F413079
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 230 | 279 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10051114|Ga0157374_100511142 |
| Length | 395 |
| Sequence | LDEPAFQRHAERIAVKVLQARVRRVFKEWRNPMTTAKSSHEAAMQKGYRSKGVRALTTFTLGGIIAMTQLAAAQTPNAATDDRIDPQVRAFLAELNKASSPFWELPQPKPQEILTALQNQTPVDMSGVTTVEKTITQDRRTVKLYIMTPQHPAPKPGVLLFIHGGVWIVGNFQNHQRLLRDLVVGSGQVGVFVEYTPLPAAVFPTQLEESYAALKWVAAHAQEFGADGTRIAIAGNSVGGNMTAALTLMAKDRRGPKIAYQVLFIPATDASVDTDSYHEFGTGRFLARDFMKYGWDLYAPDHKTRNNPYVSPLRATTEELQGLPPALVITAENDPLREEGEAYARKLKDAGVPVTATRYNGMIHDFVLLNAIHEVPGVQTALREATDGIREALKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 7 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 8 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 9 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 10 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 11 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 12 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 13 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 14 | 2922368715 | |||
| 15 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 16 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 17 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 18 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 19 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 20 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 21 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 22 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 23 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 24 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 25 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 26 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 27 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 28 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 29 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 30 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 31 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 32 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 33 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 34 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 35 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 36 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 37 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 38 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 39 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 40 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 41 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 42 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 43 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 44 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 45 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 46 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 47 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 107 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 108 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 110 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 111 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 112 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 115 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 116 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 117 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 118 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 119 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 189 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 190 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 191 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 192 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 193 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 194 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 195 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 196 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 197 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 207 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 208 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 209 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 210 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 211 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 212 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 213 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 214 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 215 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 216 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 217 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 219 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 220 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 222 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 223 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 224 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 225 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 226 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 227 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 228 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 229 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 230 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.93 |
