F415260

General Info

Members Datasets Scaffolds Average Seq Length
342 208 341 193

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0042475|Ga0439465_0042475_106_750
Length 214
Sequence MDFRTAGSVADRGPRRPHRIRPMSSDRINLTNQFLIAMPGMADDTFAGSVVYLCEHTEKGALGLVINKPIDIKLKNLFERIDLSLDSPELAEQPVFFGGPVQTERGFVLHERQGDAERPYNSTLSIPGGLEMTTSKDVLEALSQGAGPKRLLVTLGYSGWGAGQLEEEIGRNGWLTVDATRDVIFDTPIEQRYDRSLGLLGIDPRMLSQEAGHA

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
47 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
136 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
137 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
138 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
178 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
185 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
186 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
203 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
204 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.29
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.45
Nodule 0
Rhizoplane 1.75
Rhizosphere 75.73
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000535 3300002705 Bacteria 21903
2 JGI25156J39149_1024446 3300002705 Bacteria 988
3 JGI25154J39366_1000331 3300002738 Bacteria 27376
4 JGI25157J39369_1000351 3300002741 Bacteria 32381
5 JGI25164J39214_1003999 3300002772 Bacteria 1759
6 rootH1_10065375 3300003316 Bacteria 2809
7 rootH2_10012966 3300003320 Bacteria 2192
8 Ga0055533_1000033 3300003756 Bacteria 265716
9 Ga0055525_1000031 3300003759 Bacteria 314909
10 Ga0055525_1000739 3300003759 Bacteria 11167
11 Ga0055535_1000307 3300003761 Bacteria 49806
12 Ga0055535_1000551 3300003761 Bacteria 32122
13 Ga0055535_1010727 3300003761 Bacteria 1489
14 Ga0055529_1000486 3300003763 Bacteria 36917
15 Ga0065704_10479540 3300005289 Bacteria 683
16 Ga0065707_10094259 3300005295 Bacteria 3520
17 Ga0070658_10035620 3300005327 Bacteria 4009
18 Ga0070658_10611676 3300005327 Bacteria 945
19 Ga0070676_10055450 3300005328 Bacteria 2339
20 Ga0068869_100041868 3300005334 Bacteria 3281
21 Ga0070660_100102917 3300005339 Bacteria 2264
22 Ga0070660_100870483 3300005339 Bacteria 759
23 Ga0070675_100109765 3300005354 Bacteria 2332
24 Ga0070675_100587018 3300005354 Bacteria 1010
25 Ga0070659_100244633 3300005366 Bacteria 1485
26 Ga0070663_100007170 3300005455 Bacteria 6771
27 Ga0070663_100101548 3300005455 Bacteria 2147
28 Ga0070662_100024926 3300005457 Bacteria 4126
29 Ga0070662_100510892 3300005457 Bacteria 1003
30 Ga0068867_100039861 3300005459 Bacteria 3426
31 Ga0068867_100821117 3300005459 Bacteria 831
32 Ga0070672_100123995 3300005543 Bacteria 2117
33 Ga0068855_100202865 3300005563 Bacteria 2232
34 Ga0068855_100355570 3300005563 Bacteria 1613
35 Ga0068854_100146514 3300005578 Bacteria 1817
36 Ga0068856_100001433 3300005614 Bacteria 25021
37 Ga0068856_100150270 3300005614 Bacteria 2338
38 Ga0068852_100003324 3300005616 Bacteria 11227
39 Ga0068852_100108595 3300005616 Bacteria 2518
40 Ga0068852_100165793 3300005616 Bacteria 2067
41 Ga0068863_100347920 3300005841 Bacteria 1443
42 Ga0068858_100265390 3300005842 Bacteria 1633
43 Ga0068860_100191972 3300005843 Bacteria 1977
44 Ga0068862_100007093 3300005844 Bacteria 9307
45 Ga0068862_100686243 3300005844 Bacteria 991
46 Ga0075362_10221852 3300006177 Bacteria 924
47 Ga0075366_10003436 3300006195 Bacteria 8355
48 Ga0075366_10015112 3300006195 Bacteria 4418
49 Ga0075366_10056651 3300006195 Bacteria 2328
50 Ga0075366_10115153 3300006195 Bacteria 1619
51 Ga0075366_10341170 3300006195 Bacteria 919
52 Ga0075370_10002344 3300006353 Bacteria 8755
53 Ga0075370_10024695 3300006353 Bacteria 3322
54 Ga0075430_100016934 3300006846 Bacteria 6208
55 Ga0075430_100138743 3300006846 Bacteria 2025
56 Ga0075429_100000199 3300006880 Bacteria 39995
57 Ga0105240_10010964 3300009093 Bacteria 12693
58 Ga0105240_10097981 3300009093 Bacteria 3572
59 Ga0114129_11261397 3300009147 Bacteria 918
60 Ga0105243_10044920 3300009148 Bacteria 3469
61 Ga0105243_10223599 3300009148 Bacteria 1665
62 Ga0105243_11331935 3300009148 Bacteria 736
63 Ga0105241_10023164 3300009174 Bacteria 4603
64 Ga0105241_10375531 3300009174 Bacteria 1241
65 Ga0105237_10027921 3300009545 Bacteria 5751
66 Ga0105238_10026974 3300009551 Bacteria 5855
67 Ga0105238_10575854 3300009551 Bacteria 1132
68 Ga0105249_10378084 3300009553 Bacteria 1442
69 Ga0105249_10453910 3300009553 Bacteria 1321
70 Ga0105239_10002779 3300010375 Bacteria 21928
71 Ga0105246_10036940 3300011119 Bacteria 3275
72 Ga0105246_10451870 3300011119 Bacteria 1080
73 Ga0157322_1015629 3300012490 Bacteria 678
74 Ga0157326_1017320 3300012513 Bacteria 860
75 Ga0157371_10707584 3300013102 Bacteria 754
76 Ga0157374_10721161 3300013296 Bacteria 1011
77 Ga0157374_10810894 3300013296 Bacteria 952
78 Ga0157378_10030144 3300013297 Bacteria 4792
79 Ga0157378_10509708 3300013297 Bacteria 1203
80 Ga0163162_10208294 3300013306 Bacteria 2085
81 Ga0157372_10444280 3300013307 Bacteria 1512
