F413079

General Info

Members Datasets Scaffolds Average Seq Length
337 230 279 342

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10051114|Ga0157374_100511142
Length 395
Sequence LDEPAFQRHAERIAVKVLQARVRRVFKEWRNPMTTAKSSHEAAMQKGYRSKGVRALTTFTLGGIIAMTQLAAAQTPNAATDDRIDPQVRAFLAELNKASSPFWELPQPKPQEILTALQNQTPVDMSGVTTVEKTITQDRRTVKLYIMTPQHPAPKPGVLLFIHGGVWIVGNFQNHQRLLRDLVVGSGQVGVFVEYTPLPAAVFPTQLEESYAALKWVAAHAQEFGADGTRIAIAGNSVGGNMTAALTLMAKDRRGPKIAYQVLFIPATDASVDTDSYHEFGTGRFLARDFMKYGWDLYAPDHKTRNNPYVSPLRATTEELQGLPPALVITAENDPLREEGEAYARKLKDAGVPVTATRYNGMIHDFVLLNAIHEVPGVQTALREATDGIREALKP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2739367700 Dyella sp. YR388 Isolate Unclassified
7 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
8 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
9 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
10 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
11 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
12 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
13 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
14 2922368715
15 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
16 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
17 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
18 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
19 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
20 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
21 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
22 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
23 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
24 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
25 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
26 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
27 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
28 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
29 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
30 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
31 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
32 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
33 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
34 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
35 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
36 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
37 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
38 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
39 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
40 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
41 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
42 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
43 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
44 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
45 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
115 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
198 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
209 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
212 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
219 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
222 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
223 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
224 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
225 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
226 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
227 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
228 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
229 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
230 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.93
Metatranscriptomes 0
Isolates 16.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 13.65
Rhizoplane 7.12
Rhizosphere 64.09
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_948318 2162886011 Bacteria 2099
2 MBSR1b_contig_868394 2162886012 Bacteria 1871
3 rootL2_10204211 3300003322 Bacteria 2106
4 Ga0055542_1000010 3300003762 Bacteria 414813
5 Ga0065715_10089138 3300005293 Bacteria 13651
6 Ga0065715_10105464 3300005293 Bacteria 2891
7 Ga0070661_100310296 3300005344 Bacteria 1230
8 Ga0070671_100011929 3300005355 Bacteria 6990
9 Ga0070673_100231436 3300005364 Bacteria 1603
10 Ga0070667_100038986 3300005367 Bacteria 3983
11 Ga0070667_100074591 3300005367 Bacteria 2894
12 Ga0070709_10048541 3300005434 Bacteria 2649
13 Ga0070708_100054788 3300005445 Bacteria 3544
14 Ga0070663_100028250 3300005455 Bacteria 3817
15 Ga0070706_100024613 3300005467 Bacteria 5542
16 Ga0070706_100031383 3300005467 Bacteria 4900
17 Ga0070706_100053488 3300005467 Bacteria 3726
18 Ga0070707_100000407 3300005468 Bacteria 42543
19 Ga0070707_100025054 3300005468 Bacteria 5658
20 Ga0070698_100084748 3300005471 Bacteria 3157
21 Ga0068855_100170773 3300005563 Bacteria 2463
22 Ga0068859_100337387 3300005617 Bacteria 1601
23 Ga0081540_1000785 3300005983 Bacteria 29131
24 Ga0070716_100001567 3300006173 Bacteria 10266
25 Ga0070712_100217159 3300006175 Bacteria 1511
26 Ga0068871_100166772 3300006358 Bacteria 1886
27 Ga0097620_100337395 3300006931 Bacteria 1601
28 Ga0099823_1042042 3300006944 Bacteria 3219
29 Ga0105251_10037859 3300009011 Bacteria 2365
30 Ga0105247_10005629 3300009101 Bacteria 7862
31 Ga0105248_10008540 3300009177 Bacteria 11244
32 Ga0105248_10017835 3300009177 Bacteria 7835
33 Ga0105238_10019803 3300009551 Bacteria 6849
34 Ga0105238_10021253 3300009551 Bacteria 6613
35 Ga0157370_10289384 3300013104 Bacteria 1513
36 Ga0157369_10125224 3300013105 Bacteria 2725
37 Ga0157374_10051114 3300013296 Bacteria 3845
38 Ga0157374_10178997 3300013296 Bacteria 2070
39 Ga0157378_10071258 3300013297 Bacteria 3121