| Metatranscriptomes | 0 |
| Isolates | 16.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.31 |
| Nodule | 13.65 |
| Rhizoplane | 7.12 |
| Rhizosphere | 64.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_948318 | 2162886011 | Bacteria | 2099 |
| 2 | MBSR1b_contig_868394 | 2162886012 | Bacteria | 1871 |
| 3 | rootL2_10204211 | 3300003322 | Bacteria | 2106 |
| 4 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 5 | Ga0065715_10089138 | 3300005293 | Bacteria | 13651 |
| 6 | Ga0065715_10105464 | 3300005293 | Bacteria | 2891 |
| 7 | Ga0070661_100310296 | 3300005344 | Bacteria | 1230 |
| 8 | Ga0070671_100011929 | 3300005355 | Bacteria | 6990 |
| 9 | Ga0070673_100231436 | 3300005364 | Bacteria | 1603 |
| 10 | Ga0070667_100038986 | 3300005367 | Bacteria | 3983 |
| 11 | Ga0070667_100074591 | 3300005367 | Bacteria | 2894 |
| 12 | Ga0070709_10048541 | 3300005434 | Bacteria | 2649 |
| 13 | Ga0070708_100054788 | 3300005445 | Bacteria | 3544 |
| 14 | Ga0070663_100028250 | 3300005455 | Bacteria | 3817 |
| 15 | Ga0070706_100024613 | 3300005467 | Bacteria | 5542 |
| 16 | Ga0070706_100031383 | 3300005467 | Bacteria | 4900 |
| 17 | Ga0070706_100053488 | 3300005467 | Bacteria | 3726 |
| 18 | Ga0070707_100000407 | 3300005468 | Bacteria | 42543 |
| 19 | Ga0070707_100025054 | 3300005468 | Bacteria | 5658 |
| 20 | Ga0070698_100084748 | 3300005471 | Bacteria | 3157 |
| 21 | Ga0068855_100170773 | 3300005563 | Bacteria | 2463 |
| 22 | Ga0068859_100337387 | 3300005617 | Bacteria | 1601 |
| 23 | Ga0081540_1000785 | 3300005983 | Bacteria | 29131 |
| 24 | Ga0070716_100001567 | 3300006173 | Bacteria | 10266 |
| 25 | Ga0070712_100217159 | 3300006175 | Bacteria | 1511 |
| 26 | Ga0068871_100166772 | 3300006358 | Bacteria | 1886 |
| 27 | Ga0097620_100337395 | 3300006931 | Bacteria | 1601 |
| 28 | Ga0099823_1042042 | 3300006944 | Bacteria | 3219 |
| 29 | Ga0105251_10037859 | 3300009011 | Bacteria | 2365 |
| 30 | Ga0105247_10005629 | 3300009101 | Bacteria | 7862 |
| 31 | Ga0105248_10008540 | 3300009177 | Bacteria | 11244 |
| 32 | Ga0105248_10017835 | 3300009177 | Bacteria | 7835 |
| 33 | Ga0105238_10019803 | 3300009551 | Bacteria | 6849 |
| 34 | Ga0105238_10021253 | 3300009551 | Bacteria | 6613 |
| 35 | Ga0157370_10289384 | 3300013104 | Bacteria | 1513 |
| 36 | Ga0157369_10125224 | 3300013105 | Bacteria | 2725 |
| 37 | Ga0157374_10051114 | 3300013296 | Bacteria | 3845 |
| 38 | Ga0157374_10178997 | 3300013296 | Bacteria | 2070 |
| 39 | Ga0157378_10071258 | 3300013297 | Bacteria | 3121 |
| 40 | Ga0157378_10389884 | 3300013297 | Bacteria | 1370 |
| 41 | Ga0163162_10000297 | 3300013306 | Bacteria | 45730 |
| 42 | Ga0163162_10002427 | 3300013306 | Bacteria | 17557 |
| 43 | Ga0157372_10012427 | 3300013307 | Bacteria | 9075 |
| 44 | Ga0157375_10005402 | 3300013308 | Bacteria | 11107 |
| 45 | Ga0157375_10005788 | 3300013308 | Bacteria | 10753 |
| 46 | Ga0163163_10173763 | 3300014325 | Bacteria | 2201 |
| 47 | Ga0157379_10244421 | 3300014968 | Bacteria | 1628 |
| 48 | Ga0157376_10050785 | 3300014969 | Bacteria | 3442 |
| 49 | Ga0157376_10341809 | 3300014969 | Bacteria | 1429 |
| 50 | Ga0182006_1000027 | 3300015261 | Bacteria | 252946 |
| 51 | Ga0182006_1000181 | 3300015261 | Bacteria | 66126 |
| 52 | Ga0182007_10006080 | 3300015262 | Bacteria | 5219 |
| 53 | Ga0182007_10033545 | 3300015262 | Bacteria | 1739 |
| 54 | Ga0163161_10091764 | 3300017792 | Bacteria | 2248 |
| 55 | Ga0163161_10197599 | 3300017792 | Bacteria | 1548 |
| 56 | Ga0209672_101852 | 3300025228 | Bacteria | 6306 |
| 57 | Ga0207427_101019 | 3300025231 | Bacteria | 11712 |
| 58 | Ga0209437_100180 | 3300025233 | Bacteria | 133661 |
| 59 | Ga0209258_100718 | 3300025242 | Bacteria | 22152 |
| 60 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 61 | Ga0209148_1000995 | 3300025254 | Bacteria | 18242 |
| 62 | Ga0209233_1018285 | 3300025261 | Bacteria | 1889 |
| 63 | Ga0209455_1001189 | 3300025272 | Bacteria | 12439 |
| 64 | Ga0209455_1003388 | 3300025272 | Bacteria | 5664 |
| 65 | Ga0207692_10081074 | 3300025898 | Bacteria | 1736 |
| 66 | Ga0207710_10006737 | 3300025900 | Bacteria | 4897 |
| 67 | Ga0207684_10042161 | 3300025910 | Bacteria | 3868 |
| 68 | Ga0207684_10048598 | 3300025910 | Bacteria | 3598 |
| 69 | Ga0207684_10134868 | 3300025910 | Bacteria | 2119 |
| 70 | Ga0207693_10028785 | 3300025915 | Bacteria | 4391 |