82 Ga0157372_10545858 3300013307 Bacteria 1351
83 Ga0157380_10495613 3300014326 Bacteria 1185
84 Ga0157377_10000075 3300014745 Bacteria 76405
85 Ga0157379_10026065 3300014968 Bacteria 5201
86 Ga0182006_1138318 3300015261 Bacteria 834
87 Ga0213872_10000068 3300021361 Bacteria 91693
88 Ga0213872_10010308 3300021361 Bacteria 4452
89 Ga0209674_100064 3300025226 Bacteria 265769
90 Ga0209563_100044 3300025230 Bacteria 396812
91 Ga0209563_100099 3300025230 Bacteria 153336
92 Ga0207427_100271 3300025231 Bacteria 39130
93 Ga0209258_100319 3300025242 Bacteria 74569
94 Ga0209258_101161 3300025242 Bacteria 10759
95 Ga0209646_1000060 3300025246 Bacteria 256386
96 Ga0209026_1000049 3300025250 Bacteria 255273
97 Ga0209677_102440 3300025253 Bacteria 6993
98 Ga0209148_1021149 3300025254 Bacteria 1062
99 Ga0209759_1000069 3300025256 Bacteria 182437
100 Ga0209759_1001071 3300025256 Bacteria 17918
101 Ga0209759_1001211 3300025256 Bacteria 15902
102 Ga0209455_1000157 3300025272 Bacteria 119719
103 Ga0209025_1001051 3300025294 Bacteria 40311
104 Ga0209051_1012637 3300025303 Bacteria 4071
105 Ga0207705_10022471 3300025909 Bacteria 4497
106 Ga0207705_10132651 3300025909 Bacteria 1855
107 Ga0207654_10313765 3300025911 Bacteria 1070
108 Ga0207695_10091766 3300025913 Bacteria 3050
109 Ga0207671_10003822 3300025914 Bacteria 14736
110 Ga0207671_10066390 3300025914 Bacteria 2685
111 Ga0207657_10021437 3300025919 Bacteria 6080
112 Ga0207657_10193521 3300025919 Bacteria 1639
113 Ga0207657_10893151 3300025919 Bacteria 685
114 Ga0207681_10934067 3300025923 Bacteria 727
115 Ga0207694_10011860 3300025924 Bacteria 6572
116 Ga0207694_10452732 3300025924 Bacteria 1072
117 Ga0207690_10072812 3300025932 Bacteria 2374
118 Ga0207706_10012036 3300025933 Bacteria 7882
119 Ga0207709_10023156 3300025935 Bacteria 3532
120 Ga0207709_10035726 3300025935 Bacteria 2940
121 Ga0207709_10258127 3300025935 Bacteria 1276
122 Ga0207691_10181558 3300025940 Bacteria 1839
123 Ga0207689_10079241 3300025942 Bacteria 2700
124 Ga0207661_10063437 3300025944 Bacteria 2993
125 Ga0207651_10032285 3300025960 Bacteria 3361
126 Ga0207640_10264549 3300025981 Bacteria 1342
127 Ga0207639_10026908 3300026041 Bacteria 4183
128 Ga0207678_10000693 3300026067 Bacteria 30761
129 Ga0207702_10015101 3300026078 Bacteria 6403
130 Ga0207702_10184511 3300026078 Bacteria 1923
131 Ga0207648_10000286 3300026089 Bacteria 54985
132 Ga0207648_10616060 3300026089 Bacteria 1001
133 Ga0207675_100278224 3300026118 Bacteria 1625
134 Ga0207683_10442263 3300026121 Bacteria 1198
135 Ga0207698_10002857 3300026142 Bacteria 10327
136 Ga0207698_10071669 3300026142 Bacteria 2750
137 Ga0207698_10140013 3300026142 Bacteria 2083
138 Ga0207698_10487873 3300026142 Bacteria 1196
139 Ga0268266_10863475 3300028379 Bacteria 875
140 Ga0268265_10428876 3300028380 Bacteria 1229
141 Ga0268265_11657632 3300028380 Bacteria 645
142 Ga0268264_10321076 3300028381 Bacteria 1464
143 Ga0265334_10074212 3300028573 Bacteria 1263
144 Ga0265336_10000040 3300028666 Bacteria 138266
145 Ga0307517_10118447 3300028786 Bacteria 1971
146 Ga0307515_10000062 3300028794 Bacteria 247284
147 Ga0307515_10000080 3300028794 Bacteria 224941
148 Ga0307515_10030743 3300028794 Bacteria 8998
149 Ga0307515_10099162 3300028794 Bacteria 3540
150 Ga0307515_10184377 3300028794 Bacteria 2023
151 Ga0307515_10213448 3300028794 Bacteria 1767
152 Ga0307515_10470474 3300028794 Bacteria 870
153 Ga0265324_10001184 3300029957 Bacteria 15538
154 Ga0265331_10022196 3300031250 Bacteria 3240
155 Ga0265327_10000042 3300031251 Bacteria 287487
156 Ga0265327_10134055 3300031251 Bacteria 1163
157 Ga0307513_10002016 3300031456 Bacteria 28599
158 Ga0307509_10000871 3300031507 Bacteria 52060
159 Ga0307509_10253363 3300031507 Bacteria 1542
160 Ga0307509_10284411 3300031507 Bacteria 1412
161 Ga0307408_100078780 3300031548 Bacteria 2457
162 Ga0307408_100110260 3300031548 Bacteria 2113
163 Ga0307408_100191965 3300031548 Bacteria 1646
164 Ga0307408_100371529 3300031548 Bacteria 1220
165 Ga0307408_100519919 3300031548 Bacteria 1045
166 Ga0307514_10253029 3300031649 Bacteria 1040
167 Ga0307516_10000127 3300031730 Bacteria 90180
168 Ga0307516_10000674 3300031730 Bacteria 46280
169 Ga0307516_10003164 3300031730 Bacteria 21417
170 Ga0307405_10192950 3300031731 Bacteria 1473
171 Ga0307413_10096914 3300031824 Bacteria 1938
172 Ga0307413_10556443 3300031824 Bacteria 931
173 Ga0307413_10647253 3300031824 Bacteria 871
174 Ga0307410_10658056 3300031852 Bacteria 879
175 Ga0307406_10413105 3300031901 Bacteria 1073
176 Ga0307407_10263205 3300031903 Bacteria 1187
177 Ga0307412_10123090 3300031911 Bacteria 1871
178 Ga0307412_10257157 3300031911 Bacteria 1359
179 Ga0307412_10340658 3300031911 Bacteria 1200
180 Ga0307409_100163327 3300031995 Bacteria 1951
181 Ga0307416_100228174 3300032002 Bacteria 1793
182 Ga0307416_100519229 3300032002 Bacteria 1259
183 Ga0307414_10994910 3300032004 Bacteria 772
184 Ga0307510_10053936 3300033180 Bacteria 4218
