F415011

General Info

Members Datasets Scaffolds Average Seq Length
342 227 339 136

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10194670|Ga0065712_101946702
Length 149
Sequence MSEEPRSYRTPMPTFVLDCSVALGWFFADEGAAFAKAVASSLATTRAIAPSIWPLEVANAILMGERRRRSTPAQASAWLASLRTLPIAIDDETTSHAWGTSLDLGREHSLSAYDAAYLELAIRKHLPIATLDGVLKGAAKKLGVRAFEP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2643221584 Caulobacter sp. Root656 Isolate Unclassified
3 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
153 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
154 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
217 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
220 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
221 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
222 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
223 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
224 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 1.17
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 0.29
Rhizosphere 91.23
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1900283 2162886012 Unclassified 859
2 rootH2_10034499 3300003320 Bacteria 3234
3 Ga0065712_10194670 3300005290 Bacteria 1133
4 Ga0065715_10571746 3300005293 Bacteria 726
5 Ga0070666_10057617 3300005335 Bacteria 2625
6 Ga0070680_100004271 3300005336 Bacteria 10730
7 Ga0070680_100185529 3300005336 Unclassified 1752
8 Ga0068868_100008493 3300005338 Bacteria 7352
9 Ga0068868_100043671 3300005338 Bacteria 3501
10 Ga0070689_101290418 3300005340 Bacteria 657
11 Ga0070691_10211141 3300005341 Bacteria 1024
12 Ga0070675_100329447 3300005354 Unclassified 1350
13 Ga0070671_101139990 3300005355 Unclassified 685
14 Ga0070688_100704131 3300005365 Bacteria 782
15 Ga0070667_100029783 3300005367 Bacteria 4550
16 Ga0070714_100617624 3300005435 Bacteria 1042
17 Ga0070714_100654093 3300005435 Bacteria 1012
18 Ga0070713_100161716 3300005436 Bacteria 1999
19 Ga0070701_10885444 3300005438 Unclassified 615
20 Ga0070705_100775498 3300005440 Unclassified 760
21 Ga0070708_100208500 3300005445 Bacteria 1831
22 Ga0070708_100546177 3300005445 Bacteria 1093
23 Ga0070681_10000074 3300005458 Bacteria 74128
24 Ga0070681_10040260 3300005458 Bacteria 4683
25 Ga0070681_10043660 3300005458 Unclassified 4489
26 Ga0070685_11232620 3300005466 Unclassified 569
27 Ga0070706_100144552 3300005467 Unclassified 2221
28 Ga0070698_101178856 3300005471 Bacteria 715
29 Ga0070679_100001026 3300005530 Bacteria 24341
30 Ga0070679_100201361 3300005530 Bacteria 1957
31 Ga0070679_100760879 3300005530 Unclassified 912
32 Ga0070684_100024446 3300005535 Bacteria 5069
33 Ga0070697_100192893 3300005536 Bacteria 1730
34 Ga0068853_100493440 3300005539 Unclassified 1155
35 Ga0070695_100078922 3300005545 Unclassified 2172
36 Ga0070693_100100626 3300005547 Bacteria 1760
37 Ga0070665_100470314 3300005548 Unclassified 1268
38 Ga0070704_100192796 3300005549 Bacteria 1639
39 Ga0068855_100005150 3300005563 Bacteria 15945
40 Ga0068855_100007772 3300005563 Bacteria 12952
41 Ga0068857_100003567 3300005577 Bacteria 13014
42 Ga0068857_100120004 3300005577 Bacteria 2367
43 Ga0068857_100577383 3300005577 Unclassified 1061
44 Ga0068857_102074263 3300005577 Unclassified 558
45 Ga0068856_100000436 3300005614 Bacteria 45887
46 Ga0068859_100105863 3300005617 Bacteria 2872
47 Ga0068859_101374908 3300005617 Bacteria 779
48 Ga0068864_100060577 3300005618 Bacteria 3277
49 Ga0068864_100414371 3300005618 Unclassified 1282
50 Ga0068864_100523867 3300005618 Bacteria 1143
51 Ga0068866_10462411 3300005718 Unclassified 832
52 Ga0068870_10390169 3300005840 Unclassified 903
53 Ga0068863_100028037 3300005841 Bacteria 5376
54 Ga0068863_100029357 3300005841 Bacteria 5249
55 Ga0068858_100048274 3300005842 Bacteria 3945
56 Ga0068858_101752316 3300005842 Unclassified 613
57 Ga0068860_100171867 3300005843 Bacteria 2093
58 Ga0068860_100391475 3300005843 Unclassified 1373
59 Ga0068862_100386862 3300005844 Unclassified 1306
60 Ga0081455_10310529 3300005937 Unclassified 1127
61 Ga0070717_11325284 3300006028 Unclassified 654
62 Ga0070717_11967030 3300006028 Bacteria 527
63 Ga0075367_10449714 3300006178 Bacteria 816
64 Ga0097621_100000183 3300006237 Bacteria 39949
65 Ga0097621_100264173 3300006237 Unclassified 1511
66 Ga0075370_10520983 3300006353 Unclassified 718
67 Ga0068871_100001462 3300006358 Bacteria 15822
68 Ga0068871_100036558 3300006358 Bacteria 3911
69 Ga0068871_100791637 3300006358 Bacteria 873
70 Ga0068871_102234541 3300006358 Bacteria 521
71 Ga0075428_101301839 3300006844 Unclassified 764
72 Ga0075430_100068227 3300006846 Bacteria 2984
73 Ga0075430_101487821 3300006846 Bacteria 556
74 Ga0075431_100467364 3300006847 Bacteria 1255
75 Ga0075431_101410601 3300006847 Unclassified 656
76 Ga0075433_11362980 3300006852 Unclassified 614
77 Ga0075429_101009216 3300006880 Unclassified 727
78 Ga0068865_100064109 3300006881 Bacteria 2585
79 Ga0075436_100012053 3300006914 Bacteria 5930
