0451843_1719880_112_621	166
291	3300041512	Ga0451853_2028690	Ga0451853_2028690_24_536	166
292	3300041512	Ga0451853_2705154	Ga0451853_2705154_173_718	166
293	3300044658	Ga0466972_0003823	Ga0466972_0003823_6562_7074	166
294	3300044693	Ga0466961_0249200	Ga0466961_0249200_365_874	166
295	3300044765	Ga0466970_0017654	Ga0466970_0017654_796_1308	166
296	3300044842	Ga0466957_0093312	Ga0466957_0093312_692_1198	166
297	3300044901	Ga0466960_0606367	Ga0466960_0606367_12_521	166
298	3300045976	Ga0466967_0274812	Ga0466967_0274812_587_1120	166
299	3300046462	Ga0495651_0606955	Ga0495651_0606955_105_623	166
300	3300046519	Ga0495632_0073153	Ga0495632_0073153_586_1086	166
301	3300046529	Ga0495652_0506385	Ga0495652_0506385_75_593	166
302	3300048907	Ga0496104_0250986	Ga0496104_0250986_71_583	166
303	3300048909	Ga0496106_0287202	Ga0496106_0287202_212_724	166
304	3300048915	Ga0496112_0120331	Ga0496112_0120331_1246_1773	166
305	3300048915	Ga0496112_0500173	Ga0496112_0500173_439_945	166
306	3300048916	Ga0496113_0487948	Ga0496113_0487948_407_916	166
307	3300048922	Ga0496119_0068632	Ga0496119_0068632_786_1298	166
308	3300048924	Ga0496121_0003465	Ga0496121_0003465_5599_6111	166
309	3300049568	Ga0501031_0000505	Ga0501031_0000505_1535_2083	166
310	3300049570	Ga0501033_0132483	Ga0501033_0132483_121_669	166
311	3300049571	Ga0501034_0187025	Ga0501034_0187025_1286_1801	166
312	3300049572	Ga0501036_0006371	Ga0501036_0006371_70_618	166
313	3300049573	Ga0501037_0020480	Ga0501037_0020480_1037_1585	166
314	3300049574	Ga0501038_0020002	Ga0501038_0020002_2064_2612	166
315	3300049575	Ga0501039_0006473	Ga0501039_0006473_2322_2870	166
316	3300049576	Ga0501040_0095109	Ga0501040_0095109_107_655	166
317	3300049577	Ga0501041_0001684	Ga0501041_0001684_11318_11866	166
318	3300049578	Ga0501042_0003033	Ga0501042_0003033_9403_9951	166
319	3300049579	Ga0501043_0426515	Ga0501043_0426515_197_745	166
320	3300049580	Ga0501046_0005824	Ga0501046_0005824_8941_9489	166
321	3300049584	Ga0501068_0026854	Ga0501068_0026854_1250_1798	166
322	3300049586	Ga0501070_0082910	Ga0501070_0082910_684_1196	166
323	3300049587	Ga0501071_0008779	Ga0501071_0008779_1652_2200	166
324	3300049588	Ga0501072_0041779	Ga0501072_0041779_592_1140	166
325	3300049590	Ga0501074_0112457	Ga0501074_0112457_1307_1855	166
326	3300049591	Ga0501075_0001935	Ga0501075_0001935_702_1250	166
327	3300049592	Ga0501076_0012436	Ga0501076_0012436_3374_3922	166
328	3300049593	Ga0501077_0028245	Ga0501077_0028245_2993_3541	166
329	3300049741	Ga0501079_0091890	Ga0501079_0091890_1397_1945	166
330	3300049742	Ga0501080_0049654	Ga0501080_0049654_2528_3076	166
331	3300049743	Ga0501081_0056942	Ga0501081_0056942_1484_2032	166
332	3300049822	Ga0501035_0057936	Ga0501035_0057936_636_1184	166
333	3300049823	Ga0501044_0568679	Ga0501044_0568679_395_907	166
334	3300049824	Ga0501045_0001268	Ga0501045_0001268_4668_5216	166
335	3300050491	nmdc:mga00v17_151528_c1	nmdc:mga00v17_151528_c1_699_1214	166
336	3300050491	nmdc:mga00v17_491353_c1	nmdc:mga00v17_491353_c1_239_748	166
337	3300050493	nmdc:mga0k408_139313_c1	nmdc:mga0k408_139313_c1_593_1102	166
338	3300050494	nmdc:mga06z11_65458_c1	nmdc:mga06z11_65458_c1_396_902	166
339	3300050508	nmdc:mga09592_83797_c1	nmdc:mga09592_83797_c1_2180_2707	166
340	3300050509	nmdc:mga0qj67_233301_c1	nmdc:mga0qj67_233301_c1_650_1156	166
341	3300050511	nmdc:mga08y16_59780_c1	nmdc:mga08y16_59780_c1_1372_1938	166
342	3300053090	Ga0500646_0000240	Ga0500646_0000240_11602_12111	166
343	3300053126	Ga0500621_168618	Ga0500621_168618_259_765	166
344	3300053139	Ga0500568_0048752	Ga0500568_0048752_689_1195	166
345	3300053153	Ga0500616_0000492	Ga0500616_0000492_38431_38937	166
346	3300054114	Ga0501084_0089122	Ga0501084_0089122_313_861	166
347	3300060353	Ga0501082_0044479	Ga0501082_0044479_1132_1680	166
348	3300061734	Ga0530510_0052787	Ga0530510_0052787_1488_2036	166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

19

182

0.86 PF12867

DinB_2

DinB superfamily

23

173

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8f5v-assembly1.cif.gz_B	crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+	0.9527	4	166
8fx9-assembly1.cif.gz_A-2	crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme	0.9398	4	166
8f5v-assembly1.cif.gz_B	crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+	0.9251	4	166
8fx9-assembly1.cif.gz_A-2	crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme	0.9127	4	166
3cex-assembly1.cif.gz_A	crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis	0.9084	1	163

ID	Description	Score	Start	End	Superfamily
af_O53728_4_171_1.20.120.450	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain	0.9564	4	165	1.20.120.450
af_O53728_4_171_1.20.120.450	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain	0.923	4	165	1.20.120.450
3cexB00	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain	0.915	1	163	1.20.120.450
3cexB00	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain	0.8786	1	163	1.20.120.450
2yqyB00	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain	0.7702	5	159	1.20.120.450

ID	Description	Score	Start	End
AF-A0A1I2FHZ2-F1-model_v4	Uncharacterized damage-inducible protein DinB (Forms a four-helix bundle)	0.99	4	165
AF-A0A316GAE1-F1-model_v4	Putative damage-inducible protein DinB	0.9893	4	166
AF-A0A4P8RD88-F1-model_v4	DinB-like domain-containing protein	0.9891	4	165
AF-A0A010Z2B5-F1-model_v4	DinB-like domain-containing protein	0.9884	1	166
AF-C4RFH8-F1-model_v4	DinB-like domain-containing protein	0.9878	1	165

Feature Viewer

pLDDT	pTM	Quality
96.88	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F417506

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04978

DUF664

Protein of unknown function (DUF664)

19

182

0.86

PF12867

DinB_2

DinB superfamily

23

173

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map