185 Ga0373931_0033371 3300035691 Bacteria 2667
186 Ga0373931_0061525 3300035691 Bacteria 2025
187 Ga0373931_0232642 3300035691 Bacteria 1114
188 Ga0373925_0325140 3300037068 Bacteria 1245
189 Ga0395900_0000058 3300037418 Bacteria 206785
190 Ga0395898_0016745 3300037466 Bacteria 7491
191 Ga0395898_0271241 3300037466 Bacteria 1618
192 Ga0395905_0008270 3300037471 Bacteria 10274
193 Ga0395905_0013060 3300037471 Bacteria 7976
194 Ga0395905_0021987 3300037471 Bacteria 6033
195 Ga0395905_0221873 3300037471 Bacteria 1769
196 Ga0395901_0012799 3300038443 Bacteria 8508
197 Ga0436360_0092983 3300039438 Bacteria 807
198 Ga0436361_0019641 3300039447 Bacteria 127735
199 Ga0436361_0305612 3300039447 Bacteria 2589
200 Ga0436361_0858281 3300039447 Bacteria 2382
201 Ga0436361_0882397 3300039447 Bacteria 35518
202 Ga0436361_0960381 3300039447 Bacteria 2708
203 Ga0436361_1162527 3300039447 Bacteria 9362
204 Ga0436363_0469087 3300039450 Bacteria 797
205 Ga0439461_0078878 3300041410 Bacteria 774
206 Ga0439466_0124676 3300041411 Bacteria 794
207 Ga0439465_0042475 3300041413 Bacteria 1473
208 Ga0451802_0393113 3300041460 Bacteria 1694
209 Ga0451807_2352941 3300041486 Bacteria 2398
210 Ga0439431_0002680 3300041997 Bacteria 3922
211 Ga0439445_0036967 3300042004 Bacteria 1287
212 Ga0439449_0057019 3300042007 Bacteria 1442
213 Ga0439455_0079560 3300042012 Bacteria 889
214 Ga0439457_020294 3300042014 Bacteria 1475
215 Ga0450888_005634 3300042126 Bacteria 1341
216 Ga0450890_025092 3300042127 Bacteria 826
217 Ga0450898_015314 3300042134 Bacteria 1298
218 Ga0450898_068834 3300042134 Bacteria 706
219 Ga0439446_0004810 3300042156 Bacteria 3442
220 Ga0450893_0012708 3300042532 Bacteria 1399
221 Ga0450893_0055976 3300042532 Bacteria 746
222 Ga0451577_0001500 3300042876 Bacteria 30862
223 Ga0451577_0004058 3300042876 Bacteria 15735
224 Ga0451577_0096242 3300042876 Bacteria 2643
225 Ga0451577_0138731 3300042876 Bacteria 2184
226 Ga0451577_1231672 3300042876 Bacteria 667
227 Ga0466969_0000013 3300044656 Bacteria 111537
228 Ga0466969_0001590 3300044656 Bacteria 12153
229 Ga0466969_0025967 3300044656 Bacteria 3007
230 Ga0466969_0127655 3300044656 Bacteria 1180
231 Ga0466972_0001525 3300044658 Bacteria 11286
232 Ga0466972_0009928 3300044658 Bacteria 4778
233 Ga0466965_0001256 3300044683 Bacteria 10063
234 Ga0466965_0040261 3300044683 Bacteria 2300
235 Ga0466965_0050202 3300044683 Bacteria 2068
236 Ga0466965_0091336 3300044683 Bacteria 1549
237 Ga0466966_0031511 3300044684 Bacteria 3437
238 Ga0466966_0036978 3300044684 Bacteria 3150
239 Ga0466966_0058159 3300044684 Bacteria 2444
240 Ga0466966_0063470 3300044684 Bacteria 2327
241 Ga0466961_0003542 3300044693 Bacteria 9743
242 Ga0466961_0006151 3300044693 Bacteria 7618
243 Ga0466961_0055185 3300044693 Bacteria 2533
244 Ga0466963_0047955 3300044694 Bacteria 2820
245 Ga0466963_0318247 3300044694 Bacteria 1095
246 Ga0466964_0025739 3300044706 Bacteria 2299
247 Ga0466964_0041917 3300044706 Bacteria 1853
248 Ga0466964_0115810 3300044706 Bacteria 1201
249 Ga0453684_0043091 3300044712 Bacteria 6072
250 Ga0453684_0099514 3300044712 Bacteria 3562
251 Ga0453684_0250783 3300044712 Bacteria 2033
252 Ga0453684_0389185 3300044712 Bacteria 1564
253 Ga0466971_0010152 3300044719 Bacteria 4112
254 Ga0466971_0012877 3300044719 Bacteria 3668
255 Ga0466971_0030482 3300044719 Bacteria 2413
256 Ga0466971_0043703 3300044719 Bacteria 2013
257 Ga0466970_0075178 3300044765 Bacteria 1819
258 Ga0466970_0075262 3300044765 Bacteria 1818
259 Ga0466957_0005110 3300044842 Bacteria 7331
260 Ga0466957_0103131 3300044842 Bacteria 1800
261 Ga0466960_0037999 3300044901 Bacteria 2261
262 Ga0466960_0663505 3300044901 Bacteria 623
263 Ga0466959_0000491 3300045049 Bacteria 23088
264 Ga0466959_0017402 3300045049 Bacteria 5268
265 Ga0466959_0119442 3300045049 Bacteria 1875
266 Ga0451576_0006424 3300045051 Bacteria 14417
267 Ga0451576_0142394 3300045051 Bacteria 2500
268 Ga0451576_0580827 3300045051 Bacteria 1178
269 Ga0451576_1076805 3300045051 Bacteria 841
270 Ga0451576_1146343 3300045051 Bacteria 813
271 Ga0466958_0032324 3300045836 Bacteria 3112
272 Ga0466958_0045654 3300045836 Bacteria 2643
273 Ga0466958_0421118 3300045836 Bacteria 863
274 Ga0466967_0015124 3300045976 Bacteria 6041
275 Ga0466967_0018595 3300045976 Bacteria 5559
276 Ga0466967_1791020 3300045976 Bacteria 611
277 Ga0495651_0146477 3300046462 Bacteria 1707
278 Ga0495650_0002544 3300046471 Bacteria 14530
279 Ga0495650_0017791 3300046471 Bacteria 3553
280 Ga0495639_0144121 3300046475 Bacteria 1146
281 Ga0495583_0000046 3300046506 Bacteria 218059
282 Ga0495606_0002937 3300046507 Bacteria 18821
283 Ga0495608_0190697 3300046511 Bacteria 1294
284 Ga0495628_0286549 3300046516 Bacteria 1222
285 Ga0495628_0420762 3300046516 Bacteria 974
286 Ga0495668_0033574 3300046616 Bacteria 2882
287 Ga0495625_0036217 3300046660 Bacteria 3629
288 Ga0495669_0071236 3300046684 Bacteria 1585
289 Ga0495649_0000709 3300046694 Bacteria 27174
290 Ga0495649_0325614 3300046694 Bacteria 779