80 Ga0097620_100105862 3300006931 Bacteria 2872
81 Ga0097620_101374883 3300006931 Bacteria 779
82 Ga0075435_100157591 3300007076 Bacteria 1911
83 Ga0099794_10102551 3300007265 Bacteria 1429
84 Ga0105240_10044929 3300009093 Bacteria 5607
85 Ga0105240_10434216 3300009093 Bacteria 1473
86 Ga0105240_11238040 3300009093 Bacteria 789
87 Ga0111539_10015537 3300009094 Bacteria 9465
88 Ga0111539_11612222 3300009094 Unclassified 753
89 Ga0105245_10007477 3300009098 Bacteria 9569
90 Ga0105247_11233910 3300009101 Bacteria 597
91 Ga0105241_10184511 3300009174 Bacteria 1733
92 Ga0105242_11346167 3300009176 Unclassified 739
93 Ga0105248_10112105 3300009177 Bacteria 3077
94 Ga0105248_10117313 3300009177 Bacteria 3002
95 Ga0105248_10510298 3300009177 Bacteria 1356
96 Ga0105237_10035910 3300009545 Bacteria 5014
97 Ga0105237_11787574 3300009545 Bacteria 622
98 Ga0105238_11289729 3300009551 Unclassified 756
99 Ga0105239_10053369 3300010375 Bacteria 4435
100 Ga0105239_10161727 3300010375 Bacteria 2501
101 Ga0157370_10010914 3300013104 Bacteria 9539
102 Ga0157370_11132377 3300013104 Bacteria 707
103 Ga0157369_10620080 3300013105 Bacteria 1116
104 Ga0157369_10843631 3300013105 Bacteria 941
105 Ga0157374_10000187 3300013296 Bacteria 57781
106 Ga0157374_10702300 3300013296 Bacteria 1024
107 Ga0157378_10000161 3300013297 Bacteria 63839
108 Ga0157378_10351440 3300013297 Unclassified 1440
109 Ga0157378_10735865 3300013297 Bacteria 1008
110 Ga0163162_10121371 3300013306 Bacteria 2718
111 Ga0163162_10226372 3300013306 Unclassified 2000
112 Ga0157372_10005390 3300013307 Bacteria 13600
113 Ga0157372_10303588 3300013307 Bacteria 1857
114 Ga0157372_10439609 3300013307 Bacteria 1520
115 Ga0157375_10230179 3300013308 Unclassified 2012
116 Ga0157375_11169351 3300013308 Bacteria 902
117 Ga0157375_11203421 3300013308 Unclassified 889
118 Ga0163163_10101527 3300014325 Bacteria 2899
119 Ga0163163_10113940 3300014325 Bacteria 2734
120 Ga0163163_10417858 3300014325 Unclassified 1400
121 Ga0157377_10209538 3300014745 Unclassified 1242
122 Ga0157376_10003365 3300014969 Bacteria 11002
123 Ga0157376_10028430 3300014969 Bacteria 4443
124 Ga0157376_10326889 3300014969 Unclassified 1460
125 Ga0157376_10510072 3300014969 Bacteria 1183
126 Ga0213872_10000545 3300021361 Bacteria 29288
127 Ga0213872_10002328 3300021361 Bacteria 11311
128 Ga0213872_10009565 3300021361 Bacteria 4646
129 Ga0213872_10009854 3300021361 Bacteria 4563
130 Ga0213872_10010697 3300021361 Bacteria 4358
131 Ga0213874_10105622 3300021377 Bacteria 941
132 Ga0213874_10250273 3300021377 Bacteria 653
133 Ga0213875_10003359 3300021388 Bacteria 9119
134 Ga0213875_10098952 3300021388 Bacteria 1361
135 Ga0213871_10147472 3300021441 Unclassified 714
136 Ga0224570_114085 3300022730 Unclassified 520
137 Ga0207642_10544494 3300025899 Unclassified 716
138 Ga0207680_10056926 3300025903 Bacteria 2364
139 Ga0207680_10271230 3300025903 Unclassified 1177
140 Ga0207699_10786932 3300025906 Unclassified 699
141 Ga0207684_10361797 3300025910 Bacteria 1248
142 Ga0207707_10000079 3300025912 Bacteria 98440
143 Ga0207707_10060530 3300025912 Bacteria 3294
144 Ga0207707_10063351 3300025912 Bacteria 3218
145 Ga0207695_10019339 3300025913 Bacteria 7842
146 Ga0207660_10000248 3300025917 Bacteria 35058
147 Ga0207660_10176923 3300025917 Unclassified 1655
148 Ga0207652_10000624 3300025921 Bacteria 35063
149 Ga0207652_10220968 3300025921 Unclassified 1707
150 Ga0207694_10851366 3300025924 Unclassified 771
151 Ga0207687_10083635 3300025927 Bacteria 2311
152 Ga0207700_10699837 3300025928 Unclassified 905
153 Ga0207664_10017247 3300025929 Bacteria 5289
154 Ga0207664_10154590 3300025929 Bacteria 1952
155 Ga0207686_10070058 3300025934 Bacteria 2252
156 Ga0207670_10612320 3300025936 Unclassified 895
157 Ga0207704_10091778 3300025938 Bacteria 1997
158 Ga0207704_10800974 3300025938 Bacteria 787
159 Ga0207711_10103630 3300025941 Bacteria 2519
160 Ga0207689_10378912 3300025942 Unclassified 1178
161 Ga0207661_10476170 3300025944 Unclassified 1139
162 Ga0207679_11148820 3300025945 Unclassified 713
163 Ga0207667_10000694 3300025949 Bacteria 43647
164 Ga0207712_10671522 3300025961 Bacteria 902
165 Ga0207677_10109325 3300026023 Bacteria 2055
166 Ga0207703_10007520 3300026035 Bacteria 8645
167 Ga0207703_10423920 3300026035 Unclassified 1239
168 Ga0207639_10680263 3300026041 Unclassified 953
169 Ga0207702_10058465 3300026078 Bacteria 3281
170 Ga0207702_10853459 3300026078 Bacteria 901
171 Ga0207641_10064881 3300026088 Bacteria 3122
172 Ga0207641_10122495 3300026088 Unclassified 2323
173 Ga0207648_10931951 3300026089 Unclassified 812
174 Ga0207676_10081249 3300026095 Bacteria 2633
175 Ga0207676_10511145 3300026095 Unclassified 1142
176 Ga0207676_10689132 3300026095 Bacteria 989
177 Ga0207674_10018484 3300026116 Bacteria 7575
178 Ga0207674_10399310 3300026116 Bacteria 1329
179 Ga0207674_10456235 3300026116 Unclassified 1235
180 Ga0207674_10505013 3300026116 Unclassified 1168
181 Ga0207675_100340476 3300026118 Unclassified 1468
