F415334

General Info

Members Datasets Scaffolds Average Seq Length
342 212 300 242

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0005383|Ga0496122_0005383_10324_11118
Length 264
Sequence VSICEKQLVKLVFNKNYLCFMNQNTNKTVLILGANSDVAKQCIKQYVEKGFSVIAASRNTTSLNDFIESNNLDGSKVMVMYFDAADFDSHHEFYSSLSVKPHIVVYAAGFLVDNQKALTDFKGAKQMIEVNYMGGVSILSMIAMDRSNTNLERIIGLSSLSGVRGRKSNFVYGSTKAAFTQFLAGLRQELASRKIIVNALVIGYIRTKINEGLELNESLIMEPDYVAKFIVNAGSSFTIVPNFEWKIIYHILRLLPESLAAKLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
7 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
8 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
9 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
10 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
11 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
12 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
13 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
14 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
15 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
16 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
17 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
18 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
19 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
20 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
21 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
22 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
23 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
24 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
25 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
26 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
27 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
28 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
29 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
30 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
31 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
32 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
33 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
34 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
35 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
36 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
37 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
38 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
39 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
40 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
41 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
42 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
43 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
44 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
45 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
46 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
47 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
193 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
194 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
195 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
196 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
199 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
200 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
212 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.13
Metatranscriptomes 0
Isolates 12.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 7.6
Nodule 0.29
Rhizoplane 0.58
Rhizosphere 73.1
Stem 0
Stem Tuber 0
Unclassified 17.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1389943 2162886007 Bacteria 823
2 SwRhRL2b_contig_753927 2162886007 Bacteria 1279
3 JGI24736J21556_1011898 3300001904 Bacteria 1412
4 JGI24741J21665_1000699 3300001915 Bacteria 10128
5 rootH1_10000428 3300003316 Bacteria 39625
6 rootH2_10006124 3300003320 Bacteria 45135
7 rootH2_10008379 3300003320 Bacteria 3566
8 rootH2_10010920 3300003320 Bacteria 23104
9 rootH2_10020079 3300003320 Bacteria 39210
10 rootH2_10104731 3300003320 Bacteria 11033
11 rootH2_10139933 3300003320 Bacteria 5119
12 rootL2_10000931 3300003322 Bacteria 12413
13 rootL2_10029102 3300003322 Bacteria 14496
14 rootL2_10044184 3300003322 Bacteria 5930
15 rootL2_10050740 3300003322 Bacteria 18783
16 rootL2_10065433 3300003322 Bacteria 23193
17 rootL2_10253090 3300003322 Unclassified 1284
18 rootL2_10293138 3300003322 Bacteria 3660
19 rootH1_10000888 3300003323 Bacteria 41861
20 rootH1_10025715 3300003316 Bacteria 1790
21 rootH1_10025715 3300003323 Bacteria 1550
22 rootH1_10025716 3300003323 Bacteria 14191
23 rootH1_10056533 3300003323 Bacteria 4339
24 rootH1_10075457 3300003323 Bacteria 9626
25 rootH1_10095951 3300003323 Bacteria 1271
26 rootH1_10099913 3300003323 Bacteria 5014
27 rootH1_10112543 3300003316 Bacteria 1213
28 rootH1_10112543 3300003323 Bacteria 2965
29 rootH1_10265201 3300003323 Bacteria 5475
30 JGI25160J50197_1012042 3300003354 Bacteria 3030
31 Ga0055535_1004257 3300003761 Bacteria 3567
32 Ga0055534_1007368 3300003784 Bacteria 2628