291 Ga0495589_0009929 3300046794 Bacteria 4945
292 Ga0495676_0088584 3300047321 Bacteria 2321
293 Ga0495686_0005518 3300047472 Bacteria 9951
294 Ga0496105_0172301 3300048908 Bacteria 1774
295 Ga0496106_1018043 3300048909 Bacteria 651
296 Ga0496107_0432743 3300048910 Bacteria 978
297 Ga0496107_0753219 3300048910 Bacteria 715
298 Ga0496121_0002991 3300048924 Bacteria 24547
299 Ga0501308_021987 3300049128 Bacteria 804
300 Ga0501290_046343 3300049513 Bacteria 666
301 Ga0501299_037466 3300049522 Bacteria 960
302 Ga0501034_0004719 3300049571 Bacteria 15087
303 Ga0501034_0040051 3300049571 Bacteria 4745
304 Ga0501043_0000009 3300049579 Bacteria 214823
305 Ga0501046_0000022 3300049580 Bacteria 215451
306 Ga0501047_0000021 3300049581 Bacteria 254841
307 Ga0501048_0000909 3300049582 Bacteria 21828
308 Ga0501198_000001 3300049649 Bacteria 234552
309 Ga0501222_000004 3300049662 Bacteria 136139
310 Ga0501248_031706 3300049678 Bacteria 606
311 Ga0501225_0105983 3300049705 Bacteria 825
312 Ga0501079_0442132 3300049741 Bacteria 1021
313 Ga0501035_0977904 3300049822 Bacteria 666
314 Ga0501045_0030356 3300049824 Bacteria 3912
315 nmdc:mga03683_527831_c1 3300050489 Bacteria 573
316 nmdc:mga0k408_126406_c1 3300050493 Bacteria 1517
317 nmdc:mga0k408_44972_c1 3300050493 Bacteria 2547
318 nmdc:mga0k408_598944_c1 3300050493 Bacteria 650
319 nmdc:mga0k408_62527_c1 3300050493 Bacteria 2165
320 nmdc:mga07m45_1390_c1 3300050496 Bacteria 11048
321 nmdc:mga07m45_362703_c1 3300050496 Bacteria 842
322 nmdc:mga07m45_5529_c2 3300050496 Bacteria 2130
323 nmdc:mga05p37_414724_c1 3300050507 Bacteria 1569
324 nmdc:mga09592_13275_c1 3300050508 Bacteria 6726
325 nmdc:mga0qj67_10758_c1 3300050509 Bacteria 6841
326 nmdc:mga0qj67_294362_c1 3300050509 Bacteria 1315
327 Ga0500635_0000213 3300053080 Bacteria 28019
328 Ga0500643_064183 3300053087 Bacteria 1027
329 Ga0500651_0163900 3300053093 Bacteria 1328
330 Ga0500651_0240300 3300053093 Bacteria 1056
331 Ga0500597_219927 3300053120 Bacteria 790
332 Ga0500559_0011332 3300053136 Bacteria 3809
333 Ga0500564_109266 3300053138 Bacteria 1215
334 Ga0500589_056996 3300053147 Bacteria 1800
335 Ga0500590_047124 3300053148 Bacteria 2201
336 Ga0500636_0054380 3300053177 Bacteria 2346
337 Ga0500637_0420935 3300053178 Bacteria 687
338 Ga0590071_014622 3300059421 Bacteria 1841
339 Ga0466962_0011123 3300061719 Bacteria 4331
340 Ga0466962_0035303 3300061719 Bacteria 2393
341 Ga0466962_0056183 3300061719 Bacteria 1880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_1791020 Ga0466967_1791020_53_577 173
2 3300050489 nmdc:mga03683_527831_c1 nmdc:mga03683_527831_c1_23_559 174
3 3300045051 Ga0451576_1146343 Ga0451576_1146343_262_795 176
4 3300039447 Ga0436361_1162527 Ga0436361_1162527_586_1164 183
5 3300039438 Ga0436360_0092983 Ga0436360_0092983_145_720 184
6 3300039447 Ga0436361_0305612 Ga0436361_0305612_138_716 184
7 3300006846 Ga0075430_100016934 Ga0075430_1000169343 186
8 3300006880 Ga0075429_100000199 Ga0075429_1000001997 186
9 3300031548 Ga0307408_100110260 Ga0307408_1001102602 186
10 3300045051 Ga0451576_1076805 Ga0451576_1076805_57_617 186
11 3300049522 Ga0501299_037466 Ga0501299_037466_315_878 186
12 iso_pu_bacteria 2643221654 2644303016 186
13 3300025294 Ga0209025_1001051 Ga0209025_100105123 188
14 3300046694 Ga0495649_0325614 Ga0495649_0325614_92_673 188
15 3300049571 Ga0501034_0004719 Ga0501034_0004719_1481_2062 188
16 3300005842 Ga0068858_100265390 Ga0068858_1002653903 189
17 3300005843 Ga0068860_100191972 Ga0068860_1001919722 189
18 3300005844 Ga0068862_100686243 Ga0068862_1006862431 189
19 3300006195 Ga0075366_10341170 Ga0075366_103411701 189
20 3300011119 Ga0105246_10451870 Ga0105246_104518702 189
21 3300014968 Ga0157379_10026065 Ga0157379_100260654 189
22 3300028379 Ga0268266_10863475 Ga0268266_108634752 189
23 3300037471 Ga0395905_0013060 Ga0395905_0013060_1506_2081 189
24 3300041410 Ga0439461_0078878 Ga0439461_0078878_137_715 189
25 3300044656 Ga0466969_0025967 Ga0466969_0025967_2355_2924 189
26 3300044683 Ga0466965_0001256 Ga0466965_0001256_4179_4748 189
27 3300044684 Ga0466966_0063470 Ga0466966_0063470_931_1500 189
28 3300044693 Ga0466961_0055185 Ga0466961_0055185_1889_2458 189
29 3300044706 Ga0466964_0041917 Ga0466964_0041917_1209_1778 189
30 3300044719 Ga0466971_0012877 Ga0466971_0012877_933_1502 189
31 3300044842 Ga0466957_0005110 Ga0466957_0005110_4701_5270 189
32 3300045049 Ga0466959_0017402 Ga0466959_0017402_3279_3848 189
33 3300045836 Ga0466958_0032324 Ga0466958_0032324_354_923 189
34 3300045976 Ga0466967_0015124 Ga0466967_0015124_4365_4934 189
35 3300050493 nmdc:mga0k408_598944_c1 nmdc:mga0k408_598944_c1_29_601 189
36 3300061719 Ga0466962_0035303 Ga0466962_0035303_1365_1934 189
37 3300005289 Ga0065704_10479540 Ga0065704_104795401 190
38 3300005295 Ga0065707_10094259 Ga0065707_100942593 190
39 3300005457 Ga0070662_100510892 Ga0070662_1005108922 190
40 3300005459 Ga0068867_100039861 Ga0068867_1000398613 190