182 Ga0207428_10166166 3300027907 Unclassified 1673
183 Ga0265356_1008324 3300028017 Unclassified 1183
184 Ga0268266_10397733 3300028379 Unclassified 1302
185 Ga0268264_11285848 3300028381 Unclassified 741
186 Ga0265319_1046765 3300028563 Bacteria 1442
187 Ga0265319_1151278 3300028563 Bacteria 718
188 Ga0265338_10015342 3300028800 Bacteria 8427
189 Ga0265338_10110193 3300028800 Unclassified 2219
190 Ga0265762_1010683 3300030760 Bacteria 1640
191 Ga0265770_1031875 3300030878 Unclassified 887
192 Ga0265760_10046910 3300031090 Bacteria 1297
193 Ga0265760_10062015 3300031090 Unclassified 1137
194 Ga0265332_10035626 3300031238 Bacteria 2161
195 Ga0265320_10029189 3300031240 Bacteria 2855
196 Ga0265325_10090220 3300031241 Unclassified 1512
197 Ga0265329_10060316 3300031242 Unclassified 1201
198 Ga0265340_10038443 3300031247 Bacteria 2366
199 Ga0265339_10029746 3300031249 Bacteria 3097
200 Ga0265327_10030258 3300031251 Bacteria 3064
201 Ga0265316_10020885 3300031344 Bacteria 5562
202 Ga0265316_10401617 3300031344 Bacteria 987
203 Ga0307513_10006065 3300031456 Bacteria 15864
204 Ga0307408_101158910 3300031548 Unclassified 719
205 Ga0265313_10010735 3300031595 Bacteria 5760
206 Ga0265314_10076520 3300031711 Bacteria 2223
207 Ga0316212_1052392 3300033547 Unclassified 582
208 Ga0373956_0021394 3300035119 Bacteria 2760
209 Ga0373957_0199460 3300035120 Bacteria 833
210 Ga0373955_0264807 3300035172 Bacteria 1032
211 Ga0373937_0070466 3300036401 Bacteria 3225
212 Ga0395899_0232417 3300037312 Unclassified 1272
213 Ga0395899_0512392 3300037312 Unclassified 777
214 Ga0395900_0180365 3300037418 Bacteria 2146
215 Ga0395900_0811669 3300037418 Bacteria 863
216 Ga0395898_0011498 3300037466 Bacteria 9191
217 Ga0395905_0734252 3300037471 Unclassified 890
218 Ga0395905_1256694 3300037471 Bacteria 644
219 Ga0436364_0188595 3300037853 Unclassified 728
220 Ga0436364_1249967 3300037853 Bacteria 10698
221 Ga0395901_0188627 3300038443 Bacteria 2162
222 Ga0395901_0671850 3300038443 Unclassified 1037
223 Ga0436365_0594982 3300039437 Bacteria 647
224 Ga0436365_1927647 3300039437 Bacteria 1620
225 Ga0436360_0597578 3300039438 Bacteria 1719
226 Ga0436361_0027550 3300039447 Bacteria 11259
227 Ga0436361_0229246 3300039447 Bacteria 2021
228 Ga0436361_0351038 3300039447 Unclassified 780
229 Ga0436361_0370217 3300039447 Bacteria 3456
230 Ga0436361_0419405 3300039447 Bacteria 103155
231 Ga0436361_0493956 3300039447 Bacteria 1504
232 Ga0436363_0299345 3300039450 Bacteria 3297
233 Ga0436363_0487747 3300039450 Bacteria 3678
234 Ga0436362_0852133 3300039453 Bacteria 615
235 Ga0439441_001586 3300042001 Bacteria 3022
236 Ga0439463_001354 3300042016 Bacteria 6530
237 Ga0450890_007471 3300042127 Bacteria 1396
238 Ga0439464_0008795 3300042439 Bacteria 2648
239 Ga0439460_0157843 3300042461 Unclassified 759
240 Ga0451576_0303881 3300045051 Unclassified 1669
241 Ga0466967_0019448 3300045976 Bacteria 5460
242 Ga0466967_1782037 3300045976 Unclassified 613
243 Ga0495627_001096 3300046453 Bacteria 17686
244 Ga0495638_0011692 3300046460 Bacteria 6045
245 Ga0495580_0009085 3300046472 Bacteria 7838
246 Ga0495582_0860100 3300046473 Bacteria 524
247 Ga0495607_0046372 3300046501 Bacteria 2553
248 Ga0495610_0210967 3300046512 Bacteria 789
249 Ga0495610_0319741 3300046512 Bacteria 593
250 Ga0495616_0006961 3300046513 Bacteria 6809
251 Ga0495632_0009729 3300046519 Bacteria 5764
252 Ga0495643_0103719 3300046522 Bacteria 1454
253 Ga0495643_0156721 3300046522 Bacteria 1123
254 Ga0495648_0010816 3300046524 Bacteria 6929
255 Ga0495648_0084251 3300046524 Bacteria 1799
256 Ga0495666_0195353 3300046526 Bacteria 931
257 Ga0495668_0022989 3300046616 Bacteria 3559
258 Ga0495668_0077074 3300046616 Bacteria 1830
259 Ga0495625_0096486 3300046660 Bacteria 2036
260 Ga0495683_0031979 3300047323 Bacteria 2681
261 Ga0495673_0009616 3300047469 Bacteria 5332
262 Ga0495681_0054530 3300047470 Bacteria 1867
263 Ga0495681_0166133 3300047470 Bacteria 916
264 Ga0496115_0370006 3300048918 Bacteria 1167
265 Ga0495678_009317 3300049459 Bacteria 4868
266 Ga0501031_0019033 3300049568 Bacteria 4471
267 Ga0501032_0024012 3300049569 Bacteria 4211
268 Ga0501032_0159205 3300049569 Bacteria 1483
269 Ga0501032_0310256 3300049569 Bacteria 1019
270 Ga0501033_0013976 3300049570 Bacteria 6106
271 Ga0501033_0417623 3300049570 Bacteria 934
272 Ga0501033_0451694 3300049570 Bacteria 893
273 Ga0501034_0778588 3300049571 Bacteria 850
274 Ga0501036_0196410 3300049572 Bacteria 1697
275 Ga0501036_0334984 3300049572 Bacteria 1264
276 Ga0501036_0424425 3300049572 Bacteria 1108
277 Ga0501037_0010778 3300049573 Bacteria 6717
278 Ga0501038_0003934 3300049574 Bacteria 13808
279 Ga0501038_0167136 3300049574 Bacteria 1784
280 Ga0501038_0996604 3300049574 Bacteria 615
281 Ga0501039_0009042 3300049575 Bacteria 7590
282 Ga0501039_0071131 3300049575 Bacteria 2703
283 Ga0501039_0425991 3300049575 Bacteria 1042
284 Ga0501040_0278732 3300049576 Bacteria 1194
285 Ga0501041_0017002 3300049577 Bacteria 4329