33 Ga0055530_10007572 3300003791 Bacteria 4544
34 Ga0065165_1001654 3300005262 Bacteria 22603
35 Ga0065165_1004229 3300005262 Bacteria 9127
36 Ga0065714_10075715 3300005288 Bacteria 2874
37 Ga0065704_10075150 3300005289 Bacteria 5766
38 Ga0065704_10106346 3300005289 Bacteria 2085
39 Ga0065712_10135311 3300005290 Bacteria 1504
40 Ga0070683_100001309 3300005329 Bacteria 18987
41 Ga0070683_100004590 3300005329 Bacteria 11400
42 Ga0070683_100049052 3300005329 Bacteria 3904
43 Ga0070683_101047264 3300005329 Bacteria 783
44 Ga0070670_100016897 3300005331 Bacteria 6264
45 Ga0070670_100594511 3300005331 Bacteria 990
46 Ga0070670_100601169 3300005331 Bacteria 984
47 Ga0070666_10042901 3300005335 Unclassified 3027
48 Ga0070666_10428558 3300005335 Bacteria 953
49 Ga0070682_100000187 3300005337 Bacteria 46443
50 Ga0068868_100065765 3300005338 Bacteria 2881
51 Ga0070660_100041518 3300005339 Bacteria 3507
52 Ga0070691_10008899 3300005341 Bacteria 4596
53 Ga0070661_100065188 3300005344 Unclassified 2677
54 Ga0070668_100040170 3300005347 Bacteria 3580
55 Ga0070668_100362504 3300005347 Bacteria 1229
56 Ga0070671_100140474 3300005355 Unclassified 2038
57 Ga0070673_100378257 3300005364 Bacteria 1262
58 Ga0070673_100685903 3300005364 Bacteria 940
59 Ga0070659_100035764 3300005366 Bacteria 3869
60 Ga0070659_100379492 3300005366 Bacteria 1190
61 Ga0070684_100003969 3300005535 Bacteria 11209
62 Ga0070684_100226852 3300005535 Unclassified 1705
63 Ga0070684_100282632 3300005535 Bacteria 1520
64 Ga0068853_100065775 3300005539 Bacteria 3146
65 Ga0068853_100499499 3300005539 Bacteria 1148
66 Ga0070672_100056265 3300005543 Bacteria 3084
67 Ga0068855_100006583 3300005563 Bacteria 14123
68 Ga0070664_100017474 3300005564 Bacteria 5890
69 Ga0070664_100052182 3300005564 Bacteria 3463
70 Ga0068857_100745738 3300005577 Bacteria 932
71 Ga0068854_100041370 3300005578 Unclassified 3256
72 Ga0068854_100117017 3300005578 Bacteria 2018
73 Ga0068856_100067587 3300005614 Unclassified 3532
74 Ga0068856_100296079 3300005614 Bacteria 1635
75 Ga0068852_100004016 3300005616 Bacteria 10346
76 Ga0068852_100083601 3300005616 Bacteria 2839
77 Ga0068852_100120868 3300005616 Bacteria 2398
78 Ga0068852_100128173 3300005616 Unclassified 2333
79 Ga0068852_100189729 3300005616 Unclassified 1938
80 Ga0068852_100388674 3300005616 Unclassified 1370
81 Ga0068852_100395997 3300005616 Bacteria 1357
82 Ga0068852_100494509 3300005616 Bacteria 1217
83 Ga0068864_100223036 3300005618 Bacteria 1740
84 Ga0068864_100374172 3300005618 Unclassified 1349
85 Ga0068851_10110134 3300005834 Unclassified 1469
86 Ga0068851_10288279 3300005834 Bacteria 941
87 Ga0081540_1002851 3300005983 Bacteria 13999
88 Ga0105244_10000001 3300009036 Bacteria 1034899
89 Ga0105240_10000160 3300009093 Bacteria 137390
90 Ga0105240_10000846 3300009093 Bacteria 55115
91 Ga0105240_10002203 3300009093 Bacteria 31766
92 Ga0105240_10112820 3300009093 Bacteria 3285
93 Ga0105243_10000447 3300009148 Bacteria 43040
94 Ga0105243_10078954 3300009148 Bacteria 2681
95 Ga0105241_10000604 3300009174 Bacteria 27074
96 Ga0105237_10005255 3300009545 Bacteria 14654
97 Ga0105237_10007307 3300009545 Bacteria 12114
98 Ga0105237_10009649 3300009545 Bacteria 10330
99 Ga0105237_10032304 3300009545 Bacteria 5300
100 Ga0105237_10057406 3300009545 Unclassified 3896
101 Ga0105237_10117476 3300009545 Unclassified 2654
102 Ga0105238_10004074 3300009551 Bacteria 14490
103 Ga0105238_10141812 3300009551 Unclassified 2379
104 Ga0105238_10184100 3300009551 Unclassified 2065
105 Ga0105239_10002380 3300010375 Bacteria 23985
106 Ga0105239_10005620 3300010375 Bacteria 14658
107 Ga0105239_10008598 3300010375 Bacteria 11574
108 Ga0105239_10064280 3300010375 Bacteria 4029
109 Ga0105239_10222237 3300010375 Bacteria 2118
110 Ga0105239_10229544 3300010375 Unclassified 2083
111 Ga0157373_10048976 3300013100 Unclassified 3012
112 Ga0157373_10144645 3300013100 Bacteria 1672
113 Ga0157371_10007547 3300013102 Bacteria 8794
114 Ga0157371_10020574 3300013102 Bacteria 4856
115 Ga0157371_10339868 3300013102 Bacteria 1092
116 Ga0157370_10002065 3300013104 Bacteria 24606
117 Ga0157370_10006322 3300013104 Bacteria 13087
118 Ga0157370_10057767 3300013104 Bacteria 3688
119 Ga0157369_10014957 3300013105 Bacteria 8758
120 Ga0157369_10032724 3300013105 Bacteria 5714
121 Ga0157369_10678734 3300013105 Bacteria 1061
122 Ga0157374_10000004 3300013296 Bacteria 759774
123 Ga0157374_10048159 3300013296 Bacteria 3955
124 Ga0157374_10748305 3300013296 Unclassified 992
125 Ga0157378_10072205 3300013297 Unclassified 3101
126 Ga0163162_10536478 3300013306 Bacteria 1299
127 Ga0157372_10001393 3300013307 Bacteria 26053
128 Ga0157372_10001615 3300013307 Bacteria 24488
129 Ga0157372_10048220 3300013307 Bacteria 4735
130 Ga0157372_10052642 3300013307 Bacteria 4534
131 Ga0157372_10119872 3300013307 Bacteria 3020
132 Ga0157372_10128965 3300013307 Unclassified 2909