40 Ga0157378_10389884 3300013297 Bacteria 1370
41 Ga0163162_10000297 3300013306 Bacteria 45730
42 Ga0163162_10002427 3300013306 Bacteria 17557
43 Ga0157372_10012427 3300013307 Bacteria 9075
44 Ga0157375_10005402 3300013308 Bacteria 11107
45 Ga0157375_10005788 3300013308 Bacteria 10753
46 Ga0163163_10173763 3300014325 Bacteria 2201
47 Ga0157379_10244421 3300014968 Bacteria 1628
48 Ga0157376_10050785 3300014969 Bacteria 3442
49 Ga0157376_10341809 3300014969 Bacteria 1429
50 Ga0182006_1000027 3300015261 Bacteria 252946
51 Ga0182006_1000181 3300015261 Bacteria 66126
52 Ga0182007_10006080 3300015262 Bacteria 5219
53 Ga0182007_10033545 3300015262 Bacteria 1739
54 Ga0163161_10091764 3300017792 Bacteria 2248
55 Ga0163161_10197599 3300017792 Bacteria 1548
56 Ga0209672_101852 3300025228 Bacteria 6306
57 Ga0207427_101019 3300025231 Bacteria 11712
58 Ga0209437_100180 3300025233 Bacteria 133661
59 Ga0209258_100718 3300025242 Bacteria 22152
60 Ga0209148_1000005 3300025254 Bacteria 1806504
61 Ga0209148_1000995 3300025254 Bacteria 18242
62 Ga0209233_1018285 3300025261 Bacteria 1889
63 Ga0209455_1001189 3300025272 Bacteria 12439
64 Ga0209455_1003388 3300025272 Bacteria 5664
65 Ga0207692_10081074 3300025898 Bacteria 1736
66 Ga0207710_10006737 3300025900 Bacteria 4897
67 Ga0207684_10042161 3300025910 Bacteria 3868
68 Ga0207684_10048598 3300025910 Bacteria 3598
69 Ga0207684_10134868 3300025910 Bacteria 2119
70 Ga0207693_10028785 3300025915 Bacteria 4391
71 Ga0207693_10084271 3300025915 Bacteria 2490
72 Ga0207663_10300363 3300025916 Bacteria 1199
73 Ga0207646_10000736 3300025922 Bacteria 42554
74 Ga0207646_10032795 3300025922 Bacteria 4698
75 Ga0207700_10169739 3300025928 Bacteria 1819
76 Ga0207665_10010065 3300025939 Bacteria 6211
77 Ga0207711_10032088 3300025941 Bacteria 4440
78 Ga0207711_10033006 3300025941 Bacteria 4378
79 Ga0207711_10243226 3300025941 Bacteria 1650
80 Ga0207651_10245800 3300025960 Bacteria 1461
81 Ga0207658_10039383 3300025986 Bacteria 3410
82 Ga0207678_10041646 3300026067 Bacteria 3982
83 Ga0207678_10090524 3300026067 Bacteria 2615
84 Ga0207676_10165652 3300026095 Bacteria 1920
85 Ga0265338_10000258 3300028800 Bacteria 96517
86 Ga0265338_10141366 3300028800 Unclassified 1885
87 Ga0265339_10014293 3300031249 Bacteria 4787
88 Ga0373936_0007904 3300035113 Bacteria 3995
89 Ga0373945_0005388 3300035116 Bacteria 4095
90 Ga0373935_0043866 3300035692 Bacteria 2816
91 Ga0373927_0031223 3300035695 Bacteria 3473
92 Ga0373927_0203364 3300035695 Bacteria 1300
93 Ga0373927_0204513 3300035695 Bacteria 1296
94 Ga0373933_0048205 3300035724 Bacteria 2536
95 Ga0373933_0063251 3300035724 Bacteria 2237
96 Ga0373933_0114762 3300035724 Bacteria 1683
97 Ga0373947_0032228 3300035725 Bacteria 3087
98 Ga0373947_0051629 3300035725 Bacteria 2474
99 Ga0373947_0214369 3300035725 Bacteria 1264
100 Ga0373937_0084296 3300036401 Bacteria 2940
101 Ga0373937_0131886 3300036401 Bacteria 2334
102 Ga0373925_0027153 3300037068 Bacteria 4193
103 Ga0373925_0029165 3300037068 Bacteria 4047
104 Ga0373925_0141352 3300037068 Bacteria 1884
105 Ga0450908_000740 3300042184 Bacteria 6272
106 Ga0466982_0000002 3300044672 Bacteria 454900
107 Ga0466971_0002548 3300044719 Bacteria 7709
108 Ga0466968_0089977 3300044735 Bacteria 1358
109 Ga0466970_0026300 3300044765 Bacteria 3050
110 Ga0495617_000220 3300046452 Bacteria 34639
111 Ga0495617_001361 3300046452 Bacteria 10838
112 Ga0495592_0026529 3300046454 Bacteria 4392
113 Ga0495603_0000321 3300046455 Bacteria 25860
114 Ga0495603_0077696 3300046455 Bacteria 1947
115 Ga0495629_0015963 3300046459 Bacteria 5396
116 Ga0495629_0018023 3300046459 Bacteria 5061
117 Ga0495629_0018433 3300046459 Bacteria 4997
118 Ga0495638_0000049 3300046460 Bacteria 206725
119 Ga0495638_0000062 3300046460 Bacteria 188223
120 Ga0495638_0004907 3300046460 Bacteria 10052
121 Ga0495638_0009440 3300046460 Bacteria 6846
122 Ga0495638_0036798 3300046460 Bacteria 3116
123 Ga0495641_0008163 3300046461 Bacteria 6428
124 Ga0495651_0133383 3300046462 Bacteria 1811
125 Ga0495580_0062456 3300046472 Bacteria 2613
126 Ga0495582_0043468 3300046473 Bacteria 2475
127 Ga0495605_0028053 3300046474 Bacteria 2909
128 Ga0495639_0004663 3300046475 Bacteria 5887
129 Ga0495662_0005641 3300046476 Bacteria 6260
130 Ga0495664_0098982 3300046477 Bacteria 1756
131 Ga0495585_0008356 3300046492 Bacteria 6278
132 Ga0495585_0024520 3300046492 Bacteria 3458
133 Ga0495585_0034323 3300046492 Bacteria 2867
134 Ga0495585_0110117 3300046492 Bacteria 1465
135 Ga0495594_0000044 3300046499 Bacteria 54809
136 Ga0495594_0007861 3300046499 Bacteria 5484
137 Ga0495596_0003873 3300046500 Bacteria 7427
138 Ga0495596_0068227 3300046500 Bacteria 1382
139 Ga0495607_0112166 3300046501 Bacteria 1444
140 Ga0495583_0017042 3300046506 Bacteria 3873
141 Ga0495606_0000181 3300046507 Bacteria 111247
142 Ga0495620_0000461 3300046515 Bacteria 26697
143 Ga0495630_0027565 3300046517 Bacteria 4216
144 Ga0495631_0042799 3300046518 Bacteria 2000
145 Ga0495631_0063084 3300046518 Bacteria 1605
146 Ga0495631_0105971 3300046518 Bacteria 1209
147 Ga0495632_0047205 3300046519 Bacteria 2137
148 Ga0495644_0000041 3300046523 Bacteria 60975
149 Ga0495644_0030410 3300046523 Bacteria 2039
150 Ga0495648_0001919 3300046524 Bacteria 19808
151 Ga0495648_0071191 3300046524 Bacteria 2017
152 Ga0495666_0062025 3300046526 Bacteria 1786
153 Ga0495642_0013842 3300046528 Bacteria 3124
154 Ga0495665_0002545 3300046531 Bacteria 9835
155 Ga0495640_0017487 3300046533 Bacteria 5343
156 Ga0495640_0070630 3300046533 Bacteria 2345
157 Ga0495609_0012356 3300046538 Bacteria 4050
158 Ga0495597_0039375 3300046542 Bacteria 2117
159 Ga0495645_0011203 3300046543 Bacteria 6306