286 Ga0501041_0053041 3300049577 Bacteria 2473
287 Ga0501042_0544794 3300049578 Bacteria 843
288 Ga0501043_0116694 3300049579 Bacteria 2094
289 Ga0501046_0203564 3300049580 Bacteria 1472
290 Ga0501046_1085647 3300049580 Bacteria 553
291 Ga0501047_0016386 3300049581 Bacteria 7075
292 Ga0501048_0166707 3300049582 Bacteria 1560
293 Ga0501070_0011175 3300049586 Bacteria 7579
294 Ga0501070_0392222 3300049586 Bacteria 1124
295 Ga0501071_0150005 3300049587 Bacteria 1739
296 Ga0501071_0209027 3300049587 Bacteria 1467
297 Ga0501072_0056165 3300049588 Bacteria 3103
298 Ga0501075_0008214 3300049591 Bacteria 7270
299 Ga0501075_0053598 3300049591 Bacteria 3033
300 Ga0501076_0042916 3300049592 Unclassified 3563
301 Ga0501077_0146529 3300049593 Bacteria 1498
302 Ga0501243_040732 3300049675 Unclassified 816
303 Ga0501079_0063202 3300049741 Bacteria 2856
304 Ga0501079_1186982 3300049741 Unclassified 601
305 Ga0501080_0156404 3300049742 Bacteria 2106
306 Ga0501080_0610750 3300049742 Bacteria 967
307 Ga0501081_0095328 3300049743 Bacteria 2098
308 Ga0501081_0101003 3300049743 Bacteria 2039
309 Ga0501083_0158533 3300049744 Bacteria 1481
310 Ga0501035_0127261 3300049822 Bacteria 2223
311 Ga0501044_0283167 3300049823 Bacteria 1590
312 Ga0501044_0757152 3300049823 Bacteria 853
313 Ga0501045_0549729 3300049824 Unclassified 856
314 Ga0501045_0599968 3300049824 Bacteria 815
315 Ga0501045_0887570 3300049824 Unclassified 655
316 nmdc:mga06z11_72374_c1 3300050494 Bacteria 1827
317 nmdc:mga07m45_482723_c1 3300050496 Unclassified 718
318 nmdc:mga09592_794340_c1 3300050508 Bacteria 801
319 nmdc:mga0qj67_1452304_c1 3300050509 Bacteria 528
320 nmdc:mga0qj67_63092_c1 3300050509 Bacteria 2946
321 nmdc:mga06r32_425290_c1 3300050510 Bacteria 1309
322 nmdc:mga08y16_71435_c1 3300050511 Unclassified 3617
323 nmdc:mga08x19_209277_c1 3300050514 Bacteria 1339
324 nmdc:mga0a205_1161943_c1 3300050515 Unclassified 619
325 Ga0495595_0352650 3300053084 Bacteria 743
326 Ga0500578_0000015 3300053086 Bacteria 179217
327 Ga0500644_0001211 3300053088 Bacteria 7255
328 Ga0500646_0307094 3300053090 Unclassified 570
329 Ga0500594_0001250 3300053118 Bacteria 5504
330 Ga0500564_005268 3300053138 Bacteria 5274
331 Ga0500573_0319947 3300053140 Bacteria 767
332 Ga0500627_0096536 3300053158 Bacteria 1325
333 Ga0500633_0314104 3300053160 Bacteria 575
334 Ga0500634_0260873 3300053161 Bacteria 713
335 Ga0500609_000518 3300053731 Bacteria 5790
336 Ga0501082_0050747 3300060353 Bacteria 3577
337 Ga0501082_0075803 3300060353 Bacteria 2898
338 Ga0530510_0012549 3300061734 Bacteria 5955
339 Ga0530510_0119936 3300061734 Bacteria 1930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025929 Ga0207664_10154590 Ga0207664_101545903 111
2 3300037853 Ga0436364_0188595 Ga0436364_0188595_247_585 112
3 3300006028 Ga0070717_11967030 Ga0070717_119670301 115
4 3300039450 Ga0436363_0299345 Ga0436363_0299345_2809_3195 122
5 3300026089 Ga0207648_10931951 Ga0207648_109319512 126
6 3300031456 Ga0307513_10006065 Ga0307513_100060653 126
7 3300005336 Ga0070680_100185529 Ga0070680_1001855292 127
8 3300039447 Ga0436361_0493956 Ga0436361_0493956_596_985 128
9 3300039453 Ga0436362_0852133 Ga0436362_0852133_11_397 128
10 3300049741 Ga0501079_1186982 Ga0501079_1186982_122_511 129
11 3300049824 Ga0501045_0549729 Ga0501045_0549729_146_535 129
12 3300050494 nmdc:mga06z11_72374_c1 nmdc:mga06z11_72374_c1_1096_1494 129
13 iso_pu_bacteria 2883577096 2883580564 129
14 3300005840 Ga0068870_10390169 Ga0068870_103901692 130
15 3300005844 Ga0068862_100386862 Ga0068862_1003868624 130
16 3300025961 Ga0207712_10671522 Ga0207712_106715221 130
17 3300026095 Ga0207676_10511145 Ga0207676_105111452 130
18 3300005354 Ga0070675_100329447 Ga0070675_1003294472 131
19 3300042016 Ga0439463_001354 Ga0439463_001354_3943_4338 131
20 3300042439 Ga0439464_0008795 Ga0439464_0008795_1833_2228 131
21 3300042461 Ga0439460_0157843 Ga0439460_0157843_200_595 131
22 3300049572 Ga0501036_0196410 Ga0501036_0196410_1240_1635 131
23 3300049575 Ga0501039_0071131 Ga0501039_0071131_134_529 131
24 3300049577 Ga0501041_0053041 Ga0501041_0053041_849_1244 131
25 3300049580 Ga0501046_0203564 Ga0501046_0203564_1003_1398 131
26 3300049586 Ga0501070_0392222 Ga0501070_0392222_12_407 131
27 3300049587 Ga0501071_0209027 Ga0501071_0209027_415_810 131
28 3300049591 Ga0501075_0008214 Ga0501075_0008214_4559_4954 131
29 3300049592 Ga0501076_0042916 Ga0501076_0042916_2674_3069 131
30 3300049593 Ga0501077_0146529 Ga0501077_0146529_231_626 131
31 3300049742 Ga0501080_0156404 Ga0501080_0156404_281_676 131
32 3300049743 Ga0501081_0095328 Ga0501081_0095328_610_1005 131
33 3300060353 Ga0501082_0075803 Ga0501082_0075803_1025_1420 131
34 3300061734 Ga0530510_0012549 Ga0530510_0012549_3793_4188 131
35 3300021377 Ga0213874_10250273 Ga0213874_102502731 132
36 3300013307 Ga0157372_10303588 Ga0157372_103035881 133
37 3300025903 Ga0207680_10271230 Ga0207680_102712302 133
38 3300031249 Ga0265339_10029746 Ga0265339_100297464 133
39 3300031344 Ga0265316_10020885 Ga0265316_100208854 133