133 Ga0157372_10135353 3300013307 Bacteria 2837
134 Ga0157372_10146580 3300013307 Bacteria 2722
135 Ga0157372_10192615 3300013307 Bacteria 2361
136 Ga0157372_10235901 3300013307 Bacteria 2122
137 Ga0157372_10595751 3300013307 Bacteria 1288
138 Ga0157372_10674151 3300013307 Bacteria 1204
139 Ga0157375_10001396 3300013308 Bacteria 20834
140 Ga0157375_10413719 3300013308 Bacteria 1515
141 Ga0163163_10006249 3300014325 Bacteria 10395
142 Ga0157377_10055665 3300014745 Unclassified 2243
143 Ga0157376_10094103 3300014969 Bacteria 2603
144 Ga0182006_1000003 3300015261 Bacteria 826681
145 Ga0182007_10043861 3300015262 Bacteria 1485
146 Ga0163161_10096579 3300017792 Bacteria 2193
147 Ga0163161_10132120 3300017792 Bacteria 1884
148 Ga0209258_100156 3300025242 Bacteria 156926
149 Ga0209646_1000009 3300025246 Bacteria 652154
150 Ga0209026_1000133 3300025250 Bacteria 117872
151 Ga0209148_1000427 3300025254 Bacteria 46722
152 Ga0209675_1000059 3300025291 Bacteria 184781
153 Ga0209050_1000526 3300025298 Bacteria 63612
154 Ga0207426_1000104 3300025302 Bacteria 249464
155 Ga0207656_10155283 3300025321 Bacteria 1086
156 Ga0207655_1000018 3300025728 Bacteria 537129
157 Ga0207680_10041823 3300025903 Unclassified 2677
158 Ga0207647_10004322 3300025904 Bacteria 10532
159 Ga0207654_10003906 3300025911 Bacteria 7507
160 Ga0207695_10000027 3300025913 Bacteria 612456
161 Ga0207695_10000076 3300025913 Bacteria 307969
162 Ga0207695_10000090 3300025913 Bacteria 272143
163 Ga0207695_10000687 3300025913 Bacteria 66305
164 Ga0207695_10066895 3300025913 Unclassified 3688
165 Ga0207671_10002245 3300025914 Bacteria 20915
166 Ga0207671_10011030 3300025914 Bacteria 7397
167 Ga0207671_10091124 3300025914 Bacteria 2297
168 Ga0207671_10194543 3300025914 Bacteria 1582
169 Ga0207671_10262566 3300025914 Unclassified 1359
170 Ga0207671_10337662 3300025914 Bacteria 1193
171 Ga0207657_10198317 3300025919 Bacteria 1616
172 Ga0207649_10074767 3300025920 Unclassified 2175
173 Ga0207694_10007575 3300025924 Bacteria 8229
174 Ga0207694_10367104 3300025924 Unclassified 1193
175 Ga0207650_10003309 3300025925 Bacteria 11091
176 Ga0207659_10140425 3300025926 Unclassified 1875
177 Ga0207690_10129896 3300025932 Unclassified 1842
178 Ga0207690_10137465 3300025932 Bacteria 1796
179 Ga0207709_10000691 3300025935 Bacteria 27175
180 Ga0207709_10201231 3300025935 Bacteria 1422
181 Ga0207691_10137235 3300025940 Bacteria 2156
182 Ga0207691_10425439 3300025940 Bacteria 1131
183 Ga0207661_10000698 3300025944 Bacteria 21784
184 Ga0207661_10038967 3300025944 Bacteria 3728
185 Ga0207679_10014970 3300025945 Bacteria 5112
186 Ga0207667_10000431 3300025949 Bacteria 56406
187 Ga0207667_10019665 3300025949 Bacteria 7528
188 Ga0207651_10237455 3300025960 Bacteria 1484
189 Ga0207668_10029624 3300025972 Bacteria 3589
190 Ga0207640_10011001 3300025981 Bacteria 5108
191 Ga0207677_10115506 3300026023 Unclassified 2008
192 Ga0207703_10548312 3300026035 Bacteria 1090
193 Ga0207639_10027849 3300026041 Bacteria 4120
194 Ga0207639_10755309 3300026041 Unclassified 904
195 Ga0207702_10072272 3300026078 Unclassified 2973
196 Ga0207702_10253288 3300026078 Bacteria 1654
197 Ga0207702_10372854 3300026078 Unclassified 1371
198 Ga0207674_10000549 3300026116 Bacteria 49221
199 Ga0207698_10034133 3300026142 Bacteria 3706
200 Ga0207698_10091607 3300026142 Bacteria 2489
201 Ga0207698_10355142 3300026142 Unclassified 1386
202 Ga0209995_1001482 3300027471 Unclassified 3622
203 Ga0209974_10121504 3300027876 Bacteria 926
204 Ga0268266_10000010 3300028379 Bacteria 1030233
205 Ga0268264_10000252 3300028381 Bacteria 99533
206 Ga0307515_10000003 3300028794 Bacteria 891317
207 Ga0307515_10223423 3300028794 Bacteria 1695
208 Ga0307513_10016334 3300031456 Bacteria 8961
209 Ga0307509_10043822 3300031507 Bacteria 4838
210 Ga0307509_10402485 3300031507 Unclassified 1075
211 Ga0307508_10001016 3300031616 Bacteria 32624
212 Ga0307405_10120803 3300031731 Bacteria 1793
213 Ga0307406_10120404 3300031901 Bacteria 1824
214 Ga0307412_10000275 3300031911 Bacteria 32752
215 Ga0307412_10000733 3300031911 Bacteria 18949
216 Ga0307412_10010855 3300031911 Bacteria 5258
217 Ga0307416_100000055 3300032002 Bacteria 107523
218 Ga0307414_10000047 3300032004 Bacteria 132863
219 Ga0307414_10019514 3300032004 Bacteria 4203
220 Ga0307414_10102006 3300032004 Bacteria 2162
221 Ga0307414_10344986 3300032004 Bacteria 1276
222 Ga0307414_10357589 3300032004 Bacteria 1255
223 Ga0307411_10493280 3300032005 Bacteria 1034
224 Ga0307510_10001662 3300033180 Bacteria 24661
225 Ga0395905_0002024 3300037471 Bacteria 23176
226 Ga0395905_0173509 3300037471 Bacteria 2025
227 Ga0439466_0075857 3300041411 Bacteria 1065
228 Ga0439465_0000041 3300041413 Bacteria 26200
229 Ga0439465_0012581 3300041413 Unclassified 2646
230 Ga0439465_0021151 3300041413 Unclassified 2040
231 Ga0439445_0014970 3300042004 Bacteria 1895
232 Ga0466982_0030704 3300044672 Bacteria 3180
233 Ga0466961_0044864 3300044693 Unclassified 2829