41 3300005614 Ga0068856_100150270 Ga0068856_1001502704 190
42 3300005844 Ga0068862_100007093 Ga0068862_1000070937 190
43 3300006195 Ga0075366_10003436 Ga0075366_100034364 190
44 3300006195 Ga0075366_10015112 Ga0075366_100151121 190
45 3300009148 Ga0105243_10044920 Ga0105243_100449202 190
46 3300009551 Ga0105238_10575854 Ga0105238_105758542 190
47 3300009553 Ga0105249_10378084 Ga0105249_103780841 190
48 3300013306 Ga0163162_10208294 Ga0163162_102082942 190
49 3300013307 Ga0157372_10545858 Ga0157372_105458582 190
50 3300025924 Ga0207694_10452732 Ga0207694_104527322 190
51 3300026078 Ga0207702_10184511 Ga0207702_101845114 190
52 3300026089 Ga0207648_10616060 Ga0207648_106160602 190
53 3300026121 Ga0207683_10442263 Ga0207683_104422632 190
54 3300028380 Ga0268265_10428876 Ga0268265_104288762 190
55 3300028794 Ga0307515_10000062 Ga0307515_1000006219 190
56 3300028794 Ga0307515_10000080 Ga0307515_1000008053 190
57 3300028794 Ga0307515_10184377 Ga0307515_101843772 190
58 3300031456 Ga0307513_10002016 Ga0307513_100020163 190
59 3300031824 Ga0307413_10096914 Ga0307413_100969142 190
60 3300032002 Ga0307416_100228174 Ga0307416_1002281742 190
61 3300041411 Ga0439466_0124676 Ga0439466_0124676_21_614 190
62 3300042127 Ga0450890_025092 Ga0450890_025092_89_670 190
63 3300042134 Ga0450898_068834 Ga0450898_068834_30_623 190
64 3300042876 Ga0451577_0096242 Ga0451577_0096242_439_1017 190
65 3300042876 Ga0451577_1231672 Ga0451577_1231672_50_640 190
66 3300044656 Ga0466969_0001590 Ga0466969_0001590_7647_8225 190
67 3300044683 Ga0466965_0040261 Ga0466965_0040261_1120_1698 190
68 3300044684 Ga0466966_0058159 Ga0466966_0058159_565_1152 190
69 3300044693 Ga0466961_0003542 Ga0466961_0003542_8009_8587 190
70 3300044706 Ga0466964_0115810 Ga0466964_0115810_171_749 190
71 3300044712 Ga0453684_0250783 Ga0453684_0250783_1092_1670 190
72 3300044719 Ga0466971_0010152 Ga0466971_0010152_1649_2236 190
73 3300044901 Ga0466960_0037999 Ga0466960_0037999_813_1388 190
74 3300045049 Ga0466959_0119442 Ga0466959_0119442_445_1023 190
75 3300045051 Ga0451576_0006424 Ga0451576_0006424_973_1563 190
76 3300045051 Ga0451576_0580827 Ga0451576_0580827_465_1040 190
77 3300045836 Ga0466958_0421118 Ga0466958_0421118_109_696 190
78 3300048910 Ga0496107_0432743 Ga0496107_0432743_386_961 190
79 3300049649 Ga0501198_000001 Ga0501198_000001_63881_64456 190
80 3300049662 Ga0501222_000004 Ga0501222_000004_52857_53432 190
81 3300049741 Ga0501079_0442132 Ga0501079_0442132_121_699 190
82 3300050493 nmdc:mga0k408_126406_c1 nmdc:mga0k408_126406_c1_549_1127 190
83 3300061719 Ga0466962_0011123 Ga0466962_0011123_3375_3953 190
84 3300002705 JGI25156J39149_1000535 JGI25156J39149_100053510 191
85 3300002705 JGI25156J39149_1024446 JGI25156J39149_10244462 191
86 3300002738 JGI25154J39366_1000331 JGI25154J39366_100033110 191
87 3300002741 JGI25157J39369_1000351 JGI25157J39369_100035122 191
88 3300002772 JGI25164J39214_1003999 JGI25164J39214_10039992 191
89 3300003316 rootH1_10065375 rootH1_100653751 191
90 3300003320 rootH2_10012966 rootH2_100129663 191
91 3300003756 Ga0055533_1000033 Ga0055533_1000033169 191
92 3300003759 Ga0055525_1000031 Ga0055525_1000031136 191
93 3300003759 Ga0055525_1000739 Ga0055525_10007395 191
94 3300003761 Ga0055535_1000307 Ga0055535_10003077 191
95 3300003761 Ga0055535_1000551 Ga0055535_10005518 191
96 3300003761 Ga0055535_1010727 Ga0055535_10107272 191
97 3300003763 Ga0055529_1000486 Ga0055529_100048632 191
98 3300005327 Ga0070658_10035620 Ga0070658_100356204 191
99 3300005327 Ga0070658_10611676 Ga0070658_106116762 191
100 3300005328 Ga0070676_10055450 Ga0070676_100554501 191
101 3300005334 Ga0068869_100041868 Ga0068869_1000418685 191
102 3300005339 Ga0070660_100102917 Ga0070660_1001029172 191
103 3300005339 Ga0070660_100870483 Ga0070660_1008704831 191
104 3300005354 Ga0070675_100109765 Ga0070675_1001097653 191
105 3300005354 Ga0070675_100587018 Ga0070675_1005870182 191
106 3300005366 Ga0070659_100244633 Ga0070659_1002446332 191
107 3300005455 Ga0070663_100007170 Ga0070663_1000071702 191
108 3300005455 Ga0070663_100101548 Ga0070663_1001015482 191
109 3300005457 Ga0070662_100024926 Ga0070662_1000249265 191
110 3300005459 Ga0068867_100821117 Ga0068867_1008211172 191
111 3300005543 Ga0070672_100123995 Ga0070672_1001239953 191
112 3300005563 Ga0068855_100202865 Ga0068855_1002028652 191
113 3300005563 Ga0068855_100355570 Ga0068855_1003555702 191
114 3300005578 Ga0068854_100146514 Ga0068854_1001465143 191
115 3300005614 Ga0068856_100001433 Ga0068856_10000143315 191
116 3300005616 Ga0068852_100003324 Ga0068852_1000033244 191
117 3300005616 Ga0068852_100108595 Ga0068852_1001085952 191
118 3300005616 Ga0068852_100165793 Ga0068852_1001657933 191
119 3300005841 Ga0068863_100347920 Ga0068863_1003479203 191
120 3300006177 Ga0075362_10221852 Ga0075362_102218522 191
121 3300006195 Ga0075366_10056651 Ga0075366_100566512 191
122 3300006195 Ga0075366_10115153 Ga0075366_101151532 191
123 3300006353 Ga0075370_10002344 Ga0075370_1000234411 191