40 3300031595 Ga0265313_10010735 Ga0265313_100107355 133
41 3300037312 Ga0395899_0232417 Ga0395899_0232417_406_810 133
42 3300037418 Ga0395900_0180365 Ga0395900_0180365_464_868 133
43 3300037466 Ga0395898_0011498 Ga0395898_0011498_7114_7518 133
44 3300037471 Ga0395905_0734252 Ga0395905_0734252_265_669 133
45 3300038443 Ga0395901_0188627 Ga0395901_0188627_352_756 133
46 iso_pu_bacteria 2643221584 2643929634 133
47 iso_pu_bacteria 8002060224 8002060268 133
48 3300005458 Ga0070681_10043660 Ga0070681_100436607 134
49 3300005530 Ga0070679_100760879 Ga0070679_1007608792 134
50 3300005563 Ga0068855_100007772 Ga0068855_1000077725 134
51 3300005577 Ga0068857_100003567 Ga0068857_10000356710 134
52 3300006028 Ga0070717_11325284 Ga0070717_113252842 134
53 3300009174 Ga0105241_10184511 Ga0105241_101845113 134
54 3300009545 Ga0105237_10035910 Ga0105237_100359102 134
55 3300013104 Ga0157370_11132377 Ga0157370_111323772 134
56 3300013307 Ga0157372_10439609 Ga0157372_104396093 134
57 3300013308 Ga0157375_11203421 Ga0157375_112034212 134
58 3300014325 Ga0163163_10101527 Ga0163163_101015272 134
59 3300025912 Ga0207707_10063351 Ga0207707_100633513 134
60 3300025913 Ga0207695_10019339 Ga0207695_100193399 134
61 3300025917 Ga0207660_10176923 Ga0207660_101769232 134
62 3300025934 Ga0207686_10070058 Ga0207686_100700582 134
63 3300026116 Ga0207674_10018484 Ga0207674_100184842 134
64 3300028379 Ga0268266_10397733 Ga0268266_103977331 134
65 3300039437 Ga0436365_0594982 Ga0436365_0594982_161_565 134
66 3300049570 Ga0501033_0451694 Ga0501033_0451694_55_459 134
67 3300049574 Ga0501038_0167136 Ga0501038_0167136_1041_1445 134
68 3300049575 Ga0501039_0425991 Ga0501039_0425991_413_817 134
69 3300049576 Ga0501040_0278732 Ga0501040_0278732_726_1130 134
70 3300049577 Ga0501041_0017002 Ga0501041_0017002_2925_3329 134
71 3300049588 Ga0501072_0056165 Ga0501072_0056165_2295_2699 134
72 3300049591 Ga0501075_0053598 Ga0501075_0053598_2041_2445 134
73 3300049741 Ga0501079_0063202 Ga0501079_0063202_1194_1598 134
74 3300049742 Ga0501080_0610750 Ga0501080_0610750_162_566 134
75 3300049743 Ga0501081_0101003 Ga0501081_0101003_695_1099 134
76 3300060353 Ga0501082_0050747 Ga0501082_0050747_486_890 134
77 3300061734 Ga0530510_0119936 Ga0530510_0119936_110_514 134
78 3300003320 rootH2_10034499 rootH2_100344994 135
79 3300005335 Ga0070666_10057617 Ga0070666_100576173 135
80 3300005338 Ga0068868_100043671 Ga0068868_1000436711 135
81 3300005367 Ga0070667_100029783 Ga0070667_1000297833 135
82 3300005435 Ga0070714_100617624 Ga0070714_1006176241 135
83 3300005617 Ga0068859_100105863 Ga0068859_1001058633 135
84 3300005618 Ga0068864_100523867 Ga0068864_1005238672 135
85 3300005841 Ga0068863_100029357 Ga0068863_1000293573 135
86 3300005842 Ga0068858_100048274 Ga0068858_1000482743 135
87 3300005843 Ga0068860_100171867 Ga0068860_1001718672 135
88 3300005937 Ga0081455_10310529 Ga0081455_103105292 135
89 3300006358 Ga0068871_100036558 Ga0068871_1000365583 135
90 3300006931 Ga0097620_100105862 Ga0097620_1001058623 135
91 3300009093 Ga0105240_10044929 Ga0105240_100449297 135
92 3300009094 Ga0111539_11612222 Ga0111539_116122221 135
93 3300009098 Ga0105245_10007477 Ga0105245_100074776 135
94 3300009101 Ga0105247_11233910 Ga0105247_112339102 135
95 3300009177 Ga0105248_10117313 Ga0105248_101173134 135
96 3300013104 Ga0157370_10010914 Ga0157370_100109143 135
97 3300013105 Ga0157369_10620080 Ga0157369_106200801 135
98 3300013296 Ga0157374_10702300 Ga0157374_107023002 135
99 3300013297 Ga0157378_10735865 Ga0157378_107358652 135
100 3300013306 Ga0163162_10121371 Ga0163162_101213713 135
101 3300013308 Ga0157375_10230179 Ga0157375_102301793 135
102 3300014325 Ga0163163_10113940 Ga0163163_101139403 135
103 3300014969 Ga0157376_10510072 Ga0157376_105100722 135
104 3300021388 Ga0213875_10098952 Ga0213875_100989522 135
105 3300025903 Ga0207680_10056926 Ga0207680_100569263 135
106 3300025927 Ga0207687_10083635 Ga0207687_100836352 135
107 3300025929 Ga0207664_10017247 Ga0207664_100172472 135
108 3300025938 Ga0207704_10800974 Ga0207704_108009741 135
109 3300025941 Ga0207711_10103630 Ga0207711_101036302 135
110 3300026035 Ga0207703_10007520 Ga0207703_100075206 135
111 3300026078 Ga0207702_10853459 Ga0207702_108534592 135
112 3300026088 Ga0207641_10122495 Ga0207641_101224954 135
113 3300026095 Ga0207676_10689132 Ga0207676_106891323 135
114 3300028563 Ga0265319_1151278 Ga0265319_11512781 135
115 3300031344 Ga0265316_10401617 Ga0265316_104016171 135
116 3300031548 Ga0307408_101158910 Ga0307408_1011589101 135
117 3300037471 Ga0395905_1256694 Ga0395905_1256694_31_441 135
118 3300045976 Ga0466967_1782037 Ga0466967_1782037_159_566 135
119 3300048918 Ga0496115_0370006 Ga0496115_0370006_571_978 135
120 3300049568 Ga0501031_0019033 Ga0501031_0019033_1236_1643 135
121 3300049569 Ga0501032_0024012 Ga0501032_0024012_1054_1461 135
122 3300049569 Ga0501032_0159205 Ga0501032_0159205_54_461 135
123 3300049570 Ga0501033_0013976 Ga0501033_0013976_535_942 135