234 Ga0466964_0017712 3300044706 Unclassified 2728
235 Ga0466970_0092993 3300044765 Unclassified 1638
236 Ga0466959_0063916 3300045049 Unclassified 2672
237 Ga0495627_000335 3300046453 Bacteria 44545
238 Ga0495638_0250175 3300046460 Bacteria 977
239 Ga0495596_0002798 3300046500 Bacteria 9139
240 Ga0495610_0000006 3300046512 Bacteria 856822
241 Ga0495632_0005544 3300046519 Bacteria 8320
242 Ga0495643_0039768 3300046522 Bacteria 2571
243 Ga0495648_0001413 3300046524 Bacteria 23465
244 Ga0495663_0020538 3300046525 Bacteria 1896
245 Ga0495654_0000044 3300046530 Bacteria 158495
246 Ga0495633_0000569 3300046558 Bacteria 35878
247 Ga0495633_0000761 3300046558 Bacteria 28994
248 Ga0495668_0010720 3300046616 Bacteria 5536
249 Ga0495611_0000015 3300046648 Bacteria 129696
250 Ga0495625_0000987 3300046660 Bacteria 37719
251 Ga0495660_0178481 3300046810 Bacteria 1029
252 Ga0495672_0146960 3300047320 Bacteria 1226
253 Ga0495683_0214968 3300047323 Bacteria 860
254 Ga0495686_0000086 3300047472 Bacteria 197490
255 Ga0495686_0001844 3300047472 Bacteria 21271
256 Ga0495686_0005340 3300047472 Bacteria 10174
257 Ga0496102_0227410 3300048905 Bacteria 1759
258 Ga0496103_0029307 3300048906 Bacteria 3345
259 Ga0496116_0000144 3300048919 Bacteria 148276
260 Ga0496117_0000076 3300048920 Bacteria 232366
261 Ga0496118_0000496 3300048921 Bacteria 65131
262 Ga0496119_0000021 3300048922 Bacteria 277056
263 Ga0496121_0000007 3300048924 Bacteria 942516
264 Ga0496122_0000871 3300048925 Bacteria 56764
265 Ga0496122_0001609 3300048925 Bacteria 35313
266 Ga0496122_0002808 3300048925 Bacteria 23881
267 Ga0496122_0005383 3300048925 Bacteria 15279
268 Ga0496122_0005681 3300048925 Bacteria 14725
269 Ga0496123_0002387 3300048926 Bacteria 23524
270 Ga0496123_0004486 3300048926 Bacteria 14639
271 Ga0496123_0010300 3300048926 Bacteria 8292
272 Ga0496125_0002012 3300048928 Bacteria 27563
273 Ga0496125_0012946 3300048928 Bacteria 8236
274 Ga0496126_0001385 3300048929 Bacteria 38358
275 Ga0501043_0274237 3300049579 Bacteria 1294
276 Ga0501202_012965 3300049652 Bacteria 1581
277 Ga0501217_001652 3300049661 Bacteria 4242
278 Ga0501247_013520 3300049677 Bacteria 1004
279 Ga0501250_008163 3300049680 Bacteria 1148
280 Ga0501251_002013 3300049681 Bacteria 1940
281 Ga0501257_006445 3300049686 Unclassified 2604
282 Ga0501241_002161 3300049758 Bacteria 3841
283 Ga0501241_051316 3300049758 Unclassified 815
284 Ga0501269_003815 3300049766 Bacteria 1814
285 Ga0501271_005922 3300049768 Bacteria 1203
286 Ga0500578_0318789 3300053086 Unclassified 917
287 Ga0500583_0001601 3300053092 Bacteria 6564
288 Ga0500583_0011360 3300053092 Bacteria 3351
289 Ga0500553_073008 3300053101 Bacteria 1570
290 Ga0500562_005256 3300053108 Bacteria 3254
291 Ga0500655_001299 3300053133 Unclassified 4740
292 Ga0500559_0017815 3300053136 Bacteria 3004
293 Ga0500588_0005610 3300053146 Unclassified 2796
294 Ga0500604_0006385 3300053151 Bacteria 3117
295 Ga0500622_0000031 3300053156 Bacteria 207165
296 Ga0500622_0000039 3300053156 Bacteria 170859
297 Ga0500622_0009661 3300053156 Bacteria 5331
298 Ga0500636_0089884 3300053177 Bacteria 1760
299 Ga0500637_0176247 3300053178 Unclassified 1227
300 Ga0500637_0359531 3300053178 Unclassified 771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049681 Ga0501251_002013 Ga0501251_002013_47_637 196
2 3300044706 Ga0466964_0017712 Ga0466964_0017712_23_634 203
3 3300026035 Ga0207703_10548312 Ga0207703_105483121 211
4 3300013307 Ga0157372_10052642 Ga0157372_100526423 214
5 3300005262 Ga0065165_1004229 Ga0065165_100422910 221
6 3300046648 Ga0495611_0000015 Ga0495611_0000015_72282_72950 221
7 3300009545 Ga0105237_10032304 Ga0105237_100323042 226
8 3300025914 Ga0207671_10262566 Ga0207671_102625662 226
9 3300047472 Ga0495686_0000086 Ga0495686_0000086_158564_159277 230
10 3300005539 Ga0068853_100065775 Ga0068853_1000657754 233
11 3300005616 Ga0068852_100083601 Ga0068852_1000836012 233
12 3300010375 Ga0105239_10002380 Ga0105239_1000238015 233
13 3300049758 Ga0501241_051316 Ga0501241_051316_96_797 233
14 3300005335 Ga0070666_10428558 Ga0070666_104285581 234
15 3300026041 Ga0207639_10027849 Ga0207639_100278493 234
16 3300026041 Ga0207639_10755309 Ga0207639_107553091 234
17 3300026142 Ga0207698_10355142 Ga0207698_103551422 234
18 iso_pu_bacteria 2884791551 2884793670 234
19 3300001904 JGI24736J21556_1011898 JGI24736J21556_10118982 236
20 3300005290 Ga0065712_10135311 Ga0065712_101353111 236
21 3300005329 Ga0070683_100004590 Ga0070683_1000045907 236
22 3300005331 Ga0070670_100016897 Ga0070670_1000168972 236
23 3300005331 Ga0070670_100594511 Ga0070670_1005945112 236
24 3300005331 Ga0070670_100601169 Ga0070670_1006011692 236
25 3300005338 Ga0068868_100065765 Ga0068868_1000657651 236
26 3300005344 Ga0070661_100065188 Ga0070661_1000651883 236
27 3300005364 Ga0070673_100378257 Ga0070673_1003782572 236
28 3300005366 Ga0070659_100035764 Ga0070659_1000357644 236