| 71 | Ga0207693_10084271 | 3300025915 | Bacteria | 2490 |
| 72 | Ga0207663_10300363 | 3300025916 | Bacteria | 1199 |
| 73 | Ga0207646_10000736 | 3300025922 | Bacteria | 42554 |
| 74 | Ga0207646_10032795 | 3300025922 | Bacteria | 4698 |
| 75 | Ga0207700_10169739 | 3300025928 | Bacteria | 1819 |
| 76 | Ga0207665_10010065 | 3300025939 | Bacteria | 6211 |
| 77 | Ga0207711_10032088 | 3300025941 | Bacteria | 4440 |
| 78 | Ga0207711_10033006 | 3300025941 | Bacteria | 4378 |
| 79 | Ga0207711_10243226 | 3300025941 | Bacteria | 1650 |
| 80 | Ga0207651_10245800 | 3300025960 | Bacteria | 1461 |
| 81 | Ga0207658_10039383 | 3300025986 | Bacteria | 3410 |
| 82 | Ga0207678_10041646 | 3300026067 | Bacteria | 3982 |
| 83 | Ga0207678_10090524 | 3300026067 | Bacteria | 2615 |
| 84 | Ga0207676_10165652 | 3300026095 | Bacteria | 1920 |
| 85 | Ga0265338_10000258 | 3300028800 | Bacteria | 96517 |
| 86 | Ga0265338_10141366 | 3300028800 | Unclassified | 1885 |
| 87 | Ga0265339_10014293 | 3300031249 | Bacteria | 4787 |
| 88 | Ga0373936_0007904 | 3300035113 | Bacteria | 3995 |
| 89 | Ga0373945_0005388 | 3300035116 | Bacteria | 4095 |
| 90 | Ga0373935_0043866 | 3300035692 | Bacteria | 2816 |
| 91 | Ga0373927_0031223 | 3300035695 | Bacteria | 3473 |
| 92 | Ga0373927_0203364 | 3300035695 | Bacteria | 1300 |
| 93 | Ga0373927_0204513 | 3300035695 | Bacteria | 1296 |
| 94 | Ga0373933_0048205 | 3300035724 | Bacteria | 2536 |
| 95 | Ga0373933_0063251 | 3300035724 | Bacteria | 2237 |
| 96 | Ga0373933_0114762 | 3300035724 | Bacteria | 1683 |
| 97 | Ga0373947_0032228 | 3300035725 | Bacteria | 3087 |
| 98 | Ga0373947_0051629 | 3300035725 | Bacteria | 2474 |
| 99 | Ga0373947_0214369 | 3300035725 | Bacteria | 1264 |
| 100 | Ga0373937_0084296 | 3300036401 | Bacteria | 2940 |
| 101 | Ga0373937_0131886 | 3300036401 | Bacteria | 2334 |
| 102 | Ga0373925_0027153 | 3300037068 | Bacteria | 4193 |
| 103 | Ga0373925_0029165 | 3300037068 | Bacteria | 4047 |
| 104 | Ga0373925_0141352 | 3300037068 | Bacteria | 1884 |
| 105 | Ga0450908_000740 | 3300042184 | Bacteria | 6272 |
| 106 | Ga0466982_0000002 | 3300044672 | Bacteria | 454900 |
| 107 | Ga0466971_0002548 | 3300044719 | Bacteria | 7709 |
| 108 | Ga0466968_0089977 | 3300044735 | Bacteria | 1358 |
| 109 | Ga0466970_0026300 | 3300044765 | Bacteria | 3050 |
| 110 | Ga0495617_000220 | 3300046452 | Bacteria | 34639 |
| 111 | Ga0495617_001361 | 3300046452 | Bacteria | 10838 |
| 112 | Ga0495592_0026529 | 3300046454 | Bacteria | 4392 |
| 113 | Ga0495603_0000321 | 3300046455 | Bacteria | 25860 |
| 114 | Ga0495603_0077696 | 3300046455 | Bacteria | 1947 |
| 115 | Ga0495629_0015963 | 3300046459 | Bacteria | 5396 |
| 116 | Ga0495629_0018023 | 3300046459 | Bacteria | 5061 |
| 117 | Ga0495629_0018433 | 3300046459 | Bacteria | 4997 |
| 118 | Ga0495638_0000049 | 3300046460 | Bacteria | 206725 |
| 119 | Ga0495638_0000062 | 3300046460 | Bacteria | 188223 |
| 120 | Ga0495638_0004907 | 3300046460 | Bacteria | 10052 |
| 121 | Ga0495638_0009440 | 3300046460 | Bacteria | 6846 |
| 122 | Ga0495638_0036798 | 3300046460 | Bacteria | 3116 |
| 123 | Ga0495641_0008163 | 3300046461 | Bacteria | 6428 |
| 124 | Ga0495651_0133383 | 3300046462 | Bacteria | 1811 |
| 125 | Ga0495580_0062456 | 3300046472 | Bacteria | 2613 |
| 126 | Ga0495582_0043468 | 3300046473 | Bacteria | 2475 |
| 127 | Ga0495605_0028053 | 3300046474 | Bacteria | 2909 |
| 128 | Ga0495639_0004663 | 3300046475 | Bacteria | 5887 |
| 129 | Ga0495662_0005641 | 3300046476 | Bacteria | 6260 |
| 130 | Ga0495664_0098982 | 3300046477 | Bacteria | 1756 |
| 131 | Ga0495585_0008356 | 3300046492 | Bacteria | 6278 |
| 132 | Ga0495585_0024520 | 3300046492 | Bacteria | 3458 |
| 133 | Ga0495585_0034323 | 3300046492 | Bacteria | 2867 |
| 134 | Ga0495585_0110117 | 3300046492 | Bacteria | 1465 |
| 135 | Ga0495594_0000044 | 3300046499 | Bacteria | 54809 |
| 136 | Ga0495594_0007861 | 3300046499 | Bacteria | 5484 |
| 137 | Ga0495596_0003873 | 3300046500 | Bacteria | 7427 |
| 138 | Ga0495596_0068227 | 3300046500 | Bacteria | 1382 |
| 139 | Ga0495607_0112166 | 3300046501 | Bacteria | 1444 |
| 140 | Ga0495583_0017042 | 3300046506 | Bacteria | 3873 |
| 141 | Ga0495606_0000181 | 3300046507 | Bacteria | 111247 |
| 142 | Ga0495620_0000461 | 3300046515 | Bacteria | 26697 |
| 143 | Ga0495630_0027565 | 3300046517 | Bacteria | 4216 |
| 144 | Ga0495631_0042799 | 3300046518 | Bacteria | 2000 |
| 145 | Ga0495631_0063084 | 3300046518 | Bacteria | 1605 |
| 146 | Ga0495631_0105971 | 3300046518 | Bacteria | 1209 |
| 147 | Ga0495632_0047205 | 3300046519 | Bacteria | 2137 |
| 148 | Ga0495644_0000041 | 3300046523 | Bacteria | 60975 |
| 149 | Ga0495644_0030410 | 3300046523 | Bacteria | 2039 |
| 150 | Ga0495648_0001919 | 3300046524 | Bacteria | 19808 |
| 151 | Ga0495648_0071191 | 3300046524 | Bacteria | 2017 |