124 3300049571 Ga0501034_0778588 Ga0501034_0778588_324_731 135
125 3300049572 Ga0501036_0334984 Ga0501036_0334984_74_481 135
126 3300049572 Ga0501036_0424425 Ga0501036_0424425_368_775 135
127 3300049573 Ga0501037_0010778 Ga0501037_0010778_3621_4028 135
128 3300049574 Ga0501038_0003934 Ga0501038_0003934_2838_3245 135
129 3300049575 Ga0501039_0009042 Ga0501039_0009042_4434_4841 135
130 3300049578 Ga0501042_0544794 Ga0501042_0544794_241_648 135
131 3300049579 Ga0501043_0116694 Ga0501043_0116694_825_1232 135
132 3300049580 Ga0501046_1085647 Ga0501046_1085647_99_506 135
133 3300049581 Ga0501047_0016386 Ga0501047_0016386_5563_5970 135
134 3300049582 Ga0501048_0166707 Ga0501048_0166707_76_483 135
135 3300049586 Ga0501070_0011175 Ga0501070_0011175_5904_6311 135
136 3300049587 Ga0501071_0150005 Ga0501071_0150005_220_627 135
137 3300049675 Ga0501243_040732 Ga0501243_040732_230_640 135
138 3300049744 Ga0501083_0158533 Ga0501083_0158533_227_637 135
139 3300049822 Ga0501035_0127261 Ga0501035_0127261_781_1188 135
140 3300049823 Ga0501044_0283167 Ga0501044_0283167_769_1176 135
141 3300049823 Ga0501044_0757152 Ga0501044_0757152_436_843 135
142 3300049824 Ga0501045_0599968 Ga0501045_0599968_99_506 135
143 3300053140 Ga0500573_0319947 Ga0500573_0319947_189_596 135
144 3300053161 Ga0500634_0260873 Ga0500634_0260873_93_500 135
145 3300005338 Ga0068868_100008493 Ga0068868_1000084936 136
146 3300005341 Ga0070691_10211141 Ga0070691_102111413 136
147 3300005355 Ga0070671_101139990 Ga0070671_1011399901 136
148 3300005435 Ga0070714_100654093 Ga0070714_1006540932 136
149 3300005436 Ga0070713_100161716 Ga0070713_1001617162 136
150 3300005530 Ga0070679_100201361 Ga0070679_1002013613 136
151 3300005535 Ga0070684_100024446 Ga0070684_1000244467 136
152 3300005539 Ga0068853_100493440 Ga0068853_1004934401 136
153 3300005563 Ga0068855_100005150 Ga0068855_1000051508 136
154 3300005577 Ga0068857_100577383 Ga0068857_1005773832 136
155 3300005614 Ga0068856_100000436 Ga0068856_10000043629 136
156 3300005618 Ga0068864_100060577 Ga0068864_1000605774 136
157 3300005718 Ga0068866_10462411 Ga0068866_104624112 136
158 3300005841 Ga0068863_100028037 Ga0068863_1000280375 136
159 3300005842 Ga0068858_101752316 Ga0068858_1017523161 136
160 3300005843 Ga0068860_100391475 Ga0068860_1003914752 136
161 3300006237 Ga0097621_100000183 Ga0097621_10000018314 136
162 3300006358 Ga0068871_100001462 Ga0068871_10000146216 136
163 3300006846 Ga0075430_101487821 Ga0075430_1014878211 136
164 3300006881 Ga0068865_100064109 Ga0068865_1000641094 136
165 3300009093 Ga0105240_10434216 Ga0105240_104342163 136
166 3300009176 Ga0105242_11346167 Ga0105242_113461671 136
167 3300009551 Ga0105238_11289729 Ga0105238_112897292 136
168 3300010375 Ga0105239_10053369 Ga0105239_100533695 136
169 3300013105 Ga0157369_10843631 Ga0157369_108436312 136
170 3300013296 Ga0157374_10000187 Ga0157374_1000018722 136
171 3300013297 Ga0157378_10000161 Ga0157378_100001617 136
172 3300013307 Ga0157372_10005390 Ga0157372_100053907 136
173 3300013308 Ga0157375_11169351 Ga0157375_111693512 136
174 3300014969 Ga0157376_10003365 Ga0157376_100033658 136
175 3300021361 Ga0213872_10000545 Ga0213872_1000054519 136
176 3300021361 Ga0213872_10002328 Ga0213872_100023286 136
177 3300021361 Ga0213872_10009565 Ga0213872_100095652 136
178 3300021361 Ga0213872_10009854 Ga0213872_100098543 136
179 3300021388 Ga0213875_10003359 Ga0213875_100033595 136
180 3300022730 Ga0224570_114085 Ga0224570_1140851 136
181 3300025899 Ga0207642_10544494 Ga0207642_105444941 136
182 3300025921 Ga0207652_10220968 Ga0207652_102209683 136
183 3300025924 Ga0207694_10851366 Ga0207694_108513661 136
184 3300025928 Ga0207700_10699837 Ga0207700_106998371 136
185 3300025938 Ga0207704_10091778 Ga0207704_100917784 136
186 3300025944 Ga0207661_10476170 Ga0207661_104761701 136
187 3300025945 Ga0207679_11148820 Ga0207679_111488202 136
188 3300025949 Ga0207667_10000694 Ga0207667_1000069420 136
189 3300026023 Ga0207677_10109325 Ga0207677_101093254 136
190 3300026035 Ga0207703_10423920 Ga0207703_104239203 136
191 3300026041 Ga0207639_10680263 Ga0207639_106802631 136
192 3300026078 Ga0207702_10058465 Ga0207702_100584651 136
193 3300026088 Ga0207641_10064881 Ga0207641_100648814 136
194 3300026095 Ga0207676_10081249 Ga0207676_100812493 136
195 3300026116 Ga0207674_10505013 Ga0207674_105050133 136
196 3300028381 Ga0268264_11285848 Ga0268264_112858482 136
197 3300030760 Ga0265762_1010683 Ga0265762_10106833 136
198 3300030878 Ga0265770_1031875 Ga0265770_10318752 136
199 3300031090 Ga0265760_10046910 Ga0265760_100469102 136
200 3300031238 Ga0265332_10035626 Ga0265332_100356262 136
201 3300031247 Ga0265340_10038443 Ga0265340_100384432 136
202 3300031251 Ga0265327_10030258 Ga0265327_100302582 136
203 3300031711 Ga0265314_10076520 Ga0265314_100765202 136
204 3300033547 Ga0316212_1052392 Ga0316212_10523922 136
205 3300037312 Ga0395899_0512392 Ga0395899_0512392_302_718 136
206 3300037418 Ga0395900_0811669 Ga0395900_0811669_236_652 136