29 3300005366 Ga0070659_100379492 Ga0070659_1003794922 236
30 3300005535 Ga0070684_100282632 Ga0070684_1002826322 236
31 3300005564 Ga0070664_100017474 Ga0070664_1000174745 236
32 3300005564 Ga0070664_100052182 Ga0070664_1000521823 236
33 3300005577 Ga0068857_100745738 Ga0068857_1007457381 236
34 3300005616 Ga0068852_100128173 Ga0068852_1001281733 236
35 3300005616 Ga0068852_100189729 Ga0068852_1001897292 236
36 3300005616 Ga0068852_100395997 Ga0068852_1003959972 236
37 3300005618 Ga0068864_100223036 Ga0068864_1002230362 236
38 3300005834 Ga0068851_10110134 Ga0068851_101101342 236
39 3300009545 Ga0105237_10057406 Ga0105237_100574065 236
40 3300010375 Ga0105239_10005620 Ga0105239_1000562010 236
41 3300013100 Ga0157373_10048976 Ga0157373_100489764 236
42 3300013102 Ga0157371_10007547 Ga0157371_100075474 236
43 3300013102 Ga0157371_10020574 Ga0157371_100205745 236
44 3300013105 Ga0157369_10032724 Ga0157369_100327244 236
45 3300013105 Ga0157369_10678734 Ga0157369_106787342 236
46 3300013296 Ga0157374_10748305 Ga0157374_107483052 236
47 3300013307 Ga0157372_10048220 Ga0157372_100482203 236
48 3300013307 Ga0157372_10119872 Ga0157372_101198723 236
49 3300013307 Ga0157372_10128965 Ga0157372_101289652 236
50 3300013307 Ga0157372_10146580 Ga0157372_101465801 236
51 3300013307 Ga0157372_10235901 Ga0157372_102359012 236
52 3300013307 Ga0157372_10674151 Ga0157372_106741512 236
53 3300014325 Ga0163163_10006249 Ga0163163_100062495 236
54 3300014745 Ga0157377_10055665 Ga0157377_100556653 236
55 3300025904 Ga0207647_10004322 Ga0207647_100043228 236
56 3300025914 Ga0207671_10194543 Ga0207671_101945431 236
57 3300025914 Ga0207671_10337662 Ga0207671_103376622 236
58 3300025920 Ga0207649_10074767 Ga0207649_100747672 236
59 3300025925 Ga0207650_10003309 Ga0207650_100033096 236
60 3300025926 Ga0207659_10140425 Ga0207659_101404252 236
61 3300025932 Ga0207690_10129896 Ga0207690_101298962 236
62 3300025932 Ga0207690_10137465 Ga0207690_101374652 236
63 3300025940 Ga0207691_10425439 Ga0207691_104254392 236
64 3300025945 Ga0207679_10014970 Ga0207679_100149704 236
65 3300025960 Ga0207651_10237455 Ga0207651_102374552 236
66 3300026023 Ga0207677_10115506 Ga0207677_101155062 236
67 3300027471 Ga0209995_1001482 Ga0209995_10014822 236
68 3300027876 Ga0209974_10121504 Ga0209974_101215041 236
69 3300032005 Ga0307411_10493280 Ga0307411_104932801 236
70 3300033180 Ga0307510_10001662 Ga0307510_1000166214 236
71 3300037471 Ga0395905_0002024 Ga0395905_0002024_19882_20613 236
72 3300037471 Ga0395905_0173509 Ga0395905_0173509_794_1525 236
73 3300041413 Ga0439465_0021151 Ga0439465_0021151_203_934 236
74 3300049579 Ga0501043_0274237 Ga0501043_0274237_282_1013 236
75 3300049652 Ga0501202_012965 Ga0501202_012965_700_1431 236
76 3300049680 Ga0501250_008163 Ga0501250_008163_172_903 236
77 iso_pu_bacteria 2929921140 2929924181 236
78 iso_pu_bacteria 8003151029 8003152567 236
79 3300003791 Ga0055530_10007572 Ga0055530_100075722 237
80 3300025298 Ga0209050_1000526 Ga0209050_10005266 237
81 iso_pu_bacteria 2818991460 2819678627 237
82 3300003320 rootH2_10010920 rootH2_100109204 238
83 3300003320 rootH2_10020079 rootH2_100200793 238
84 3300003320 rootH2_10139933 rootH2_101399334 238
85 3300005329 Ga0070683_100049052 Ga0070683_1000490522 238
86 3300005329 Ga0070683_101047264 Ga0070683_1010472641 238
87 3300005341 Ga0070691_10008899 Ga0070691_100088993 238
88 3300005347 Ga0070668_100362504 Ga0070668_1003625041 238
89 3300005535 Ga0070684_100226852 Ga0070684_1002268522 238
90 3300005563 Ga0068855_100006583 Ga0068855_1000065832 238
91 3300005578 Ga0068854_100117017 Ga0068854_1001170173 238
92 3300005614 Ga0068856_100067587 Ga0068856_1000675873 238
93 3300005616 Ga0068852_100120868 Ga0068852_1001208682 238
94 3300005983 Ga0081540_1002851 Ga0081540_10028517 238
95 3300009093 Ga0105240_10000160 Ga0105240_1000016010 238
96 3300009093 Ga0105240_10002203 Ga0105240_100022035 238
97 3300009093 Ga0105240_10112820 Ga0105240_101128203 238
98 3300009545 Ga0105237_10117476 Ga0105237_101174762 238
99 3300009551 Ga0105238_10184100 Ga0105238_101841002 238
100 3300010375 Ga0105239_10008598 Ga0105239_1000859810 238
101 3300010375 Ga0105239_10064280 Ga0105239_100642802 238
102 3300013104 Ga0157370_10057767 Ga0157370_100577673 238
103 3300013296 Ga0157374_10000004 Ga0157374_10000004439 238
104 3300013307 Ga0157372_10001615 Ga0157372_1000161512 238
105 3300013307 Ga0157372_10192615 Ga0157372_101926152 238
106 3300014969 Ga0157376_10094103 Ga0157376_100941033 238
107 3300025913 Ga0207695_10000027 Ga0207695_10000027220 238
108 3300025913 Ga0207695_10000076 Ga0207695_10000076182 238
109 3300025913 Ga0207695_10000090 Ga0207695_10000090180 238
110 3300025924 Ga0207694_10367104 Ga0207694_103671042 238
111 3300025944 Ga0207661_10038967 Ga0207661_100389672 238
112 3300025949 Ga0207667_10019665 Ga0207667_100196656 238
113 3300026078 Ga0207702_10372854 Ga0207702_103728542 238