| 152 | Ga0495666_0062025 | 3300046526 | Bacteria | 1786 |
| 153 | Ga0495642_0013842 | 3300046528 | Bacteria | 3124 |
| 154 | Ga0495665_0002545 | 3300046531 | Bacteria | 9835 |
| 155 | Ga0495640_0017487 | 3300046533 | Bacteria | 5343 |
| 156 | Ga0495640_0070630 | 3300046533 | Bacteria | 2345 |
| 157 | Ga0495609_0012356 | 3300046538 | Bacteria | 4050 |
| 158 | Ga0495597_0039375 | 3300046542 | Bacteria | 2117 |
| 159 | Ga0495645_0011203 | 3300046543 | Bacteria | 6306 |
| 160 | Ga0495622_0008892 | 3300046557 | Bacteria | 4653 |
| 161 | Ga0495622_0016288 | 3300046557 | Bacteria | 3460 |
| 162 | Ga0495622_0017158 | 3300046557 | Bacteria | 3370 |
| 163 | Ga0495622_0072667 | 3300046557 | Bacteria | 1587 |
| 164 | Ga0495633_0002414 | 3300046558 | Bacteria | 13209 |
| 165 | Ga0495633_0003836 | 3300046558 | Bacteria | 9827 |
| 166 | Ga0495668_0007762 | 3300046616 | Bacteria | 6806 |
| 167 | Ga0495634_0015884 | 3300046642 | Bacteria | 5393 |
| 168 | Ga0495634_0030202 | 3300046642 | Bacteria | 3745 |
| 169 | Ga0495625_0013870 | 3300046660 | Bacteria | 6454 |
| 170 | Ga0495625_0041092 | 3300046660 | Bacteria | 3367 |
| 171 | Ga0495625_0046770 | 3300046660 | Bacteria | 3121 |
| 172 | Ga0495625_0056796 | 3300046660 | Bacteria | 2785 |
| 173 | Ga0495635_0034371 | 3300046663 | Bacteria | 3516 |
| 174 | Ga0495635_0184150 | 3300046663 | Bacteria | 1419 |
| 175 | Ga0495588_0018201 | 3300046674 | Bacteria | 3421 |
| 176 | Ga0495599_0002014 | 3300046678 | Bacteria | 11751 |
| 177 | Ga0495623_0027979 | 3300046679 | Bacteria | 3629 |
| 178 | Ga0495647_0017164 | 3300046681 | Bacteria | 2558 |
| 179 | Ga0495658_0002382 | 3300046683 | Bacteria | 9488 |
| 180 | Ga0495669_0015280 | 3300046684 | Bacteria | 3287 |
| 181 | Ga0495613_0002308 | 3300046689 | Bacteria | 14452 |
| 182 | Ga0495613_0002505 | 3300046689 | Bacteria | 13851 |
| 183 | Ga0495613_0033746 | 3300046689 | Bacteria | 3801 |
| 184 | Ga0495613_0065069 | 3300046689 | Bacteria | 2665 |
| 185 | Ga0495613_0196917 | 3300046689 | Bacteria | 1422 |
| 186 | Ga0495624_0016425 | 3300046690 | Bacteria | 4982 |
| 187 | Ga0495670_0186417 | 3300046691 | Bacteria | 1096 |
| 188 | Ga0495671_0019871 | 3300046692 | Bacteria | 3545 |
| 189 | Ga0495671_0026937 | 3300046692 | Bacteria | 2974 |
| 190 | Ga0495649_0007710 | 3300046694 | Bacteria | 6535 |
| 191 | Ga0495649_0046370 | 3300046694 | Bacteria | 2366 |
| 192 | Ga0495589_0002956 | 3300046794 | Bacteria | 9362 |
| 193 | Ga0495589_0003628 | 3300046794 | Bacteria | 8335 |
| 194 | Ga0495660_0000078 | 3300046810 | Bacteria | 104055 |
| 195 | Ga0495581_0009274 | 3300047315 | Bacteria | 5695 |
| 196 | Ga0495581_0042625 | 3300047315 | Bacteria | 2626 |
| 197 | Ga0495581_0076094 | 3300047315 | Bacteria | 1942 |
| 198 | Ga0495674_0015507 | 3300047319 | Bacteria | 7120 |
| 199 | Ga0495674_0102316 | 3300047319 | Bacteria | 2436 |
| 200 | Ga0495672_0000346 | 3300047320 | Bacteria | 59410 |
| 201 | Ga0495672_0011406 | 3300047320 | Bacteria | 6276 |
| 202 | Ga0495676_0057656 | 3300047321 | Bacteria | 3061 |
| 203 | Ga0495683_0130103 | 3300047323 | Bacteria | 1188 |
| 204 | Ga0495679_048154 | 3300047446 | Bacteria | 1290 |
| 205 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 206 | Ga0495673_0000010 | 3300047469 | Bacteria | 709599 |
| 207 | Ga0495684_0243643 | 3300047471 | Bacteria | 1310 |
| 208 | Ga0495686_0000105 | 3300047472 | Bacteria | 176098 |
| 209 | Ga0495686_0000440 | 3300047472 | Bacteria | 63165 |
| 210 | Ga0495686_0000576 | 3300047472 | Bacteria | 52136 |
| 211 | Ga0495686_0002216 | 3300047472 | Bacteria | 18870 |
| 212 | Ga0495686_0034095 | 3300047472 | Bacteria | 3281 |
| 213 | Ga0495686_0067399 | 3300047472 | Bacteria | 2209 |
| 214 | Ga0495593_0009057 | 3300047673 | Bacteria | 5775 |
| 215 | Ga0495614_0008732 | 3300048089 | Bacteria | 4502 |
| 216 | Ga0495614_0019587 | 3300048089 | Bacteria | 2928 |
| 217 | Ga0496101_0003285 | 3300048904 | Bacteria | 10054 |
| 218 | Ga0496101_0246805 | 3300048904 | Bacteria | 1390 |
| 219 | Ga0496102_0004927 | 3300048905 | Bacteria | 11312 |
| 220 | Ga0496102_0020605 | 3300048905 | Bacteria | 5827 |
| 221 | Ga0496104_0032165 | 3300048907 | Bacteria | 4881 |
| 222 | Ga0496104_0101225 | 3300048907 | Bacteria | 2758 |
| 223 | Ga0496105_0006788 | 3300048908 | Bacteria | 8801 |
| 224 | Ga0496105_0043828 | 3300048908 | Bacteria | 3690 |
| 225 | Ga0496105_0073222 | 3300048908 | Bacteria | 2831 |
| 226 | Ga0496106_0151419 | 3300048909 | Bacteria | 1830 |
| 227 | Ga0496106_0254970 | 3300048909 | Bacteria | 1403 |
| 228 | Ga0496107_0013544 | 3300048910 | Bacteria | 5701 |
| 229 | Ga0496107_0032567 | 3300048910 | Bacteria | 3726 |
| 230 | Ga0496110_0104065 | 3300048913 | Bacteria | 2547 |
| 231 | Ga0496110_0227726 | 3300048913 | Bacteria | 1695 |
| 232 | Ga0496112_0035115 | 3300048915 | Bacteria | 4880 |