160 Ga0495622_0008892 3300046557 Bacteria 4653
161 Ga0495622_0016288 3300046557 Bacteria 3460
162 Ga0495622_0017158 3300046557 Bacteria 3370
163 Ga0495622_0072667 3300046557 Bacteria 1587
164 Ga0495633_0002414 3300046558 Bacteria 13209
165 Ga0495633_0003836 3300046558 Bacteria 9827
166 Ga0495668_0007762 3300046616 Bacteria 6806
167 Ga0495634_0015884 3300046642 Bacteria 5393
168 Ga0495634_0030202 3300046642 Bacteria 3745
169 Ga0495625_0013870 3300046660 Bacteria 6454
170 Ga0495625_0041092 3300046660 Bacteria 3367
171 Ga0495625_0046770 3300046660 Bacteria 3121
172 Ga0495625_0056796 3300046660 Bacteria 2785
173 Ga0495635_0034371 3300046663 Bacteria 3516
174 Ga0495635_0184150 3300046663 Bacteria 1419
175 Ga0495588_0018201 3300046674 Bacteria 3421
176 Ga0495599_0002014 3300046678 Bacteria 11751
177 Ga0495623_0027979 3300046679 Bacteria 3629
178 Ga0495647_0017164 3300046681 Bacteria 2558
179 Ga0495658_0002382 3300046683 Bacteria 9488
180 Ga0495669_0015280 3300046684 Bacteria 3287
181 Ga0495613_0002308 3300046689 Bacteria 14452
182 Ga0495613_0002505 3300046689 Bacteria 13851
183 Ga0495613_0033746 3300046689 Bacteria 3801
184 Ga0495613_0065069 3300046689 Bacteria 2665
185 Ga0495613_0196917 3300046689 Bacteria 1422
186 Ga0495624_0016425 3300046690 Bacteria 4982
187 Ga0495670_0186417 3300046691 Bacteria 1096
188 Ga0495671_0019871 3300046692 Bacteria 3545
189 Ga0495671_0026937 3300046692 Bacteria 2974
190 Ga0495649_0007710 3300046694 Bacteria 6535
191 Ga0495649_0046370 3300046694 Bacteria 2366
192 Ga0495589_0002956 3300046794 Bacteria 9362
193 Ga0495589_0003628 3300046794 Bacteria 8335
194 Ga0495660_0000078 3300046810 Bacteria 104055
195 Ga0495581_0009274 3300047315 Bacteria 5695
196 Ga0495581_0042625 3300047315 Bacteria 2626
197 Ga0495581_0076094 3300047315 Bacteria 1942
198 Ga0495674_0015507 3300047319 Bacteria 7120
199 Ga0495674_0102316 3300047319 Bacteria 2436
200 Ga0495672_0000346 3300047320 Bacteria 59410
201 Ga0495672_0011406 3300047320 Bacteria 6276
202 Ga0495676_0057656 3300047321 Bacteria 3061
203 Ga0495683_0130103 3300047323 Bacteria 1188
204 Ga0495679_048154 3300047446 Bacteria 1290
205 Ga0495673_0000001 3300047469 Bacteria 1630730
206 Ga0495673_0000010 3300047469 Bacteria 709599
207 Ga0495684_0243643 3300047471 Bacteria 1310
208 Ga0495686_0000105 3300047472 Bacteria 176098
209 Ga0495686_0000440 3300047472 Bacteria 63165
210 Ga0495686_0000576 3300047472 Bacteria 52136
211 Ga0495686_0002216 3300047472 Bacteria 18870
212 Ga0495686_0034095 3300047472 Bacteria 3281
213 Ga0495686_0067399 3300047472 Bacteria 2209
214 Ga0495593_0009057 3300047673 Bacteria 5775
215 Ga0495614_0008732 3300048089 Bacteria 4502
216 Ga0495614_0019587 3300048089 Bacteria 2928
217 Ga0496101_0003285 3300048904 Bacteria 10054
218 Ga0496101_0246805 3300048904 Bacteria 1390
219 Ga0496102_0004927 3300048905 Bacteria 11312
220 Ga0496102_0020605 3300048905 Bacteria 5827
221 Ga0496104_0032165 3300048907 Bacteria 4881
222 Ga0496104_0101225 3300048907 Bacteria 2758
223 Ga0496105_0006788 3300048908 Bacteria 8801
224 Ga0496105_0043828 3300048908 Bacteria 3690
225 Ga0496105_0073222 3300048908 Bacteria 2831
226 Ga0496106_0151419 3300048909 Bacteria 1830
227 Ga0496106_0254970 3300048909 Bacteria 1403
228 Ga0496107_0013544 3300048910 Bacteria 5701
229 Ga0496107_0032567 3300048910 Bacteria 3726
230 Ga0496110_0104065 3300048913 Bacteria 2547
231 Ga0496110_0227726 3300048913 Bacteria 1695
232 Ga0496112_0035115 3300048915 Bacteria 4880
233 Ga0496113_0006713 3300048916 Bacteria 7329
234 Ga0496113_0204469 3300048916 Bacteria 1570
235 Ga0496114_0131026 3300048917 Bacteria 2165
236 Ga0496115_0000096 3300048918 Bacteria 82735
237 Ga0496115_0039098 3300048918 Bacteria 3767
238 Ga0496115_0128205 3300048918 Bacteria 2090
239 Ga0496115_0284010 3300048918 Bacteria 1358
240 Ga0496119_0065373 3300048922 Bacteria 2154
241 Ga0496120_0011303 3300048923 Bacteria 6147
242 Ga0496121_0002184 3300048924 Bacteria 30622
243 Ga0496121_0006812 3300048924 Bacteria 13995
244 Ga0496121_0022765 3300048924 Bacteria 6061
245 Ga0496121_0270277 3300048924 Bacteria 1169
246 Ga0496125_0140172 3300048928 Bacteria 1683
247 Ga0496126_0003232 3300048929 Bacteria 20840
248 Ga0496126_0045138 3300048929 Bacteria 4053
249 Ga0496126_0070077 3300048929 Bacteria 3125
250 Ga0496126_0117127 3300048929 Bacteria 2315
251 Ga0495678_015884 3300049459 Bacteria 3455
252 Ga0495682_0000540 3300049460 Bacteria 26138
253 Ga0495682_0000694 3300049460 Bacteria 22096
254 Ga0501034_0249671 3300049571 Bacteria 1719
255 Ga0501068_0033487 3300049584 Bacteria 3060
256 Ga0501080_0083651 3300049742 Bacteria 2965
257 Ga0501044_0033717 3300049823 Bacteria 5377
258 Ga0495601_0006095 3300053077 Bacteria 7035
259 Ga0495612_0004289 3300053078 Bacteria 5919
260 Ga0495619_0015190 3300053085 Bacteria 4867
261 Ga0500578_0063154 3300053086 Bacteria 2363
262 Ga0500651_0054028 3300053093 Bacteria 2519
263 Ga0500640_055519 3300053095 Bacteria 1725
264 Ga0500572_000465 3300053111 Bacteria 14081
265 Ga0500595_002366 3300053119 Bacteria 9421
266 Ga0500595_002699 3300053119 Bacteria 8602
267 Ga0500595_003460 3300053119 Bacteria 7356
268 Ga0500595_008469 3300053119 Unclassified 4197
269 Ga0500614_001232 3300053123 Bacteria 6229
270 Ga0500655_001603 3300053133 Bacteria 4273
271 Ga0500559_0001191 3300053136 Bacteria 15465
272 Ga0500559_0005167 3300053136 Bacteria 6027
273 Ga0500573_0173122 3300053140 Bacteria 1166
274 Ga0500616_0045792 3300053153 Bacteria 2329
275 Ga0500639_053330 3300053163 Bacteria 2104
276 Ga0500636_0000047 3300053177 Bacteria 62796
277 Ga0500596_000165 3300053735 Bacteria 10394
278 Ga0500601_000032 3300053737 Bacteria 31109
279 Ga0501082_0036172 3300060353 Bacteria 4254