114 3300026142 Ga0207698_10091607 Ga0207698_100916072 238
115 3300044693 Ga0466961_0044864 Ga0466961_0044864_815_1534 238
116 3300044765 Ga0466970_0092993 Ga0466970_0092993_454_1173 238
117 3300045049 Ga0466959_0063916 Ga0466959_0063916_618_1337 238
118 3300048924 Ga0496121_0000007 Ga0496121_0000007_732428_733147 238
119 3300053178 Ga0500637_0359531 Ga0500637_0359531_33_752 238
120 3300003316 rootH1_10000428 rootH1_1000042835 239
121 3300003322 rootL2_10050740 rootL2_1005074013 239
122 3300003323 rootH1_10000888 rootH1_1000088827 239
123 3300003323 rootH1_10075457 rootH1_100754572 239
124 3300005335 Ga0070666_10042901 Ga0070666_100429014 239
125 3300005539 Ga0068853_100499499 Ga0068853_1004994993 239
126 3300005614 Ga0068856_100296079 Ga0068856_1002960792 239
127 3300005616 Ga0068852_100388674 Ga0068852_1003886742 239
128 3300009093 Ga0105240_10000846 Ga0105240_1000084628 239
129 3300009174 Ga0105241_10000604 Ga0105241_1000060415 239
130 3300009545 Ga0105237_10009649 Ga0105237_100096493 239
131 3300009551 Ga0105238_10004074 Ga0105238_100040743 239
132 3300025903 Ga0207680_10041823 Ga0207680_100418234 239
133 3300025911 Ga0207654_10003906 Ga0207654_100039063 239
134 3300025913 Ga0207695_10000687 Ga0207695_1000068721 239
135 3300025914 Ga0207671_10002245 Ga0207671_100022455 239
136 3300025924 Ga0207694_10007575 Ga0207694_100075755 239
137 3300026078 Ga0207702_10253288 Ga0207702_102532882 239
138 iso_pu_bacteria 2511231000 2511234841 239
139 iso_pu_bacteria 2582581278 2585142245 239
140 iso_pu_bacteria 2582581281 2585156415 239
141 iso_pu_bacteria 2582581282 2585160648 239
142 iso_pu_bacteria 2582581873 2585426598 239
143 iso_pu_bacteria 2585428045 2587678895 239
144 iso_pu_bacteria 2585428060 2587747715 239
145 iso_pu_bacteria 2585428061 2587751608 239
146 iso_pu_bacteria 2585428115 2587941423 239
147 iso_pu_bacteria 2585428182 2588210699 239
148 iso_pu_bacteria 2585428183 2588214064 239
149 iso_pu_bacteria 2585428184 2588221298 239
150 iso_pu_bacteria 2585428185 2588221734 239
151 iso_pu_bacteria 2585428187 2588232577 239
152 iso_pu_bacteria 2588253712 2588443578 239
153 iso_pu_bacteria 2588254255 2590601975 239
154 iso_pu_bacteria 2588254257 2590613824 239
155 iso_pu_bacteria 2728369107 2729200492 239
156 iso_pu_bacteria 2739367874 2740059471 239
157 iso_pu_bacteria 2751185877 2753673527 239
158 iso_pu_bacteria 2765235839 2765574651 239
159 iso_pu_bacteria 2772190705 2772606472 239
160 iso_pu_bacteria 2775506739 2775671573 239
161 iso_pu_bacteria 2816332188 2816874856 239
162 iso_pu_bacteria 2842083920 2842085391 239
163 iso_pu_bacteria 2871720351 2871722385 239
164 iso_pu_bacteria 2889290771 2889294795 239
165 iso_pu_bacteria 2905999023 2906001417 239
166 iso_pu_bacteria 2919097161 2919099600 239
167 iso_pu_bacteria 2919399522 2919402541 239
168 iso_pu_bacteria 2929177148 2929182209 239
169 iso_pu_bacteria 2945924605 2945925675 239
170 iso_pu_bacteria 2945977869 2945978127 239
171 iso_pu_bacteria 2946013367 2946016012 239
172 iso_pu_bacteria 2946019816 2946023082 239
173 iso_pu_bacteria 2977243572 2977244543 239
174 iso_pu_bacteria 2984572630 2984573593 239
175 iso_pu_bacteria 2984606641 2984607036 239
176 iso_pu_bacteria 2993372514 2993375989 239
177 iso_pu_bacteria 2993480792 2993482837 239
178 3300003322 rootL2_10253090 rootL2_102530902 240
179 3300003323 rootH1_10112543 rootH1_101125433 240
180 3300003354 JGI25160J50197_1012042 JGI25160J50197_10120422 240
181 3300010375 Ga0105239_10229544 Ga0105239_102295442 240
182 3300025246 Ga0209646_1000009 Ga0209646_1000009501 240
183 3300025250 Ga0209026_1000133 Ga0209026_100013320 240
184 3300025302 Ga0207426_1000104 Ga0207426_100010459 240
185 3300047320 Ga0495672_0146960 Ga0495672_0146960_231_956 240
186 3300049686 Ga0501257_006445 Ga0501257_006445_1516_2244 240
187 3300053092 Ga0500583_0001601 Ga0500583_0001601_4521_5246 240
188 3300003761 Ga0055535_1004257 Ga0055535_10042572 241
189 3300009545 Ga0105237_10005255 Ga0105237_100052556 241
190 3300013102 Ga0157371_10339868 Ga0157371_103398681 241
191 3300013307 Ga0157372_10595751 Ga0157372_105957512 241
192 3300025242 Ga0209258_100156 Ga0209258_10015643 241
193 3300025254 Ga0209148_1000427 Ga0209148_100042730 241
194 3300025914 Ga0207671_10011030 Ga0207671_100110306 241
195 3300028379 Ga0268266_10000010 Ga0268266_1000001019 241
196 3300028381 Ga0268264_10000252 Ga0268264_1000025232 241
197 3300031731 Ga0307405_10120803 Ga0307405_101208033 241
198 3300031911 Ga0307412_10000733 Ga0307412_1000073315 241
199 3300032004 Ga0307414_10357589 Ga0307414_103575891 241
200 3300041413 Ga0439465_0012581 Ga0439465_0012581_146_874 241
201 3300046524 Ga0495648_0001413 Ga0495648_0001413_3269_3997 241
202 3300047323 Ga0495683_0214968 Ga0495683_0214968_117_845 241
203 3300049758 Ga0501241_002161 Ga0501241_002161_97_822 241
204 3300053086 Ga0500578_0318789 Ga0500578_0318789_128_856 241
205 3300053092 Ga0500583_0011360 Ga0500583_0011360_515_1243 241