| 233 | Ga0496113_0006713 | 3300048916 | Bacteria | 7329 |
| 234 | Ga0496113_0204469 | 3300048916 | Bacteria | 1570 |
| 235 | Ga0496114_0131026 | 3300048917 | Bacteria | 2165 |
| 236 | Ga0496115_0000096 | 3300048918 | Bacteria | 82735 |
| 237 | Ga0496115_0039098 | 3300048918 | Bacteria | 3767 |
| 238 | Ga0496115_0128205 | 3300048918 | Bacteria | 2090 |
| 239 | Ga0496115_0284010 | 3300048918 | Bacteria | 1358 |
| 240 | Ga0496119_0065373 | 3300048922 | Bacteria | 2154 |
| 241 | Ga0496120_0011303 | 3300048923 | Bacteria | 6147 |
| 242 | Ga0496121_0002184 | 3300048924 | Bacteria | 30622 |
| 243 | Ga0496121_0006812 | 3300048924 | Bacteria | 13995 |
| 244 | Ga0496121_0022765 | 3300048924 | Bacteria | 6061 |
| 245 | Ga0496121_0270277 | 3300048924 | Bacteria | 1169 |
| 246 | Ga0496125_0140172 | 3300048928 | Bacteria | 1683 |
| 247 | Ga0496126_0003232 | 3300048929 | Bacteria | 20840 |
| 248 | Ga0496126_0045138 | 3300048929 | Bacteria | 4053 |
| 249 | Ga0496126_0070077 | 3300048929 | Bacteria | 3125 |
| 250 | Ga0496126_0117127 | 3300048929 | Bacteria | 2315 |
| 251 | Ga0495678_015884 | 3300049459 | Bacteria | 3455 |
| 252 | Ga0495682_0000540 | 3300049460 | Bacteria | 26138 |
| 253 | Ga0495682_0000694 | 3300049460 | Bacteria | 22096 |
| 254 | Ga0501034_0249671 | 3300049571 | Bacteria | 1719 |
| 255 | Ga0501068_0033487 | 3300049584 | Bacteria | 3060 |
| 256 | Ga0501080_0083651 | 3300049742 | Bacteria | 2965 |
| 257 | Ga0501044_0033717 | 3300049823 | Bacteria | 5377 |
| 258 | Ga0495601_0006095 | 3300053077 | Bacteria | 7035 |
| 259 | Ga0495612_0004289 | 3300053078 | Bacteria | 5919 |
| 260 | Ga0495619_0015190 | 3300053085 | Bacteria | 4867 |
| 261 | Ga0500578_0063154 | 3300053086 | Bacteria | 2363 |
| 262 | Ga0500651_0054028 | 3300053093 | Bacteria | 2519 |
| 263 | Ga0500640_055519 | 3300053095 | Bacteria | 1725 |
| 264 | Ga0500572_000465 | 3300053111 | Bacteria | 14081 |
| 265 | Ga0500595_002366 | 3300053119 | Bacteria | 9421 |
| 266 | Ga0500595_002699 | 3300053119 | Bacteria | 8602 |
| 267 | Ga0500595_003460 | 3300053119 | Bacteria | 7356 |
| 268 | Ga0500595_008469 | 3300053119 | Unclassified | 4197 |
| 269 | Ga0500614_001232 | 3300053123 | Bacteria | 6229 |
| 270 | Ga0500655_001603 | 3300053133 | Bacteria | 4273 |
| 271 | Ga0500559_0001191 | 3300053136 | Bacteria | 15465 |
| 272 | Ga0500559_0005167 | 3300053136 | Bacteria | 6027 |
| 273 | Ga0500573_0173122 | 3300053140 | Bacteria | 1166 |
| 274 | Ga0500616_0045792 | 3300053153 | Bacteria | 2329 |
| 275 | Ga0500639_053330 | 3300053163 | Bacteria | 2104 |
| 276 | Ga0500636_0000047 | 3300053177 | Bacteria | 62796 |
| 277 | Ga0500596_000165 | 3300053735 | Bacteria | 10394 |
| 278 | Ga0500601_000032 | 3300053737 | Bacteria | 31109 |
| 279 | Ga0501082_0036172 | 3300060353 | Bacteria | 4254 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005563 | Ga0068855_100170773 | Ga0068855_1001707733 | 299 |
| 2 | 3300049571 | Ga0501034_0249671 | Ga0501034_0249671_108_1139 | 303 |
| 3 | 3300005293 | Ga0065715_10089138 | Ga0065715_100891389 | 304 |
| 4 | 3300053119 | Ga0500595_002699 | Ga0500595_002699_6362_7390 | 308 |
| 5 | 3300048913 | Ga0496110_0227726 | Ga0496110_0227726_138_1172 | 310 |
| 6 | iso_pu_bacteria | 8019608314 | 8019615423 | 311 |
| 7 | 3300006358 | Ga0068871_100166772 | Ga0068871_1001667722 | 312 |
| 8 | 3300046678 | Ga0495599_0002014 | Ga0495599_0002014_7498_8538 | 313 |
| 9 | 3300046679 | Ga0495623_0027979 | Ga0495623_0027979_362_1402 | 313 |
| 10 | 3300047472 | Ga0495686_0000576 | Ga0495686_0000576_21060_22106 | 316 |
| 11 | 3300053111 | Ga0500572_000465 | Ga0500572_000465_7449_8486 | 316 |
| 12 | 3300053136 | Ga0500559_0001191 | Ga0500559_0001191_8187_9224 | 316 |
| 13 | 3300053163 | Ga0500639_053330 | Ga0500639_053330_531_1568 | 316 |
| 14 | 3300053735 | Ga0500596_000165 | Ga0500596_000165_7757_8794 | 316 |
| 15 | 3300047472 | Ga0495686_0002216 | Ga0495686_0002216_8740_9774 | 318 |
| 16 | 3300053119 | Ga0500595_003460 | Ga0500595_003460_1795_2859 | 319 |
| 17 | 3300013296 | Ga0157374_10178997 | Ga0157374_101789972 | 320 |
| 18 | 3300013297 | Ga0157378_10071258 | Ga0157378_100712583 | 320 |
| 19 | 3300014969 | Ga0157376_10050785 | Ga0157376_100507853 | 320 |
| 20 | 3300046492 | Ga0495585_0008356 | Ga0495585_0008356_3655_4638 | 320 |
| 21 | 3300053095 | Ga0500640_055519 | Ga0500640_055519_551_1588 | 320 |
| 22 | 3300053136 | Ga0500559_0005167 | Ga0500559_0005167_3786_4823 | 320 |
| 23 | 3300048924 | Ga0496121_0270277 | Ga0496121_0270277_77_1066 | 321 |
| 24 | 3300047320 | Ga0495672_0000346 | Ga0495672_0000346_48229_49260 | 322 |
| 25 | iso_pu_bacteria | 8056967851 | 8056968894 | 322 |
| 26 | 3300025960 | Ga0207651_10245800 | Ga0207651_102458002 | 324 |
| 27 | iso_pu_bacteria | 2824661429 | 2824664694 | 324 |
| 28 | iso_pu_bacteria | 2879099564 | 2879109929 | 324 |
| 29 | iso_pu_bacteria | 2883354860 | 2883356614 | 324 |