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100170773 Ga0068855_1001707733 299
2 3300049571 Ga0501034_0249671 Ga0501034_0249671_108_1139 303
3 3300005293 Ga0065715_10089138 Ga0065715_100891389 304
4 3300053119 Ga0500595_002699 Ga0500595_002699_6362_7390 308
5 3300048913 Ga0496110_0227726 Ga0496110_0227726_138_1172 310
6 iso_pu_bacteria 8019608314 8019615423 311
7 3300006358 Ga0068871_100166772 Ga0068871_1001667722 312
8 3300046678 Ga0495599_0002014 Ga0495599_0002014_7498_8538 313
9 3300046679 Ga0495623_0027979 Ga0495623_0027979_362_1402 313
10 3300047472 Ga0495686_0000576 Ga0495686_0000576_21060_22106 316
11 3300053111 Ga0500572_000465 Ga0500572_000465_7449_8486 316
12 3300053136 Ga0500559_0001191 Ga0500559_0001191_8187_9224 316
13 3300053163 Ga0500639_053330 Ga0500639_053330_531_1568 316
14 3300053735 Ga0500596_000165 Ga0500596_000165_7757_8794 316
15 3300047472 Ga0495686_0002216 Ga0495686_0002216_8740_9774 318
16 3300053119 Ga0500595_003460 Ga0500595_003460_1795_2859 319
17 3300013296 Ga0157374_10178997 Ga0157374_101789972 320
18 3300013297 Ga0157378_10071258 Ga0157378_100712583 320
19 3300014969 Ga0157376_10050785 Ga0157376_100507853 320
20 3300046492 Ga0495585_0008356 Ga0495585_0008356_3655_4638 320
21 3300053095 Ga0500640_055519 Ga0500640_055519_551_1588 320
22 3300053136 Ga0500559_0005167 Ga0500559_0005167_3786_4823 320
23 3300048924 Ga0496121_0270277 Ga0496121_0270277_77_1066 321
24 3300047320 Ga0495672_0000346 Ga0495672_0000346_48229_49260 322
25 iso_pu_bacteria 8056967851 8056968894 322
26 3300025960 Ga0207651_10245800 Ga0207651_102458002 324
27 iso_pu_bacteria 2824661429 2824664694 324
28 iso_pu_bacteria 2879099564 2879109929 324
29 iso_pu_bacteria 2883354860 2883356614 324
30 iso_pu_bacteria 2922368715 2922372265 324
31 iso_pu_bacteria 2929615660 2929616531 324
32 iso_pu_bacteria 2929624759 2929625275 324
33 iso_pu_bacteria 2932784394 2932786793 324
34 iso_pu_bacteria 2932809354 2932818033 324
35 iso_pu_bacteria 2932818245 2932827828 324
36 iso_pu_bacteria 2932828146 2932832617 324
37 iso_pu_bacteria 2933577622 2933578186 324
38 iso_pu_bacteria 2935616580 2935619318 324
39 iso_pu_bacteria 2935638405 2935645295 324
40 iso_pu_bacteria 2935665750 2935671393 324
41 iso_pu_bacteria 2935675223 2935683757 324
42 iso_pu_bacteria 2935684952 2935691944 324
43 iso_pu_bacteria 2935703347 2935708032 324
44 iso_pu_bacteria 2935713505 2935721783 324
45 iso_pu_bacteria 2935722832 2935731219 324
46 iso_pu_bacteria 2935732158 2935738919 324
47 iso_pu_bacteria 2935741537 2935747896 324
48 iso_pu_bacteria 2935750917 2935756480 324
49 iso_pu_bacteria 2935760218 2935761538 324
50 iso_pu_bacteria 2935801545 2935804981 324
51 iso_pu_bacteria 2935810662 2935812145 324
52 iso_pu_bacteria 2935827899 2935834862 324
53 iso_pu_bacteria 2935837841 2935838927 324
54 iso_pu_bacteria 2935855204 2935857683 324
55 iso_pu_bacteria 2935864058 2935873314 324
56 iso_pu_bacteria 2935873716 2935882905 324
57 iso_pu_bacteria 2935992306 2935997449 324
58 iso_pu_bacteria 2936002035 2936005230 324
59 iso_pu_bacteria 2936037263 2936038739 324
60 iso_pu_bacteria 2940556831 2940562394 324
61 iso_pu_bacteria 2941538514 2941539616 324
62 iso_pu_bacteria 8017057580 8017061036 324
63 iso_pu_bacteria 8019576017 8019580507 324
64 iso_pu_bacteria 8019597564 8019603111 324
65 iso_pu_bacteria 8055742211 8055748177 324
66 3300044672 Ga0466982_0000002 Ga0466982_0000002_269329_270357 325
67 3300044719 Ga0466971_0002548 Ga0466971_0002548_3276_4304 325
68 3300044735 Ga0466968_0089977 Ga0466968_0089977_205_1233 325
69 3300044765 Ga0466970_0026300 Ga0466970_0026300_123_1151 325
70 3300046460 Ga0495638_0000062 Ga0495638_0000062_60901_61929 325
71 3300046557 Ga0495622_0072667 Ga0495622_0072667_518_1546 325
72 3300046660 Ga0495625_0046770 Ga0495625_0046770_1757_2785 325
73 3300046694 Ga0495649_0007710 Ga0495649_0007710_3433_4461 325
74 3300047472 Ga0495686_0000440 Ga0495686_0000440_5055_6083 325
75 3300048918 Ga0496115_0000096 Ga0496115_0000096_17632_18660 325
76 3300048929 Ga0496126_0003232 Ga0496126_0003232_6571_7599 325
77 iso_pu_bacteria 2517572143 2517894197 325
78 iso_pu_bacteria 2739367700 2739733077 325
79 iso_pu_bacteria 2821443989 2821448275 325
80 iso_pu_bacteria 2932784394 2932793368 325
81 3300046452 Ga0495617_001361 Ga0495617_001361_8008_9039 326
82 3300046455 Ga0495603_0077696 Ga0495603_0077696_407_1432 326
83 3300046492 Ga0495585_0024520 Ga0495585_0024520_1361_2392 326
84 3300046519 Ga0495632_0047205 Ga0495632_0047205_148_1155 326
85 3300046526 Ga0495666_0062025 Ga0495666_0062025_92_1177 326
86 3300046558 Ga0495633_0002414 Ga0495633_0002414_9864_10895 326
87 3300046692 Ga0495671_0019871 Ga0495671_0019871_1075_2106 326
88 3300047472 Ga0495686_0000105 Ga0495686_0000105_130253_131260 326
89 3300049460 Ga0495682_0000694 Ga0495682_0000694_14653_15684 326
90 3300028800 Ga0265338_10141366 Ga0265338_101413662 327
91 3300046616 Ga0495668_0007762 Ga0495668_0007762_1537_2577 327
92 3300053153 Ga0500616_0045792 Ga0500616_0045792_240_1334 327
93 3300003762 Ga0055542_1000010 Ga0055542_1000010190 328