206 3300053108 Ga0500562_005256 Ga0500562_005256_2391_3119 241
207 3300053136 Ga0500559_0017815 Ga0500559_0017815_1076_1804 241
208 3300053151 Ga0500604_0006385 Ga0500604_0006385_1445_2173 241
209 3300053156 Ga0500622_0000031 Ga0500622_0000031_37308_38036 241
210 3300053156 Ga0500622_0000039 Ga0500622_0000039_132056_132784 241
211 3300053156 Ga0500622_0009661 Ga0500622_0009661_1967_2695 241
212 3300053177 Ga0500636_0089884 Ga0500636_0089884_426_1154 241
213 3300003320 rootH2_10006124 rootH2_1000612427 242
214 3300003322 rootL2_10000931 rootL2_100009311 242
215 3300003322 rootL2_10065433 rootL2_100654335 242
216 3300003323 rootH1_10095951 rootH1_100959511 242
217 3300003323 rootH1_10099913 rootH1_100999135 242
218 3300005364 Ga0070673_100685903 Ga0070673_1006859031 242
219 3300005616 Ga0068852_100494509 Ga0068852_1004945091 242
220 3300005618 Ga0068864_100374172 Ga0068864_1003741721 242
221 3300013296 Ga0157374_10048159 Ga0157374_100481592 242
222 3300013297 Ga0157378_10072205 Ga0157378_100722052 242
223 3300013306 Ga0163162_10536478 Ga0163162_105364781 242
224 3300013308 Ga0157375_10413719 Ga0157375_104137191 242
225 2162886007 SwRhRL2b_contig_1389943 SwRhRL2b_0547.00000210 243
226 2162886007 SwRhRL2b_contig_753927 SwRhRL2b_0246.00001930 243
227 3300001915 JGI24741J21665_1000699 JGI24741J21665_10006991 243
228 3300003320 rootH2_10008379 rootH2_100083793 243
229 3300003320 rootH2_10104731 rootH2_1010473112 243
230 3300003322 rootL2_10029102 rootL2_100291027 243
231 3300003322 rootL2_10044184 rootL2_100441844 243
232 3300003322 rootL2_10293138 rootL2_102931381 243
233 3300003323 rootH1_10025715 rootH1_100257152 243
234 3300003323 rootH1_10025716 rootH1_100257167 243
235 3300003323 rootH1_10056533 rootH1_100565335 243
236 3300003323 rootH1_10265201 rootH1_102652014 243
237 3300003784 Ga0055534_1007368 Ga0055534_10073684 243
238 3300005262 Ga0065165_1001654 Ga0065165_10016549 243
239 3300005288 Ga0065714_10075715 Ga0065714_100757152 243
240 3300005289 Ga0065704_10075150 Ga0065704_100751506 243
241 3300005289 Ga0065704_10106346 Ga0065704_101063463 243
242 3300005329 Ga0070683_100001309 Ga0070683_10000130911 243
243 3300005337 Ga0070682_100000187 Ga0070682_10000018721 243
244 3300005339 Ga0070660_100041518 Ga0070660_1000415185 243
245 3300005347 Ga0070668_100040170 Ga0070668_1000401704 243
246 3300005355 Ga0070671_100140474 Ga0070671_1001404743 243
247 3300005535 Ga0070684_100003969 Ga0070684_1000039697 243
248 3300005543 Ga0070672_100056265 Ga0070672_1000562652 243
249 3300005578 Ga0068854_100041370 Ga0068854_1000413704 243
250 3300005616 Ga0068852_100004016 Ga0068852_1000040164 243
251 3300005834 Ga0068851_10288279 Ga0068851_102882791 243
252 3300009036 Ga0105244_10000001 Ga0105244_10000001829 243
253 3300009148 Ga0105243_10000447 Ga0105243_1000044734 243
254 3300009148 Ga0105243_10078954 Ga0105243_100789541 243
255 3300009545 Ga0105237_10007307 Ga0105237_100073078 243
256 3300009551 Ga0105238_10141812 Ga0105238_101418123 243
257 3300010375 Ga0105239_10222237 Ga0105239_102222371 243
258 3300013100 Ga0157373_10144645 Ga0157373_101446452 243
259 3300013104 Ga0157370_10002065 Ga0157370_100020654 243
260 3300013104 Ga0157370_10006322 Ga0157370_100063225 243
261 3300013105 Ga0157369_10014957 Ga0157369_100149576 243
262 3300013307 Ga0157372_10001393 Ga0157372_100013933 243
263 3300013307 Ga0157372_10135353 Ga0157372_101353532 243
264 3300013308 Ga0157375_10001396 Ga0157375_1000139618 243
265 3300015261 Ga0182006_1000003 Ga0182006_1000003716 243
266 3300015262 Ga0182007_10043861 Ga0182007_100438612 243
267 3300017792 Ga0163161_10096579 Ga0163161_100965792 243
268 3300017792 Ga0163161_10132120 Ga0163161_101321202 243
269 3300025291 Ga0209675_1000059 Ga0209675_100005937 243
270 3300025321 Ga0207656_10155283 Ga0207656_101552831 243
271 3300025728 Ga0207655_1000018 Ga0207655_1000018358 243
272 3300025913 Ga0207695_10066895 Ga0207695_100668953 243
273 3300025914 Ga0207671_10091124 Ga0207671_100911242 243
274 3300025919 Ga0207657_10198317 Ga0207657_101983171 243
275 3300025935 Ga0207709_10000691 Ga0207709_1000069126 243
276 3300025935 Ga0207709_10201231 Ga0207709_102012313 243
277 3300025940 Ga0207691_10137235 Ga0207691_101372353 243
278 3300025944 Ga0207661_10000698 Ga0207661_1000069816 243
279 3300025949 Ga0207667_10000431 Ga0207667_100004318 243
280 3300025972 Ga0207668_10029624 Ga0207668_100296244 243
281 3300025981 Ga0207640_10011001 Ga0207640_100110014 243
282 3300026078 Ga0207702_10072272 Ga0207702_100722723 243
283 3300026116 Ga0207674_10000549 Ga0207674_1000054932 243
284 3300026142 Ga0207698_10034133 Ga0207698_100341334 243
285 3300028794 Ga0307515_10000003 Ga0307515_10000003430 243
286 3300028794 Ga0307515_10223423 Ga0307515_102234232 243
287 3300031456 Ga0307513_10016334 Ga0307513_100163342 243
288 3300031507 Ga0307509_10043822 Ga0307509_100438224 243
289 3300031507 Ga0307509_10402485 Ga0307509_104024852 243