| 30 | iso_pu_bacteria | 2922368715 | 2922372265 | 324 |
| 31 | iso_pu_bacteria | 2929615660 | 2929616531 | 324 |
| 32 | iso_pu_bacteria | 2929624759 | 2929625275 | 324 |
| 33 | iso_pu_bacteria | 2932784394 | 2932786793 | 324 |
| 34 | iso_pu_bacteria | 2932809354 | 2932818033 | 324 |
| 35 | iso_pu_bacteria | 2932818245 | 2932827828 | 324 |
| 36 | iso_pu_bacteria | 2932828146 | 2932832617 | 324 |
| 37 | iso_pu_bacteria | 2933577622 | 2933578186 | 324 |
| 38 | iso_pu_bacteria | 2935616580 | 2935619318 | 324 |
| 39 | iso_pu_bacteria | 2935638405 | 2935645295 | 324 |
| 40 | iso_pu_bacteria | 2935665750 | 2935671393 | 324 |
| 41 | iso_pu_bacteria | 2935675223 | 2935683757 | 324 |
| 42 | iso_pu_bacteria | 2935684952 | 2935691944 | 324 |
| 43 | iso_pu_bacteria | 2935703347 | 2935708032 | 324 |
| 44 | iso_pu_bacteria | 2935713505 | 2935721783 | 324 |
| 45 | iso_pu_bacteria | 2935722832 | 2935731219 | 324 |
| 46 | iso_pu_bacteria | 2935732158 | 2935738919 | 324 |
| 47 | iso_pu_bacteria | 2935741537 | 2935747896 | 324 |
| 48 | iso_pu_bacteria | 2935750917 | 2935756480 | 324 |
| 49 | iso_pu_bacteria | 2935760218 | 2935761538 | 324 |
| 50 | iso_pu_bacteria | 2935801545 | 2935804981 | 324 |
| 51 | iso_pu_bacteria | 2935810662 | 2935812145 | 324 |
| 52 | iso_pu_bacteria | 2935827899 | 2935834862 | 324 |
| 53 | iso_pu_bacteria | 2935837841 | 2935838927 | 324 |
| 54 | iso_pu_bacteria | 2935855204 | 2935857683 | 324 |
| 55 | iso_pu_bacteria | 2935864058 | 2935873314 | 324 |
| 56 | iso_pu_bacteria | 2935873716 | 2935882905 | 324 |
| 57 | iso_pu_bacteria | 2935992306 | 2935997449 | 324 |
| 58 | iso_pu_bacteria | 2936002035 | 2936005230 | 324 |
| 59 | iso_pu_bacteria | 2936037263 | 2936038739 | 324 |
| 60 | iso_pu_bacteria | 2940556831 | 2940562394 | 324 |
| 61 | iso_pu_bacteria | 2941538514 | 2941539616 | 324 |
| 62 | iso_pu_bacteria | 8017057580 | 8017061036 | 324 |
| 63 | iso_pu_bacteria | 8019576017 | 8019580507 | 324 |
| 64 | iso_pu_bacteria | 8019597564 | 8019603111 | 324 |
| 65 | iso_pu_bacteria | 8055742211 | 8055748177 | 324 |
| 66 | 3300044672 | Ga0466982_0000002 | Ga0466982_0000002_269329_270357 | 325 |
| 67 | 3300044719 | Ga0466971_0002548 | Ga0466971_0002548_3276_4304 | 325 |
| 68 | 3300044735 | Ga0466968_0089977 | Ga0466968_0089977_205_1233 | 325 |
| 69 | 3300044765 | Ga0466970_0026300 | Ga0466970_0026300_123_1151 | 325 |
| 70 | 3300046460 | Ga0495638_0000062 | Ga0495638_0000062_60901_61929 | 325 |
| 71 | 3300046557 | Ga0495622_0072667 | Ga0495622_0072667_518_1546 | 325 |
| 72 | 3300046660 | Ga0495625_0046770 | Ga0495625_0046770_1757_2785 | 325 |
| 73 | 3300046694 | Ga0495649_0007710 | Ga0495649_0007710_3433_4461 | 325 |
| 74 | 3300047472 | Ga0495686_0000440 | Ga0495686_0000440_5055_6083 | 325 |
| 75 | 3300048918 | Ga0496115_0000096 | Ga0496115_0000096_17632_18660 | 325 |
| 76 | 3300048929 | Ga0496126_0003232 | Ga0496126_0003232_6571_7599 | 325 |
| 77 | iso_pu_bacteria | 2517572143 | 2517894197 | 325 |
| 78 | iso_pu_bacteria | 2739367700 | 2739733077 | 325 |
| 79 | iso_pu_bacteria | 2821443989 | 2821448275 | 325 |
| 80 | iso_pu_bacteria | 2932784394 | 2932793368 | 325 |
| 81 | 3300046452 | Ga0495617_001361 | Ga0495617_001361_8008_9039 | 326 |
| 82 | 3300046455 | Ga0495603_0077696 | Ga0495603_0077696_407_1432 | 326 |
| 83 | 3300046492 | Ga0495585_0024520 | Ga0495585_0024520_1361_2392 | 326 |
| 84 | 3300046519 | Ga0495632_0047205 | Ga0495632_0047205_148_1155 | 326 |
| 85 | 3300046526 | Ga0495666_0062025 | Ga0495666_0062025_92_1177 | 326 |
| 86 | 3300046558 | Ga0495633_0002414 | Ga0495633_0002414_9864_10895 | 326 |
| 87 | 3300046692 | Ga0495671_0019871 | Ga0495671_0019871_1075_2106 | 326 |
| 88 | 3300047472 | Ga0495686_0000105 | Ga0495686_0000105_130253_131260 | 326 |
| 89 | 3300049460 | Ga0495682_0000694 | Ga0495682_0000694_14653_15684 | 326 |
| 90 | 3300028800 | Ga0265338_10141366 | Ga0265338_101413662 | 327 |
| 91 | 3300046616 | Ga0495668_0007762 | Ga0495668_0007762_1537_2577 | 327 |
| 92 | 3300053153 | Ga0500616_0045792 | Ga0500616_0045792_240_1334 | 327 |
| 93 | 3300003762 | Ga0055542_1000010 | Ga0055542_1000010190 | 328 |
| 94 | 3300005367 | Ga0070667_100038986 | Ga0070667_1000389863 | 328 |
| 95 | 3300005434 | Ga0070709_10048541 | Ga0070709_100485413 | 328 |
| 96 | 3300005467 | Ga0070706_100053488 | Ga0070706_1000534882 | 328 |
| 97 | 3300005471 | Ga0070698_100084748 | Ga0070698_1000847483 | 328 |
| 98 | 3300006173 | Ga0070716_100001567 | Ga0070716_1000015677 | 328 |
| 99 | 3300006175 | Ga0070712_100217159 | Ga0070712_1002171592 | 328 |
| 100 | 3300009177 | Ga0105248_10008540 | Ga0105248_100085403 | 328 |
| 101 | 3300013306 | Ga0163162_10002427 | Ga0163162_1000242714 | 328 |
| 102 | 3300013308 | Ga0157375_10005788 | Ga0157375_100057883 | 328 |
| 103 | 3300015261 | Ga0182006_1000181 | Ga0182006_100018140 | 328 |