94 3300005367 Ga0070667_100038986 Ga0070667_1000389863 328
95 3300005434 Ga0070709_10048541 Ga0070709_100485413 328
96 3300005467 Ga0070706_100053488 Ga0070706_1000534882 328
97 3300005471 Ga0070698_100084748 Ga0070698_1000847483 328
98 3300006173 Ga0070716_100001567 Ga0070716_1000015677 328
99 3300006175 Ga0070712_100217159 Ga0070712_1002171592 328
100 3300009177 Ga0105248_10008540 Ga0105248_100085403 328
101 3300013306 Ga0163162_10002427 Ga0163162_1000242714 328
102 3300013308 Ga0157375_10005788 Ga0157375_100057883 328
103 3300015261 Ga0182006_1000181 Ga0182006_100018140 328
104 3300015262 Ga0182007_10033545 Ga0182007_100335452 328
105 3300017792 Ga0163161_10197599 Ga0163161_101975993 328
106 3300025228 Ga0209672_101852 Ga0209672_1018522 328
107 3300025231 Ga0207427_101019 Ga0207427_1010199 328
108 3300025233 Ga0209437_100180 Ga0209437_10018057 328
109 3300025242 Ga0209258_100718 Ga0209258_1007183 328
110 3300025254 Ga0209148_1000005 Ga0209148_1000005155 328
111 3300025254 Ga0209148_1000995 Ga0209148_100099519 328
112 3300025261 Ga0209233_1018285 Ga0209233_10182851 328
113 3300025272 Ga0209455_1001189 Ga0209455_10011896 328
114 3300025272 Ga0209455_1003388 Ga0209455_10033884 328
115 3300025910 Ga0207684_10048598 Ga0207684_100485984 328
116 3300025915 Ga0207693_10084271 Ga0207693_100842712 328
117 3300025941 Ga0207711_10033006 Ga0207711_100330062 328
118 3300025986 Ga0207658_10039383 Ga0207658_100393832 328
119 3300026067 Ga0207678_10041646 Ga0207678_100416462 328
120 3300026067 Ga0207678_10090524 Ga0207678_100905243 328
121 3300035724 Ga0373933_0063251 Ga0373933_0063251_1128_2159 328
122 3300042184 Ga0450908_000740 Ga0450908_000740_5003_6037 328
123 3300046460 Ga0495638_0000049 Ga0495638_0000049_48253_49239 328
124 3300046460 Ga0495638_0000062 Ga0495638_0000062_56774_57808 328
125 3300046460 Ga0495638_0004907 Ga0495638_0004907_6352_7338 328
126 3300046462 Ga0495651_0133383 Ga0495651_0133383_383_1375 328
127 3300046474 Ga0495605_0028053 Ga0495605_0028053_1754_2740 328
128 3300046492 Ga0495585_0110117 Ga0495585_0110117_395_1381 328
129 3300046500 Ga0495596_0068227 Ga0495596_0068227_150_1136 328
130 3300046518 Ga0495631_0105971 Ga0495631_0105971_196_1182 328
131 3300046523 Ga0495644_0030410 Ga0495644_0030410_946_1932 328
132 3300046557 Ga0495622_0008892 Ga0495622_0008892_2453_3487 328
133 3300046660 Ga0495625_0041092 Ga0495625_0041092_1337_2371 328
134 3300046660 Ga0495625_0056796 Ga0495625_0056796_164_1150 328
135 3300046674 Ga0495588_0018201 Ga0495588_0018201_740_1771 328
136 3300046689 Ga0495613_0002308 Ga0495613_0002308_10966_11952 328
137 3300046692 Ga0495671_0026937 Ga0495671_0026937_1299_2285 328
138 3300046694 Ga0495649_0046370 Ga0495649_0046370_1144_2178 328
139 3300046794 Ga0495589_0002956 Ga0495589_0002956_4898_5884 328
140 3300047320 Ga0495672_0011406 Ga0495672_0011406_826_1860 328
141 3300047446 Ga0495679_048154 Ga0495679_048154_103_1089 328
142 3300047472 Ga0495686_0034095 Ga0495686_0034095_245_1279 328
143 3300048904 Ga0496101_0003285 Ga0496101_0003285_4743_5729 328
144 3300048904 Ga0496101_0246805 Ga0496101_0246805_336_1322 328
145 3300048905 Ga0496102_0020605 Ga0496102_0020605_4479_5465 328
146 3300048907 Ga0496104_0032165 Ga0496104_0032165_58_1044 328
147 3300048908 Ga0496105_0006788 Ga0496105_0006788_3086_4120 328
148 3300048908 Ga0496105_0073222 Ga0496105_0073222_701_1738 328
149 3300048910 Ga0496107_0032567 Ga0496107_0032567_2447_3433 328
150 3300048916 Ga0496113_0006713 Ga0496113_0006713_4214_5200 328
151 3300048916 Ga0496113_0204469 Ga0496113_0204469_466_1500 328
152 3300048918 Ga0496115_0000096 Ga0496115_0000096_13507_14541 328
153 3300048918 Ga0496115_0284010 Ga0496115_0284010_279_1313 328
154 3300048922 Ga0496119_0065373 Ga0496119_0065373_951_1985 328
155 3300048923 Ga0496120_0011303 Ga0496120_0011303_4177_5211 328
156 3300048924 Ga0496121_0002184 Ga0496121_0002184_1000_2034 328
157 3300048928 Ga0496125_0140172 Ga0496125_0140172_492_1526 328
158 3300048929 Ga0496126_0003232 Ga0496126_0003232_2446_3480 328
159 3300048929 Ga0496126_0070077 Ga0496126_0070077_1939_2973 328
160 3300049459 Ga0495678_015884 Ga0495678_015884_1410_2444 328
161 3300049742 Ga0501080_0083651 Ga0501080_0083651_1944_2930 328
162 3300053123 Ga0500614_001232 Ga0500614_001232_4289_5320 328
163 3300053177 Ga0500636_0000047 Ga0500636_0000047_11866_12897 328
164 iso_pu_bacteria 2513237141 2513893865 328
165 iso_pu_bacteria 2739367700 2739733079 328
166 3300003322 rootL2_10204211 rootL2_102042112 329
167 3300005344 Ga0070661_100310296 Ga0070661_1003102961 329
168 3300005355 Ga0070671_100011929 Ga0070671_1000119295 329
169 3300005364 Ga0070673_100231436 Ga0070673_1002314362 329
170 3300005367 Ga0070667_100074591 Ga0070667_1000745911 329
171 3300005455 Ga0070663_100028250 Ga0070663_1000282501 329
172 3300005617 Ga0068859_100337387 Ga0068859_1003373872 329
173 3300006931 Ga0097620_100337395 Ga0097620_1003373952 329
174 3300006944 Ga0099823_1042042 Ga0099823_10420422 329
175 3300009011 Ga0105251_10037859 Ga0105251_100378593 329
176 3300009101 Ga0105247_10005629 Ga0105247_100056293 329