124 3300006353 Ga0075370_10024695 Ga0075370_100246955 191
125 3300006846 Ga0075430_100138743 Ga0075430_1001387432 191
126 3300009093 Ga0105240_10010964 Ga0105240_100109643 191
127 3300009093 Ga0105240_10097981 Ga0105240_100979812 191
128 3300009147 Ga0114129_11261397 Ga0114129_112613972 191
129 3300009148 Ga0105243_10223599 Ga0105243_102235992 191
130 3300009148 Ga0105243_11331935 Ga0105243_113319351 191
131 3300009174 Ga0105241_10023164 Ga0105241_100231642 191
132 3300009174 Ga0105241_10375531 Ga0105241_103755311 191
133 3300009545 Ga0105237_10027921 Ga0105237_100279212 191
134 3300009551 Ga0105238_10026974 Ga0105238_100269742 191
135 3300009553 Ga0105249_10453910 Ga0105249_104539103 191
136 3300010375 Ga0105239_10002779 Ga0105239_100027797 191
137 3300011119 Ga0105246_10036940 Ga0105246_100369406 191
138 3300012490 Ga0157322_1015629 Ga0157322_10156291 191
139 3300012513 Ga0157326_1017320 Ga0157326_10173201 191
140 3300013102 Ga0157371_10707584 Ga0157371_107075841 191
141 3300013296 Ga0157374_10721161 Ga0157374_107211612 191
142 3300013296 Ga0157374_10810894 Ga0157374_108108942 191
143 3300013297 Ga0157378_10030144 Ga0157378_100301442 191
144 3300013297 Ga0157378_10509708 Ga0157378_105097082 191
145 3300013307 Ga0157372_10444280 Ga0157372_104442801 191
146 3300014326 Ga0157380_10495613 Ga0157380_104956132 191
147 3300014745 Ga0157377_10000075 Ga0157377_1000007568 191
148 3300015261 Ga0182006_1138318 Ga0182006_11383182 191
149 3300021361 Ga0213872_10000068 Ga0213872_1000006856 191
150 3300021361 Ga0213872_10010308 Ga0213872_100103086 191
151 3300025226 Ga0209674_100064 Ga0209674_10006479 191
152 3300025230 Ga0209563_100044 Ga0209563_100044205 191
153 3300025230 Ga0209563_100099 Ga0209563_10009979 191
154 3300025231 Ga0207427_100271 Ga0207427_10027120 191
155 3300025242 Ga0209258_100319 Ga0209258_10031932 191
156 3300025242 Ga0209258_101161 Ga0209258_10116113 191
157 3300025246 Ga0209646_1000060 Ga0209646_1000060164 191
158 3300025250 Ga0209026_1000049 Ga0209026_1000049162 191
159 3300025253 Ga0209677_102440 Ga0209677_1024404 191
160 3300025254 Ga0209148_1021149 Ga0209148_10211491 191
161 3300025256 Ga0209759_1000069 Ga0209759_1000069162 191
162 3300025256 Ga0209759_1001071 Ga0209759_100107110 191
163 3300025256 Ga0209759_1001211 Ga0209759_10012116 191
164 3300025272 Ga0209455_1000157 Ga0209455_100015771 191
165 3300025303 Ga0209051_1012637 Ga0209051_10126373 191
166 3300025909 Ga0207705_10022471 Ga0207705_100224712 191
167 3300025909 Ga0207705_10132651 Ga0207705_101326512 191
168 3300025911 Ga0207654_10313765 Ga0207654_103137652 191
169 3300025913 Ga0207695_10091766 Ga0207695_100917663 191
170 3300025914 Ga0207671_10003822 Ga0207671_1000382210 191
171 3300025914 Ga0207671_10066390 Ga0207671_100663902 191
172 3300025919 Ga0207657_10021437 Ga0207657_100214375 191
173 3300025919 Ga0207657_10193521 Ga0207657_101935213 191
174 3300025919 Ga0207657_10893151 Ga0207657_108931511 191
175 3300025923 Ga0207681_10934067 Ga0207681_109340671 191
176 3300025924 Ga0207694_10011860 Ga0207694_100118606 191
177 3300025932 Ga0207690_10072812 Ga0207690_100728122 191
178 3300025933 Ga0207706_10012036 Ga0207706_100120364 191
179 3300025935 Ga0207709_10023156 Ga0207709_100231562 191
180 3300025935 Ga0207709_10035726 Ga0207709_100357264 191
181 3300025935 Ga0207709_10258127 Ga0207709_102581272 191
182 3300025940 Ga0207691_10181558 Ga0207691_101815583 191
183 3300025942 Ga0207689_10079241 Ga0207689_100792412 191
184 3300025944 Ga0207661_10063437 Ga0207661_100634373 191
185 3300025960 Ga0207651_10032285 Ga0207651_100322854 191
186 3300025981 Ga0207640_10264549 Ga0207640_102645492 191
187 3300026041 Ga0207639_10026908 Ga0207639_100269083 191
188 3300026067 Ga0207678_10000693 Ga0207678_1000069313 191
189 3300026078 Ga0207702_10015101 Ga0207702_100151013 191
190 3300026089 Ga0207648_10000286 Ga0207648_1000028638 191
191 3300026118 Ga0207675_100278224 Ga0207675_1002782242 191
192 3300026142 Ga0207698_10002857 Ga0207698_100028573 191
193 3300026142 Ga0207698_10071669 Ga0207698_100716694 191
194 3300026142 Ga0207698_10140013 Ga0207698_101400132 191
195 3300026142 Ga0207698_10487873 Ga0207698_104878732 191
196 3300028380 Ga0268265_11657632 Ga0268265_116576321 191
197 3300028381 Ga0268264_10321076 Ga0268264_103210762 191
198 3300028573 Ga0265334_10074212 Ga0265334_100742122 191
199 3300028666 Ga0265336_10000040 Ga0265336_1000004057 191
200 3300028786 Ga0307517_10118447 Ga0307517_101184472 191
201 3300028794 Ga0307515_10030743 Ga0307515_100307433 191
202 3300028794 Ga0307515_10099162 Ga0307515_100991624 191
203 3300028794 Ga0307515_10213448 Ga0307515_102134482 191
204 3300028794 Ga0307515_10470474 Ga0307515_104704741 191
205 3300029957 Ga0265324_10001184 Ga0265324_1000118410 191
206 3300031250 Ga0265331_10022196 Ga0265331_100221962 191
207 3300031251 Ga0265327_10000042 Ga0265327_10000042241 191
208 3300031251 Ga0265327_10134055 Ga0265327_101340552 191
209 3300031507 Ga0307509_10000871 Ga0307509_1000087119 191