290 3300031616 Ga0307508_10001016 Ga0307508_100010166 243
291 3300031901 Ga0307406_10120404 Ga0307406_101204042 243
292 3300031911 Ga0307412_10000275 Ga0307412_1000027530 243
293 3300031911 Ga0307412_10010855 Ga0307412_100108555 243
294 3300032002 Ga0307416_100000055 Ga0307416_10000005552 243
295 3300032004 Ga0307414_10000047 Ga0307414_1000004797 243
296 3300032004 Ga0307414_10019514 Ga0307414_100195143 243
297 3300032004 Ga0307414_10102006 Ga0307414_101020062 243
298 3300032004 Ga0307414_10344986 Ga0307414_103449862 243
299 3300041411 Ga0439466_0075857 Ga0439466_0075857_10_741 243
300 3300041413 Ga0439465_0000041 Ga0439465_0000041_23056_23787 243
301 3300042004 Ga0439445_0014970 Ga0439445_0014970_10_744 243
302 3300044672 Ga0466982_0030704 Ga0466982_0030704_1497_2234 243
303 3300046453 Ga0495627_000335 Ga0495627_000335_43583_44314 243
304 3300046460 Ga0495638_0250175 Ga0495638_0250175_131_865 243
305 3300046500 Ga0495596_0002798 Ga0495596_0002798_7363_8097 243
306 3300046512 Ga0495610_0000006 Ga0495610_0000006_86746_87480 243
307 3300046519 Ga0495632_0005544 Ga0495632_0005544_7318_8052 243
308 3300046522 Ga0495643_0039768 Ga0495643_0039768_1573_2307 243
309 3300046525 Ga0495663_0020538 Ga0495663_0020538_1033_1767 243
310 3300046530 Ga0495654_0000044 Ga0495654_0000044_120029_120760 243
311 3300046558 Ga0495633_0000569 Ga0495633_0000569_35002_35733 243
312 3300046558 Ga0495633_0000761 Ga0495633_0000761_9871_10605 243
313 3300046616 Ga0495668_0010720 Ga0495668_0010720_2103_2837 243
314 3300046660 Ga0495625_0000987 Ga0495625_0000987_26525_27259 243
315 3300046810 Ga0495660_0178481 Ga0495660_0178481_62_796 243
316 3300047472 Ga0495686_0001844 Ga0495686_0001844_20239_20973 243
317 3300047472 Ga0495686_0005340 Ga0495686_0005340_9227_9958 243
318 3300048905 Ga0496102_0227410 Ga0496102_0227410_115_849 243
319 3300048906 Ga0496103_0029307 Ga0496103_0029307_95_829 243
320 3300048919 Ga0496116_0000144 Ga0496116_0000144_137833_138567 243
321 3300048920 Ga0496117_0000076 Ga0496117_0000076_93384_94118 243
322 3300048921 Ga0496118_0000496 Ga0496118_0000496_6511_7245 243
323 3300048922 Ga0496119_0000021 Ga0496119_0000021_138274_139008 243
324 3300048925 Ga0496122_0000871 Ga0496122_0000871_131_865 243
325 3300048925 Ga0496122_0001609 Ga0496122_0001609_17027_17761 243
326 3300048925 Ga0496122_0002808 Ga0496122_0002808_19881_20615 243
327 3300048925 Ga0496122_0005383 Ga0496122_0005383_10324_11118 243
328 3300048925 Ga0496122_0005681 Ga0496122_0005681_3792_4526 243
329 3300048926 Ga0496123_0002387 Ga0496123_0002387_12452_13186 243
330 3300048926 Ga0496123_0004486 Ga0496123_0004486_4714_5508 243
331 3300048926 Ga0496123_0010300 Ga0496123_0010300_134_868 243
332 3300048928 Ga0496125_0002012 Ga0496125_0002012_23043_23837 243
333 3300048928 Ga0496125_0012946 Ga0496125_0012946_5600_6334 243
334 3300048929 Ga0496126_0001385 Ga0496126_0001385_22430_23164 243
335 3300049661 Ga0501217_001652 Ga0501217_001652_288_1025 243
336 3300049677 Ga0501247_013520 Ga0501247_013520_37_774 243
337 3300049766 Ga0501269_003815 Ga0501269_003815_857_1588 243
338 3300049768 Ga0501271_005922 Ga0501271_005922_349_1086 243
339 3300053101 Ga0500553_073008 Ga0500553_073008_231_965 243
340 3300053133 Ga0500655_001299 Ga0500655_001299_970_1719 243
341 3300053146 Ga0500588_0005610 Ga0500588_0005610_510_1244 243
342 3300053178 Ga0500637_0176247 Ga0500637_0176247_310_1044 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

218

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

227

0.86

PF08659

KR

KR domain

27

203

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4s-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.8971 6 242
5u4s-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.8935 6 242
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.8918 6 219
5u9p-assembly1.cif.gz_C crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp and tartrate 0.8912 7 226
1fdu-assembly1.cif.gz_B human 17-beta-hydroxysteroid-dehydrogenase type 1 mutant h221l complexed with estradiol and nadp+ 0.891 5 230
ID Description Score Start End Superfamily
af_Q3B7V0_30_291_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9167 5 241 3.40.50.720
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9126 3 36 3.50.50.60
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9061 7 242 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9046 9 242 3.40.50.720
af_Q5M875_26_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9035 6 241 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6H2BF11-F1-model_v4 deleted 0.9966 7 243
AF-A0A3D3K2H3-F1-model_v4 3-oxoacyl-ACP reductase 0.9953 69 243 GO:0016491
AF-A0A3D3K2H3-F1-model_v4 3-oxoacyl-ACP reductase 0.9896 69 243 GO:0016491
AF-A0A6H2BF11-F1-model_v4 deleted 0.9842 7 243
AF-X0TTU9-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9607 8 203 GO:0016491

Feature Viewer

pLDDT pTM Quality
92.33 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map