177 3300009177 Ga0105248_10017835 Ga0105248_100178351 329
178 3300009551 Ga0105238_10019803 Ga0105238_100198038 329
179 3300009551 Ga0105238_10021253 Ga0105238_100212536 329
180 3300013104 Ga0157370_10289384 Ga0157370_102893841 329
181 3300013105 Ga0157369_10125224 Ga0157369_101252242 329
182 3300013296 Ga0157374_10051114 Ga0157374_100511142 329
183 3300013297 Ga0157378_10389884 Ga0157378_103898841 329
184 3300013306 Ga0163162_10000297 Ga0163162_1000029713 329
185 3300013308 Ga0157375_10005402 Ga0157375_100054023 329
186 3300014325 Ga0163163_10173763 Ga0163163_101737632 329
187 3300014968 Ga0157379_10244421 Ga0157379_102444211 329
188 3300014969 Ga0157376_10341809 Ga0157376_103418091 329
189 3300015261 Ga0182006_1000027 Ga0182006_1000027105 329
190 3300015262 Ga0182007_10006080 Ga0182007_100060804 329
191 3300017792 Ga0163161_10091764 Ga0163161_100917642 329
192 3300025900 Ga0207710_10006737 Ga0207710_100067374 329
193 3300025941 Ga0207711_10032088 Ga0207711_100320881 329
194 3300025941 Ga0207711_10243226 Ga0207711_102432262 329
195 3300026095 Ga0207676_10165652 Ga0207676_101656521 329
196 3300028800 Ga0265338_10000258 Ga0265338_1000025880 329
197 3300031249 Ga0265339_10014293 Ga0265339_100142933 329
198 3300035113 Ga0373936_0007904 Ga0373936_0007904_1707_2720 329
199 3300035116 Ga0373945_0005388 Ga0373945_0005388_198_1241 329
200 3300035692 Ga0373935_0043866 Ga0373935_0043866_60_1103 329
201 3300035695 Ga0373927_0031223 Ga0373927_0031223_347_1390 329
202 3300035695 Ga0373927_0203364 Ga0373927_0203364_153_1202 329
203 3300035695 Ga0373927_0204513 Ga0373927_0204513_220_1215 329
204 3300035724 Ga0373933_0048205 Ga0373933_0048205_356_1405 329
205 3300035724 Ga0373933_0114762 Ga0373933_0114762_48_1169 329
206 3300035725 Ga0373947_0032228 Ga0373947_0032228_761_1882 329
207 3300035725 Ga0373947_0051629 Ga0373947_0051629_1354_2397 329
208 3300035725 Ga0373947_0214369 Ga0373947_0214369_179_1174 329
209 3300036401 Ga0373937_0084296 Ga0373937_0084296_977_2098 329
210 3300036401 Ga0373937_0131886 Ga0373937_0131886_823_1872 329
211 3300037068 Ga0373925_0027153 Ga0373925_0027153_1159_2202 329
212 3300037068 Ga0373925_0029165 Ga0373925_0029165_1160_2281 329
213 3300037068 Ga0373925_0141352 Ga0373925_0141352_790_1833 329
214 3300046452 Ga0495617_000220 Ga0495617_000220_22082_23122 329
215 3300046454 Ga0495592_0026529 Ga0495592_0026529_2967_4088 329
216 3300046455 Ga0495603_0000321 Ga0495603_0000321_13111_14169 329
217 3300046459 Ga0495629_0015963 Ga0495629_0015963_1216_2337 329
218 3300046459 Ga0495629_0018023 Ga0495629_0018023_205_1197 329
219 3300046459 Ga0495629_0018433 Ga0495629_0018433_2556_3599 329
220 3300046460 Ga0495638_0009440 Ga0495638_0009440_145_1194 329
221 3300046460 Ga0495638_0036798 Ga0495638_0036798_1122_2165 329
222 3300046461 Ga0495641_0008163 Ga0495641_0008163_4112_5233 329
223 3300046472 Ga0495580_0062456 Ga0495580_0062456_1195_2316 329
224 3300046473 Ga0495582_0043468 Ga0495582_0043468_963_1961 329
225 3300046475 Ga0495639_0004663 Ga0495639_0004663_3593_4714 329
226 3300046476 Ga0495662_0005641 Ga0495662_0005641_3993_5114 329
227 3300046477 Ga0495664_0098982 Ga0495664_0098982_149_1270 329
228 3300046492 Ga0495585_0034323 Ga0495585_0034323_488_1537 329
229 3300046499 Ga0495594_0000044 Ga0495594_0000044_17090_18148 329
230 3300046499 Ga0495594_0007861 Ga0495594_0007861_3181_4302 329
231 3300046500 Ga0495596_0003873 Ga0495596_0003873_646_1704 329
232 3300046501 Ga0495607_0112166 Ga0495607_0112166_133_1182 329
233 3300046506 Ga0495583_0017042 Ga0495583_0017042_1874_2932 329
234 3300046507 Ga0495606_0000181 Ga0495606_0000181_45323_46363 329
235 3300046515 Ga0495620_0000461 Ga0495620_0000461_14122_15162 329
236 3300046517 Ga0495630_0027565 Ga0495630_0027565_1158_2201 329
237 3300046518 Ga0495631_0042799 Ga0495631_0042799_719_1777 329
238 3300046518 Ga0495631_0063084 Ga0495631_0063084_135_1175 329
239 3300046523 Ga0495644_0000041 Ga0495644_0000041_40124_41182 329
240 3300046524 Ga0495648_0001919 Ga0495648_0001919_11987_13060 329
241 3300046524 Ga0495648_0071191 Ga0495648_0071191_147_1205 329
242 3300046528 Ga0495642_0013842 Ga0495642_0013842_565_1623 329
243 3300046531 Ga0495665_0002545 Ga0495665_0002545_7513_8634 329
244 3300046533 Ga0495640_0017487 Ga0495640_0017487_3926_4969 329
245 3300046533 Ga0495640_0070630 Ga0495640_0070630_276_1397 329
246 3300046538 Ga0495609_0012356 Ga0495609_0012356_345_1403 329
247 3300046542 Ga0495597_0039375 Ga0495597_0039375_121_1170 329
248 3300046543 Ga0495645_0011203 Ga0495645_0011203_4709_5752 329
249 3300046557 Ga0495622_0016288 Ga0495622_0016288_1262_2449 329
250 3300046557 Ga0495622_0017158 Ga0495622_0017158_1103_2224 329
251 3300046558 Ga0495633_0003836 Ga0495633_0003836_2533_3591 329
252 3300046642 Ga0495634_0015884 Ga0495634_0015884_1037_2158 329
253 3300046642 Ga0495634_0030202 Ga0495634_0030202_128_1171 329
254 3300046660 Ga0495625_0013870 Ga0495625_0013870_1869_2927 329
255 3300046663 Ga0495635_0034371 Ga0495635_0034371_615_1736 329
256 3300046663 Ga0495635_0184150 Ga0495635_0184150_184_1227 329