210 3300031507 Ga0307509_10253363 Ga0307509_102533632 191
211 3300031507 Ga0307509_10284411 Ga0307509_102844112 191
212 3300031548 Ga0307408_100078780 Ga0307408_1000787802 191
213 3300031548 Ga0307408_100191965 Ga0307408_1001919651 191
214 3300031548 Ga0307408_100371529 Ga0307408_1003715292 191
215 3300031548 Ga0307408_100519919 Ga0307408_1005199192 191
216 3300031649 Ga0307514_10253029 Ga0307514_102530292 191
217 3300031730 Ga0307516_10000127 Ga0307516_1000012779 191
218 3300031730 Ga0307516_10000674 Ga0307516_1000067412 191
219 3300031730 Ga0307516_10003164 Ga0307516_100031644 191
220 3300031731 Ga0307405_10192950 Ga0307405_101929502 191
221 3300031824 Ga0307413_10556443 Ga0307413_105564432 191
222 3300031824 Ga0307413_10647253 Ga0307413_106472532 191
223 3300031852 Ga0307410_10658056 Ga0307410_106580562 191
224 3300031901 Ga0307406_10413105 Ga0307406_104131051 191
225 3300031903 Ga0307407_10263205 Ga0307407_102632051 191
226 3300031911 Ga0307412_10123090 Ga0307412_101230903 191
227 3300031911 Ga0307412_10257157 Ga0307412_102571572 191
228 3300031911 Ga0307412_10340658 Ga0307412_103406582 191
229 3300031995 Ga0307409_100163327 Ga0307409_1001633272 191
230 3300032002 Ga0307416_100519229 Ga0307416_1005192292 191
231 3300032004 Ga0307414_10994910 Ga0307414_109949102 191
232 3300033180 Ga0307510_10053936 Ga0307510_100539364 191
233 3300035691 Ga0373931_0033371 Ga0373931_0033371_1339_1917 191
234 3300035691 Ga0373931_0061525 Ga0373931_0061525_1063_1638 191
235 3300035691 Ga0373931_0232642 Ga0373931_0232642_336_914 191
236 3300037068 Ga0373925_0325140 Ga0373925_0325140_135_725 191
237 3300037418 Ga0395900_0000058 Ga0395900_0000058_177235_177816 191
238 3300037466 Ga0395898_0016745 Ga0395898_0016745_5114_5695 191
239 3300037466 Ga0395898_0271241 Ga0395898_0271241_854_1429 191
240 3300037471 Ga0395905_0008270 Ga0395905_0008270_8357_8944 191
241 3300037471 Ga0395905_0021987 Ga0395905_0021987_5277_5855 191
242 3300037471 Ga0395905_0221873 Ga0395905_0221873_394_975 191
243 3300038443 Ga0395901_0012799 Ga0395901_0012799_7079_7654 191
244 3300039447 Ga0436361_0019641 Ga0436361_0019641_69773_70354 191
245 3300039447 Ga0436361_0858281 Ga0436361_0858281_1532_2119 191
246 3300039447 Ga0436361_0882397 Ga0436361_0882397_31259_31837 191
247 3300039447 Ga0436361_0960381 Ga0436361_0960381_1030_1617 191
248 3300039450 Ga0436363_0469087 Ga0436363_0469087_96_671 191
249 3300041413 Ga0439465_0042475 Ga0439465_0042475_106_750 191
250 3300041460 Ga0451802_0393113 Ga0451802_0393113_401_982 191
251 3300041486 Ga0451807_2352941 Ga0451807_2352941_243_824 191
252 3300041997 Ga0439431_0002680 Ga0439431_0002680_2491_3135 191
253 3300042004 Ga0439445_0036967 Ga0439445_0036967_36_626 191
254 3300042007 Ga0439449_0057019 Ga0439449_0057019_616_1200 191
255 3300042012 Ga0439455_0079560 Ga0439455_0079560_161_742 191
256 3300042014 Ga0439457_020294 Ga0439457_020294_737_1315 191
257 3300042126 Ga0450888_005634 Ga0450888_005634_187_831 191
258 3300042134 Ga0450898_015314 Ga0450898_015314_416_1060 191
259 3300042156 Ga0439446_0004810 Ga0439446_0004810_1622_2266 191
260 3300042532 Ga0450893_0012708 Ga0450893_0012708_232_810 191
261 3300042532 Ga0450893_0055976 Ga0450893_0055976_131_709 191
262 3300042876 Ga0451577_0001500 Ga0451577_0001500_19018_19596 191
263 3300042876 Ga0451577_0004058 Ga0451577_0004058_13990_14571 191
264 3300042876 Ga0451577_0138731 Ga0451577_0138731_442_1035 191
265 3300044656 Ga0466969_0000013 Ga0466969_0000013_80831_81412 191
266 3300044656 Ga0466969_0127655 Ga0466969_0127655_105_686 191
267 3300044658 Ga0466972_0001525 Ga0466972_0001525_7325_7939 191
268 3300044658 Ga0466972_0009928 Ga0466972_0009928_2333_2914 191
269 3300044683 Ga0466965_0050202 Ga0466965_0050202_1207_1788 191
270 3300044683 Ga0466965_0091336 Ga0466965_0091336_742_1323 191
271 3300044684 Ga0466966_0031511 Ga0466966_0031511_1157_1738 191
272 3300044684 Ga0466966_0036978 Ga0466966_0036978_261_842 191
273 3300044693 Ga0466961_0006151 Ga0466961_0006151_1714_2295 191
274 3300044694 Ga0466963_0047955 Ga0466963_0047955_1630_2211 191
275 3300044694 Ga0466963_0318247 Ga0466963_0318247_208_783 191
276 3300044706 Ga0466964_0025739 Ga0466964_0025739_556_1137 191
277 3300044712 Ga0453684_0043091 Ga0453684_0043091_4059_4640 191
278 3300044712 Ga0453684_0099514 Ga0453684_0099514_1664_2245 191
279 3300044712 Ga0453684_0389185 Ga0453684_0389185_257_850 191
280 3300044719 Ga0466971_0030482 Ga0466971_0030482_1633_2214 191
281 3300044719 Ga0466971_0043703 Ga0466971_0043703_124_705 191
282 3300044765 Ga0466970_0075178 Ga0466970_0075178_854_1435 191
283 3300044765 Ga0466970_0075262 Ga0466970_0075262_707_1288 191
284 3300044842 Ga0466957_0103131 Ga0466957_0103131_265_846 191
285 3300044901 Ga0466960_0663505 Ga0466960_0663505_23_604 191
286 3300045049 Ga0466959_0000491 Ga0466959_0000491_5576_6157 191
287 3300045051 Ga0451576_0142394 Ga0451576_0142394_1272_1853 191
288 3300045836 Ga0466958_0045654 Ga0466958_0045654_1088_1669 191