| 104 | 3300015262 | Ga0182007_10033545 | Ga0182007_100335452 | 328 |
| 105 | 3300017792 | Ga0163161_10197599 | Ga0163161_101975993 | 328 |
| 106 | 3300025228 | Ga0209672_101852 | Ga0209672_1018522 | 328 |
| 107 | 3300025231 | Ga0207427_101019 | Ga0207427_1010199 | 328 |
| 108 | 3300025233 | Ga0209437_100180 | Ga0209437_10018057 | 328 |
| 109 | 3300025242 | Ga0209258_100718 | Ga0209258_1007183 | 328 |
| 110 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005155 | 328 |
| 111 | 3300025254 | Ga0209148_1000995 | Ga0209148_100099519 | 328 |
| 112 | 3300025261 | Ga0209233_1018285 | Ga0209233_10182851 | 328 |
| 113 | 3300025272 | Ga0209455_1001189 | Ga0209455_10011896 | 328 |
| 114 | 3300025272 | Ga0209455_1003388 | Ga0209455_10033884 | 328 |
| 115 | 3300025910 | Ga0207684_10048598 | Ga0207684_100485984 | 328 |
| 116 | 3300025915 | Ga0207693_10084271 | Ga0207693_100842712 | 328 |
| 117 | 3300025941 | Ga0207711_10033006 | Ga0207711_100330062 | 328 |
| 118 | 3300025986 | Ga0207658_10039383 | Ga0207658_100393832 | 328 |
| 119 | 3300026067 | Ga0207678_10041646 | Ga0207678_100416462 | 328 |
| 120 | 3300026067 | Ga0207678_10090524 | Ga0207678_100905243 | 328 |
| 121 | 3300035724 | Ga0373933_0063251 | Ga0373933_0063251_1128_2159 | 328 |
| 122 | 3300042184 | Ga0450908_000740 | Ga0450908_000740_5003_6037 | 328 |
| 123 | 3300046460 | Ga0495638_0000049 | Ga0495638_0000049_48253_49239 | 328 |
| 124 | 3300046460 | Ga0495638_0000062 | Ga0495638_0000062_56774_57808 | 328 |
| 125 | 3300046460 | Ga0495638_0004907 | Ga0495638_0004907_6352_7338 | 328 |
| 126 | 3300046462 | Ga0495651_0133383 | Ga0495651_0133383_383_1375 | 328 |
| 127 | 3300046474 | Ga0495605_0028053 | Ga0495605_0028053_1754_2740 | 328 |
| 128 | 3300046492 | Ga0495585_0110117 | Ga0495585_0110117_395_1381 | 328 |
| 129 | 3300046500 | Ga0495596_0068227 | Ga0495596_0068227_150_1136 | 328 |
| 130 | 3300046518 | Ga0495631_0105971 | Ga0495631_0105971_196_1182 | 328 |
| 131 | 3300046523 | Ga0495644_0030410 | Ga0495644_0030410_946_1932 | 328 |
| 132 | 3300046557 | Ga0495622_0008892 | Ga0495622_0008892_2453_3487 | 328 |
| 133 | 3300046660 | Ga0495625_0041092 | Ga0495625_0041092_1337_2371 | 328 |
| 134 | 3300046660 | Ga0495625_0056796 | Ga0495625_0056796_164_1150 | 328 |
| 135 | 3300046674 | Ga0495588_0018201 | Ga0495588_0018201_740_1771 | 328 |
| 136 | 3300046689 | Ga0495613_0002308 | Ga0495613_0002308_10966_11952 | 328 |
| 137 | 3300046692 | Ga0495671_0026937 | Ga0495671_0026937_1299_2285 | 328 |
| 138 | 3300046694 | Ga0495649_0046370 | Ga0495649_0046370_1144_2178 | 328 |
| 139 | 3300046794 | Ga0495589_0002956 | Ga0495589_0002956_4898_5884 | 328 |
| 140 | 3300047320 | Ga0495672_0011406 | Ga0495672_0011406_826_1860 | 328 |
| 141 | 3300047446 | Ga0495679_048154 | Ga0495679_048154_103_1089 | 328 |
| 142 | 3300047472 | Ga0495686_0034095 | Ga0495686_0034095_245_1279 | 328 |
| 143 | 3300048904 | Ga0496101_0003285 | Ga0496101_0003285_4743_5729 | 328 |
| 144 | 3300048904 | Ga0496101_0246805 | Ga0496101_0246805_336_1322 | 328 |
| 145 | 3300048905 | Ga0496102_0020605 | Ga0496102_0020605_4479_5465 | 328 |
| 146 | 3300048907 | Ga0496104_0032165 | Ga0496104_0032165_58_1044 | 328 |
| 147 | 3300048908 | Ga0496105_0006788 | Ga0496105_0006788_3086_4120 | 328 |
| 148 | 3300048908 | Ga0496105_0073222 | Ga0496105_0073222_701_1738 | 328 |
| 149 | 3300048910 | Ga0496107_0032567 | Ga0496107_0032567_2447_3433 | 328 |
| 150 | 3300048916 | Ga0496113_0006713 | Ga0496113_0006713_4214_5200 | 328 |
| 151 | 3300048916 | Ga0496113_0204469 | Ga0496113_0204469_466_1500 | 328 |
| 152 | 3300048918 | Ga0496115_0000096 | Ga0496115_0000096_13507_14541 | 328 |
| 153 | 3300048918 | Ga0496115_0284010 | Ga0496115_0284010_279_1313 | 328 |
| 154 | 3300048922 | Ga0496119_0065373 | Ga0496119_0065373_951_1985 | 328 |
| 155 | 3300048923 | Ga0496120_0011303 | Ga0496120_0011303_4177_5211 | 328 |
| 156 | 3300048924 | Ga0496121_0002184 | Ga0496121_0002184_1000_2034 | 328 |
| 157 | 3300048928 | Ga0496125_0140172 | Ga0496125_0140172_492_1526 | 328 |
| 158 | 3300048929 | Ga0496126_0003232 | Ga0496126_0003232_2446_3480 | 328 |
| 159 | 3300048929 | Ga0496126_0070077 | Ga0496126_0070077_1939_2973 | 328 |
| 160 | 3300049459 | Ga0495678_015884 | Ga0495678_015884_1410_2444 | 328 |
| 161 | 3300049742 | Ga0501080_0083651 | Ga0501080_0083651_1944_2930 | 328 |
| 162 | 3300053123 | Ga0500614_001232 | Ga0500614_001232_4289_5320 | 328 |
| 163 | 3300053177 | Ga0500636_0000047 | Ga0500636_0000047_11866_12897 | 328 |
| 164 | iso_pu_bacteria | 2513237141 | 2513893865 | 328 |
| 165 | iso_pu_bacteria | 2739367700 | 2739733079 | 328 |
| 166 | 3300003322 | rootL2_10204211 | rootL2_102042112 | 329 |
| 167 | 3300005344 | Ga0070661_100310296 | Ga0070661_1003102961 | 329 |
| 168 | 3300005355 | Ga0070671_100011929 | Ga0070671_1000119295 | 329 |