257 3300046681 Ga0495647_0017164 Ga0495647_0017164_265_1386 329
258 3300046683 Ga0495658_0002382 Ga0495658_0002382_7150_8271 329
259 3300046684 Ga0495669_0015280 Ga0495669_0015280_2082_3131 329
260 3300046689 Ga0495613_0002505 Ga0495613_0002505_10949_12136 329
261 3300046689 Ga0495613_0033746 Ga0495613_0033746_207_1328 329
262 3300046689 Ga0495613_0065069 Ga0495613_0065069_45_1043 329
263 3300046689 Ga0495613_0196917 Ga0495613_0196917_210_1202 329
264 3300046690 Ga0495624_0016425 Ga0495624_0016425_1565_2686 329
265 3300046691 Ga0495670_0186417 Ga0495670_0186417_19_1068 329
266 3300046794 Ga0495589_0003628 Ga0495589_0003628_3767_4816 329
267 3300046810 Ga0495660_0000078 Ga0495660_0000078_13860_14900 329
268 3300047315 Ga0495581_0009274 Ga0495581_0009274_3359_4480 329
269 3300047315 Ga0495581_0042625 Ga0495581_0042625_108_1295 329
270 3300047315 Ga0495581_0076094 Ga0495581_0076094_912_1910 329
271 3300047319 Ga0495674_0015507 Ga0495674_0015507_3140_4183 329
272 3300047319 Ga0495674_0102316 Ga0495674_0102316_128_1249 329
273 3300047321 Ga0495676_0057656 Ga0495676_0057656_776_1897 329
274 3300047323 Ga0495683_0130103 Ga0495683_0130103_10_1068 329
275 3300047469 Ga0495673_0000001 Ga0495673_0000001_1451067_1452107 329
276 3300047469 Ga0495673_0000010 Ga0495673_0000010_290253_291293 329
277 3300047471 Ga0495684_0243643 Ga0495684_0243643_55_1098 329
278 3300047472 Ga0495686_0067399 Ga0495686_0067399_901_1941 329
279 3300047673 Ga0495593_0009057 Ga0495593_0009057_3439_4560 329
280 3300048089 Ga0495614_0008732 Ga0495614_0008732_237_1424 329
281 3300048089 Ga0495614_0019587 Ga0495614_0019587_644_1765 329
282 3300048905 Ga0496102_0004927 Ga0496102_0004927_4638_5687 329
283 3300048907 Ga0496104_0101225 Ga0496104_0101225_1633_2736 329
284 3300048908 Ga0496105_0043828 Ga0496105_0043828_1477_2580 329
285 3300048909 Ga0496106_0151419 Ga0496106_0151419_279_1328 329
286 3300048909 Ga0496106_0254970 Ga0496106_0254970_226_1329 329
287 3300048910 Ga0496107_0013544 Ga0496107_0013544_2230_3222 329
288 3300048913 Ga0496110_0104065 Ga0496110_0104065_35_1027 329
289 3300048915 Ga0496112_0035115 Ga0496112_0035115_2467_3510 329
290 3300048917 Ga0496114_0131026 Ga0496114_0131026_1059_2051 329
291 3300048918 Ga0496115_0039098 Ga0496115_0039098_164_1207 329
292 3300048918 Ga0496115_0128205 Ga0496115_0128205_263_1312 329
293 3300048924 Ga0496121_0006812 Ga0496121_0006812_8072_9112 329
294 3300048924 Ga0496121_0022765 Ga0496121_0022765_1455_2495 329
295 3300048929 Ga0496126_0117127 Ga0496126_0117127_715_1755 329
296 3300049460 Ga0495682_0000540 Ga0495682_0000540_19031_20071 329
297 3300049584 Ga0501068_0033487 Ga0501068_0033487_1907_2905 329
298 3300049823 Ga0501044_0033717 Ga0501044_0033717_3533_4531 329
299 3300053077 Ga0495601_0006095 Ga0495601_0006095_4795_5838 329
300 3300053078 Ga0495612_0004289 Ga0495612_0004289_4802_5845 329
301 3300053085 Ga0495619_0015190 Ga0495619_0015190_254_1297 329
302 3300053119 Ga0500595_002366 Ga0500595_002366_7928_8977 329
303 3300053119 Ga0500595_008469 Ga0500595_008469_1737_2735 329
304 3300053133 Ga0500655_001603 Ga0500655_001603_316_1356 329
305 3300053737 Ga0500601_000032 Ga0500601_000032_7497_8534 329
306 3300060353 Ga0501082_0036172 Ga0501082_0036172_3186_4184 329
307 iso_pu_bacteria 2508501128 2509154449 329
308 iso_pu_bacteria 2824753945 2824757602 329
309 iso_pu_bacteria 2824763712 2824764192 329
310 iso_pu_bacteria 2904711408 2904713419 329
311 iso_pu_bacteria 8005301065 8005306224 329
312 iso_pu_bacteria 8005688590 8005694079 329
313 iso_pu_bacteria 8006933436 8006941681 329
314 iso_pu_bacteria 8006973647 8006981395 329
315 2162886011 MRS1b_contig_948318 MRS1b_0941.00000020 330
316 2162886012 MBSR1b_contig_868394 MBSR1b_0808.00005170 330
317 3300005293 Ga0065715_10105464 Ga0065715_101054642 330
318 3300005445 Ga0070708_100054788 Ga0070708_1000547882 330
319 3300005467 Ga0070706_100024613 Ga0070706_1000246139 330
320 3300005467 Ga0070706_100031383 Ga0070706_1000313833 330
321 3300005468 Ga0070707_100000407 Ga0070707_10000040743 330
322 3300005468 Ga0070707_100025054 Ga0070707_1000250545 330
323 3300005983 Ga0081540_1000785 Ga0081540_100078524 330
324 3300013307 Ga0157372_10012427 Ga0157372_100124279 330
325 3300025898 Ga0207692_10081074 Ga0207692_100810741 330
326 3300025910 Ga0207684_10042161 Ga0207684_100421611 330
327 3300025910 Ga0207684_10134868 Ga0207684_101348683 330
328 3300025915 Ga0207693_10028785 Ga0207693_100287852 330
329 3300025916 Ga0207663_10300363 Ga0207663_103003631 330
330 3300025922 Ga0207646_10000736 Ga0207646_100007368 330
331 3300025922 Ga0207646_10032795 Ga0207646_100327953 330
332 3300025928 Ga0207700_10169739 Ga0207700_101697392 330
333 3300025939 Ga0207665_10010065 Ga0207665_100100656 330
334 3300048929 Ga0496126_0045138 Ga0496126_0045138_243_1289 330
335 3300053086 Ga0500578_0063154 Ga0500578_0063154_831_1832 330
336 3300053093 Ga0500651_0054028 Ga0500651_0054028_1176_2177 330
337 3300053140 Ga0500573_0173122 Ga0500573_0173122_100_1104 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