207 3300038443 Ga0395901_0671850 Ga0395901_0671850_238_654 136
208 3300039447 Ga0436361_0027550 Ga0436361_0027550_806_1219 136
209 3300039447 Ga0436361_0351038 Ga0436361_0351038_286_699 136
210 3300039447 Ga0436361_0370217 Ga0436361_0370217_726_1139 136
211 3300039447 Ga0436361_0419405 Ga0436361_0419405_66620_67036 136
212 3300042001 Ga0439441_001586 Ga0439441_001586_1095_1544 136
213 3300042127 Ga0450890_007471 Ga0450890_007471_80_490 136
214 3300045051 Ga0451576_0303881 Ga0451576_0303881_465_881 136
215 3300045976 Ga0466967_0019448 Ga0466967_0019448_4374_4787 136
216 3300046512 Ga0495610_0319741 Ga0495610_0319741_80_490 136
217 3300049459 Ga0495678_009317 Ga0495678_009317_3898_4308 136
218 3300049570 Ga0501033_0417623 Ga0501033_0417623_369_779 136
219 3300049574 Ga0501038_0996604 Ga0501038_0996604_102_515 136
220 3300050509 nmdc:mga0qj67_1452304_c1 nmdc:mga0qj67_1452304_c1_100_510 136
221 3300053086 Ga0500578_0000015 Ga0500578_0000015_103340_103750 136
222 3300053118 Ga0500594_0001250 Ga0500594_0001250_2046_2456 136
223 3300053160 Ga0500633_0314104 Ga0500633_0314104_153_563 136
224 3300005290 Ga0065712_10194670 Ga0065712_101946702 137
225 3300005336 Ga0070680_100004271 Ga0070680_1000042713 137
226 3300005438 Ga0070701_10885444 Ga0070701_108854441 137
227 3300005445 Ga0070708_100546177 Ga0070708_1005461771 137
228 3300005458 Ga0070681_10000074 Ga0070681_1000007479 137
229 3300005458 Ga0070681_10040260 Ga0070681_100402603 137
230 3300005466 Ga0070685_11232620 Ga0070685_112326201 137
231 3300005467 Ga0070706_100144552 Ga0070706_1001445524 137
232 3300005530 Ga0070679_100001026 Ga0070679_1000010263 137
233 3300005536 Ga0070697_100192893 Ga0070697_1001928932 137
234 3300005545 Ga0070695_100078922 Ga0070695_1000789223 137
235 3300005547 Ga0070693_100100626 Ga0070693_1001006263 137
236 3300005548 Ga0070665_100470314 Ga0070665_1004703142 137
237 3300005549 Ga0070704_100192796 Ga0070704_1001927963 137
238 3300005577 Ga0068857_102074263 Ga0068857_1020742631 137
239 3300006353 Ga0075370_10520983 Ga0075370_105209831 137
240 3300006914 Ga0075436_100012053 Ga0075436_1000120534 137
241 3300007076 Ga0075435_100157591 Ga0075435_1001575913 137
242 3300007265 Ga0099794_10102551 Ga0099794_101025511 137
243 3300009093 Ga0105240_11238040 Ga0105240_112380402 137
244 3300009177 Ga0105248_10510298 Ga0105248_105102982 137
245 3300009545 Ga0105237_11787574 Ga0105237_117875741 137
246 3300010375 Ga0105239_10161727 Ga0105239_101617273 137
247 3300021377 Ga0213874_10105622 Ga0213874_101056222 137
248 3300025910 Ga0207684_10361797 Ga0207684_103617972 137
249 3300025912 Ga0207707_10000079 Ga0207707_10000079103 137
250 3300025912 Ga0207707_10060530 Ga0207707_100605304 137
251 3300025917 Ga0207660_10000248 Ga0207660_1000024834 137
252 3300025921 Ga0207652_10000624 Ga0207652_1000062434 137
253 3300026116 Ga0207674_10399310 Ga0207674_103993102 137
254 3300028017 Ga0265356_1008324 Ga0265356_10083242 137
255 3300028800 Ga0265338_10110193 Ga0265338_101101932 137
256 3300031241 Ga0265325_10090220 Ga0265325_100902202 137
257 3300031242 Ga0265329_10060316 Ga0265329_100603163 137
258 3300039450 Ga0436363_0487747 Ga0436363_0487747_1779_2228 137
259 3300046453 Ga0495627_001096 Ga0495627_001096_350_763 137
260 3300046460 Ga0495638_0011692 Ga0495638_0011692_4866_5279 137
261 3300046501 Ga0495607_0046372 Ga0495607_0046372_1418_1831 137
262 3300046512 Ga0495610_0210967 Ga0495610_0210967_194_607 137
263 3300046513 Ga0495616_0006961 Ga0495616_0006961_4447_4860 137
264 3300046519 Ga0495632_0009729 Ga0495632_0009729_3386_3799 137
265 3300046522 Ga0495643_0103719 Ga0495643_0103719_836_1249 137
266 3300046522 Ga0495643_0156721 Ga0495643_0156721_164_577 137
267 3300046524 Ga0495648_0010816 Ga0495648_0010816_861_1274 137
268 3300046524 Ga0495648_0084251 Ga0495648_0084251_681_1094 137
269 3300046616 Ga0495668_0022989 Ga0495668_0022989_545_958 137
270 3300046616 Ga0495668_0077074 Ga0495668_0077074_548_961 137
271 3300046660 Ga0495625_0096486 Ga0495625_0096486_518_931 137
272 3300047323 Ga0495683_0031979 Ga0495683_0031979_310_723 137
273 3300047469 Ga0495673_0009616 Ga0495673_0009616_530_943 137
274 3300047470 Ga0495681_0054530 Ga0495681_0054530_1241_1654 137
275 3300047470 Ga0495681_0166133 Ga0495681_0166133_202_615 137
276 3300049824 Ga0501045_0887570 Ga0501045_0887570_137_556 137
277 3300050496 nmdc:mga07m45_482723_c1 nmdc:mga07m45_482723_c1_41_454 137
278 3300050514 nmdc:mga08x19_209277_c1 nmdc:mga08x19_209277_c1_98_517 137
279 3300053088 Ga0500644_0001211 Ga0500644_0001211_3046_3459 137
280 3300053090 Ga0500646_0307094 Ga0500646_0307094_120_533 137
281 3300053138 Ga0500564_005268 Ga0500564_005268_3913_4326 137
282 3300053158 Ga0500627_0096536 Ga0500627_0096536_715_1128 137
283 3300053731 Ga0500609_000518 Ga0500609_000518_4462_4875 137
284 3300005445 Ga0070708_100208500 Ga0070708_1002085002 138
285 3300006358 Ga0068871_100791637 Ga0068871_1007916372 138
286 3300014969 Ga0157376_10028430 Ga0157376_100284305 138
287 3300025906 Ga0207699_10786932 Ga0207699_107869321 138