289 3300045976 Ga0466967_0018595 Ga0466967_0018595_1244_1825 191
290 3300046462 Ga0495651_0146477 Ga0495651_0146477_776_1351 191
291 3300046471 Ga0495650_0002544 Ga0495650_0002544_4840_5424 191
292 3300046471 Ga0495650_0017791 Ga0495650_0017791_2539_3114 191
293 3300046475 Ga0495639_0144121 Ga0495639_0144121_73_648 191
294 3300046506 Ga0495583_0000046 Ga0495583_0000046_49456_50031 191
295 3300046507 Ga0495606_0002937 Ga0495606_0002937_15911_16486 191
296 3300046511 Ga0495608_0190697 Ga0495608_0190697_692_1267 191
297 3300046516 Ga0495628_0286549 Ga0495628_0286549_170_760 191
298 3300046516 Ga0495628_0420762 Ga0495628_0420762_182_805 191
299 3300046616 Ga0495668_0033574 Ga0495668_0033574_2112_2687 191
300 3300046660 Ga0495625_0036217 Ga0495625_0036217_2024_2599 191
301 3300046684 Ga0495669_0071236 Ga0495669_0071236_210_785 191
302 3300046694 Ga0495649_0000709 Ga0495649_0000709_15722_16297 191
303 3300046794 Ga0495589_0009929 Ga0495589_0009929_1268_1843 191
304 3300047321 Ga0495676_0088584 Ga0495676_0088584_1587_2177 191
305 3300047472 Ga0495686_0005518 Ga0495686_0005518_7215_7814 191
306 3300048908 Ga0496105_0172301 Ga0496105_0172301_592_1167 191
307 3300048909 Ga0496106_1018043 Ga0496106_1018043_40_621 191
308 3300048910 Ga0496107_0753219 Ga0496107_0753219_69_650 191
309 3300048924 Ga0496121_0002991 Ga0496121_0002991_4766_5347 191
310 3300049128 Ga0501308_021987 Ga0501308_021987_171_749 191
311 3300049513 Ga0501290_046343 Ga0501290_046343_71_649 191
312 3300049571 Ga0501034_0040051 Ga0501034_0040051_2253_2852 191
313 3300049579 Ga0501043_0000009 Ga0501043_0000009_24217_24795 191
314 3300049580 Ga0501046_0000022 Ga0501046_0000022_24206_24784 191
315 3300049581 Ga0501047_0000021 Ga0501047_0000021_24264_24842 191
316 3300049582 Ga0501048_0000909 Ga0501048_0000909_1034_1612 191
317 3300049678 Ga0501248_031706 Ga0501248_031706_13_591 191
318 3300049705 Ga0501225_0105983 Ga0501225_0105983_39_617 191
319 3300049822 Ga0501035_0977904 Ga0501035_0977904_49_630 191
320 3300049824 Ga0501045_0030356 Ga0501045_0030356_840_1418 191
321 3300050493 nmdc:mga0k408_44972_c1 nmdc:mga0k408_44972_c1_1611_2198 191
322 3300050493 nmdc:mga0k408_62527_c1 nmdc:mga0k408_62527_c1_1179_1754 191
323 3300050496 nmdc:mga07m45_1390_c1 nmdc:mga07m45_1390_c1_2120_2698 191
324 3300050496 nmdc:mga07m45_362703_c1 nmdc:mga07m45_362703_c1_122_709 191
325 3300050496 nmdc:mga07m45_5529_c2 nmdc:mga07m45_5529_c2_890_1465 191
326 3300050507 nmdc:mga05p37_414724_c1 nmdc:mga05p37_414724_c1_965_1546 191
327 3300050508 nmdc:mga09592_13275_c1 nmdc:mga09592_13275_c1_703_1281 191
328 3300050509 nmdc:mga0qj67_10758_c1 nmdc:mga0qj67_10758_c1_4758_5336 191
329 3300050509 nmdc:mga0qj67_294362_c1 nmdc:mga0qj67_294362_c1_312_893 191
330 3300053080 Ga0500635_0000213 Ga0500635_0000213_4763_5338 191
331 3300053087 Ga0500643_064183 Ga0500643_064183_154_741 191
332 3300053093 Ga0500651_0163900 Ga0500651_0163900_296_871 191
333 3300053093 Ga0500651_0240300 Ga0500651_0240300_332_919 191
334 3300053120 Ga0500597_219927 Ga0500597_219927_159_746 191
335 3300053136 Ga0500559_0011332 Ga0500559_0011332_1987_2562 191
336 3300053138 Ga0500564_109266 Ga0500564_109266_387_962 191
337 3300053147 Ga0500589_056996 Ga0500589_056996_367_942 191
338 3300053148 Ga0500590_047124 Ga0500590_047124_1336_1914 191
339 3300053177 Ga0500636_0054380 Ga0500636_0054380_1382_1957 191
340 3300053178 Ga0500637_0420935 Ga0500637_0420935_95_670 191
341 3300059421 Ga0590071_014622 Ga0590071_014622_433_1014 191
342 3300061719 Ga0466962_0056183 Ga0466962_0056183_1103_1684 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02622

DUF179

Uncharacterized ACR, COG1678

39

201

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.8893 7 180
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.881 1 181
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.8589 1 181
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.8561 7 180
2mui-assembly1.cif.gz_A solution structure of the algh protein from pseudomonas aeruginosa, pa0405, upf0301 0.7853 1 191
ID Description Score Start End Superfamily
2ew0A00 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.8836 7 180 3.40.1740.10
af_P0A8W5_4_171_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8818 10 174 3.40.50.1000
af_P0A8W5_4_171_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8624 10 174 3.40.50.1000
2aj2A01 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.8607 1 181 3.40.1740.10
2ew0A00 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.8504 7 180 3.40.1740.10
ID Description Score Start End GO Terms
AF-A0A6L5DBW0-F1-model_v4 deleted 0.93 1 180
AF-A0A227KDW8-F1-model_v4 UPF0301 protein ADH67_10760 0.9235 6 184 GO:0005829
AF-M1ME92-F1-model_v4 UPF0301 protein BCUE_0047 0.923 2 179 GO:0005829
AF-A0A7L9VV83-F1-model_v4 YqgE/AlgH family protein 0.9223 25 152 GO:0005829
AF-A0A0J7JGW5-F1-model_v4 deleted 0.9214 2 191

Feature Viewer

pLDDT pTM Quality
82.36 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map