159

368

0.97

PF20434

BD-FAE

BD-FAE

144

280

0.89

PF00326

Peptidase_S9

Prolyl oligopeptidase family

208

374

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yc0-assembly2.cif.gz_C-2 acetylesterase (lgesti) w.t. 0.9427 18 328
4ou4-assembly1.cif.gz_A-2 crystal structure of esterase rppe mutant s159a complexed with (s)-ac-cpa 0.9415 15 330
4ob7-assembly1.cif.gz_A-2 crystal structure of esterase rppe mutant w187h 0.9405 15 330
4ob8-assembly1.cif.gz_A-2 crystal structure of a novel thermostable esterase from pseudomonas putida ecu1011 0.9405 15 330
4ou5-assembly1.cif.gz_A crystal structure of esterase rppe mutant s159a/w187h 0.9398 15 330
ID Description Score Start End Superfamily
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9405 15 330 3.40.50.1820
3aikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9293 45 327 3.40.50.1820
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9292 15 330 3.40.50.1820
af_Q54L36_11_325_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9287 24 328 3.40.50.1820
4v2iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9215 18 329 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A136QGY0-F1-model_v4 deleted 0.9655 146 328
AF-A0A136QGY0-F1-model_v4 deleted 0.9604 146 328
AF-A0A165J9X0-F1-model_v4 Alpha/beta hydrolase fold-3 0.9509 103 327 GO:0016787
AF-A0A4U9HKL8-F1-model_v4 Lipase 2 (EC 3.1.1.3) 0.9498 190 328 GO:0004806
AF-A0A0D5BJU0-F1-model_v4 deleted 0.948 95 329

Feature Viewer

pLDDT pTM Quality
87.69 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map