288 3300028563 Ga0265319_1046765 Ga0265319_10467654 138
289 3300028800 Ga0265338_10015342 Ga0265338_1001534210 138
290 3300031090 Ga0265760_10062015 Ga0265760_100620152 138
291 3300031240 Ga0265320_10029189 Ga0265320_100291893 138
292 3300035119 Ga0373956_0021394 Ga0373956_0021394_2157_2576 138
293 3300035120 Ga0373957_0199460 Ga0373957_0199460_22_441 138
294 3300035172 Ga0373955_0264807 Ga0373955_0264807_306_725 138
295 3300036401 Ga0373937_0070466 Ga0373937_0070466_2460_2879 138
296 3300039437 Ga0436365_1927647 Ga0436365_1927647_409_828 138
297 3300046472 Ga0495580_0009085 Ga0495580_0009085_7043_7462 138
298 3300046473 Ga0495582_0860100 Ga0495582_0860100_36_464 138
299 3300046526 Ga0495666_0195353 Ga0495666_0195353_73_492 138
300 3300049569 Ga0501032_0310256 Ga0501032_0310256_297_713 138
301 3300053084 Ga0495595_0352650 Ga0495595_0352650_42_470 138
302 3300006178 Ga0075367_10449714 Ga0075367_104497141 139
303 3300021361 Ga0213872_10010697 Ga0213872_100106971 139
304 3300021441 Ga0213871_10147472 Ga0213871_101474721 139
305 3300037853 Ga0436364_1249967 Ga0436364_1249967_4375_4800 139
306 3300039438 Ga0436360_0597578 Ga0436360_0597578_1058_1480 139
307 3300039447 Ga0436361_0229246 Ga0436361_0229246_1438_1860 139
308 2162886012 MBSR1b_contig_1900283 MBSR1b_0529.00000140 140
309 3300005293 Ga0065715_10571746 Ga0065715_105717461 140
310 3300005340 Ga0070689_101290418 Ga0070689_1012904182 140
311 3300005365 Ga0070688_100704131 Ga0070688_1007041312 140
312 3300005440 Ga0070705_100775498 Ga0070705_1007754982 140
313 3300005471 Ga0070698_101178856 Ga0070698_1011788561 140
314 3300005577 Ga0068857_100120004 Ga0068857_1001200042 140
315 3300005617 Ga0068859_101374908 Ga0068859_1013749081 140
316 3300005618 Ga0068864_100414371 Ga0068864_1004143712 140
317 3300006237 Ga0097621_100264173 Ga0097621_1002641733 140
318 3300006358 Ga0068871_102234541 Ga0068871_1022345411 140
319 3300006844 Ga0075428_101301839 Ga0075428_1013018391 140
320 3300006846 Ga0075430_100068227 Ga0075430_1000682272 140
321 3300006847 Ga0075431_100467364 Ga0075431_1004673642 140
322 3300006847 Ga0075431_101410601 Ga0075431_1014106011 140
323 3300006852 Ga0075433_11362980 Ga0075433_113629802 140
324 3300006880 Ga0075429_101009216 Ga0075429_1010092161 140
325 3300006931 Ga0097620_101374883 Ga0097620_1013748831 140
326 3300009094 Ga0111539_10015537 Ga0111539_100155375 140
327 3300009177 Ga0105248_10112105 Ga0105248_101121053 140
328 3300013297 Ga0157378_10351440 Ga0157378_103514402 140
329 3300013306 Ga0163162_10226372 Ga0163162_102263721 140
330 3300014325 Ga0163163_10417858 Ga0163163_104178583 140
331 3300014745 Ga0157377_10209538 Ga0157377_102095382 140
332 3300014969 Ga0157376_10326889 Ga0157376_103268891 140
333 3300025936 Ga0207670_10612320 Ga0207670_106123201 140
334 3300025942 Ga0207689_10378912 Ga0207689_103789121 140
335 3300026116 Ga0207674_10456235 Ga0207674_104562353 140
336 3300026118 Ga0207675_100340476 Ga0207675_1003404764 140
337 3300027907 Ga0207428_10166166 Ga0207428_101661663 140
338 3300050508 nmdc:mga09592_794340_c1 nmdc:mga09592_794340_c1_85_507 140
339 3300050509 nmdc:mga0qj67_63092_c1 nmdc:mga0qj67_63092_c1_392_814 140
340 3300050510 nmdc:mga06r32_425290_c1 nmdc:mga06r32_425290_c1_529_951 140
341 3300050511 nmdc:mga08y16_71435_c1 nmdc:mga08y16_71435_c1_2395_2817 140
342 3300050515 nmdc:mga0a205_1161943_c1 nmdc:mga0a205_1161943_c1_78_500 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

15

141

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8p-assembly2.cif.gz_F crystal structure of pae2754 from pyrobaculum aerophilum 0.8322 1 135
1v8o-assembly2.cif.gz_H crystal structure of pae2754 from pyrobaculum aerophilum 0.8276 1 135
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.8255 1 130
1v8p-assembly1.cif.gz_D crystal structure of pae2754 from pyrobaculum aerophilum 0.8248 1 135
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.8028 1 130
ID Description Score Start End Superfamily
af_P9WFA9_1_117_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9082 3 127 3.40.50.1010
af_P9WFA9_1_117_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8793 3 127 3.40.50.1010
af_P9WFB7_11_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8634 3 127 3.40.50.1010
af_P9WFA3_1_120_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8602 3 126 3.40.50.1010
af_P9WFB7_11_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8313 3 127 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A4V0XKM6-F1-model_v4 Twitching motility protein PilT 0.9799 3 140
AF-A0A661C5L2-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.978 35 135
AF-A0A6N9A343-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9742 2 137 GO:0000287
GO:0004540
GO:0090729
AF-A0A1G0FDJ2-F1-model_v4 DNA-binding protein 0.9734 1 136 GO:0003677
AF-A0A6B2M5Z4-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9734 2 135

Feature Viewer

pLDDT pTM Quality
94.76 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map