| 169 | 3300005364 | Ga0070673_100231436 | Ga0070673_1002314362 | 329 |
| 170 | 3300005367 | Ga0070667_100074591 | Ga0070667_1000745911 | 329 |
| 171 | 3300005455 | Ga0070663_100028250 | Ga0070663_1000282501 | 329 |
| 172 | 3300005617 | Ga0068859_100337387 | Ga0068859_1003373872 | 329 |
| 173 | 3300006931 | Ga0097620_100337395 | Ga0097620_1003373952 | 329 |
| 174 | 3300006944 | Ga0099823_1042042 | Ga0099823_10420422 | 329 |
| 175 | 3300009011 | Ga0105251_10037859 | Ga0105251_100378593 | 329 |
| 176 | 3300009101 | Ga0105247_10005629 | Ga0105247_100056293 | 329 |
| 177 | 3300009177 | Ga0105248_10017835 | Ga0105248_100178351 | 329 |
| 178 | 3300009551 | Ga0105238_10019803 | Ga0105238_100198038 | 329 |
| 179 | 3300009551 | Ga0105238_10021253 | Ga0105238_100212536 | 329 |
| 180 | 3300013104 | Ga0157370_10289384 | Ga0157370_102893841 | 329 |
| 181 | 3300013105 | Ga0157369_10125224 | Ga0157369_101252242 | 329 |
| 182 | 3300013296 | Ga0157374_10051114 | Ga0157374_100511142 | 329 |
| 183 | 3300013297 | Ga0157378_10389884 | Ga0157378_103898841 | 329 |
| 184 | 3300013306 | Ga0163162_10000297 | Ga0163162_1000029713 | 329 |
| 185 | 3300013308 | Ga0157375_10005402 | Ga0157375_100054023 | 329 |
| 186 | 3300014325 | Ga0163163_10173763 | Ga0163163_101737632 | 329 |
| 187 | 3300014968 | Ga0157379_10244421 | Ga0157379_102444211 | 329 |
| 188 | 3300014969 | Ga0157376_10341809 | Ga0157376_103418091 | 329 |
| 189 | 3300015261 | Ga0182006_1000027 | Ga0182006_1000027105 | 329 |
| 190 | 3300015262 | Ga0182007_10006080 | Ga0182007_100060804 | 329 |
| 191 | 3300017792 | Ga0163161_10091764 | Ga0163161_100917642 | 329 |
| 192 | 3300025900 | Ga0207710_10006737 | Ga0207710_100067374 | 329 |
| 193 | 3300025941 | Ga0207711_10032088 | Ga0207711_100320881 | 329 |
| 194 | 3300025941 | Ga0207711_10243226 | Ga0207711_102432262 | 329 |
| 195 | 3300026095 | Ga0207676_10165652 | Ga0207676_101656521 | 329 |
| 196 | 3300028800 | Ga0265338_10000258 | Ga0265338_1000025880 | 329 |
| 197 | 3300031249 | Ga0265339_10014293 | Ga0265339_100142933 | 329 |
| 198 | 3300035113 | Ga0373936_0007904 | Ga0373936_0007904_1707_2720 | 329 |
| 199 | 3300035116 | Ga0373945_0005388 | Ga0373945_0005388_198_1241 | 329 |
| 200 | 3300035692 | Ga0373935_0043866 | Ga0373935_0043866_60_1103 | 329 |
| 201 | 3300035695 | Ga0373927_0031223 | Ga0373927_0031223_347_1390 | 329 |
| 202 | 3300035695 | Ga0373927_0203364 | Ga0373927_0203364_153_1202 | 329 |
| 203 | 3300035695 | Ga0373927_0204513 | Ga0373927_0204513_220_1215 | 329 |
| 204 | 3300035724 | Ga0373933_0048205 | Ga0373933_0048205_356_1405 | 329 |
| 205 | 3300035724 | Ga0373933_0114762 | Ga0373933_0114762_48_1169 | 329 |
| 206 | 3300035725 | Ga0373947_0032228 | Ga0373947_0032228_761_1882 | 329 |
| 207 | 3300035725 | Ga0373947_0051629 | Ga0373947_0051629_1354_2397 | 329 |
| 208 | 3300035725 | Ga0373947_0214369 | Ga0373947_0214369_179_1174 | 329 |
| 209 | 3300036401 | Ga0373937_0084296 | Ga0373937_0084296_977_2098 | 329 |
| 210 | 3300036401 | Ga0373937_0131886 | Ga0373937_0131886_823_1872 | 329 |
| 211 | 3300037068 | Ga0373925_0027153 | Ga0373925_0027153_1159_2202 | 329 |
| 212 | 3300037068 | Ga0373925_0029165 | Ga0373925_0029165_1160_2281 | 329 |
| 213 | 3300037068 | Ga0373925_0141352 | Ga0373925_0141352_790_1833 | 329 |
| 214 | 3300046452 | Ga0495617_000220 | Ga0495617_000220_22082_23122 | 329 |
| 215 | 3300046454 | Ga0495592_0026529 | Ga0495592_0026529_2967_4088 | 329 |
| 216 | 3300046455 | Ga0495603_0000321 | Ga0495603_0000321_13111_14169 | 329 |
| 217 | 3300046459 | Ga0495629_0015963 | Ga0495629_0015963_1216_2337 | 329 |
| 218 | 3300046459 | Ga0495629_0018023 | Ga0495629_0018023_205_1197 | 329 |
| 219 | 3300046459 | Ga0495629_0018433 | Ga0495629_0018433_2556_3599 | 329 |
| 220 | 3300046460 | Ga0495638_0009440 | Ga0495638_0009440_145_1194 | 329 |
| 221 | 3300046460 | Ga0495638_0036798 | Ga0495638_0036798_1122_2165 | 329 |
| 222 | 3300046461 | Ga0495641_0008163 | Ga0495641_0008163_4112_5233 | 329 |
| 223 | 3300046472 | Ga0495580_0062456 | Ga0495580_0062456_1195_2316 | 329 |
| 224 | 3300046473 | Ga0495582_0043468 | Ga0495582_0043468_963_1961 | 329 |
| 225 | 3300046475 | Ga0495639_0004663 | Ga0495639_0004663_3593_4714 | 329 |
| 226 | 3300046476 | Ga0495662_0005641 | Ga0495662_0005641_3993_5114 | 329 |
| 227 | 3300046477 | Ga0495664_0098982 | Ga0495664_0098982_149_1270 | 329 |
| 228 | 3300046492 | Ga0495585_0034323 | Ga0495585_0034323_488_1537 | 329 |
| 229 | 3300046499 | Ga0495594_0000044 | Ga0495594_0000044_17090_18148 | 329 |
| 230 | 3300046499 | Ga0495594_0007861 | Ga0495594_0007861_3181_4302 | 329 |
| 231 | 3300046500 | Ga0495596_0003873 | Ga0495596_0003873_646_1704 | 329 |
| 232 | 3300046501 | Ga0495607_0112166 | Ga0495607_0112166_133_1182 | 329 |
| 233 | 3300046506 | Ga0495583_0017042 | Ga0495583_0017042_1874_2932 | 329 |
| 234 | 3300046507 | Ga0495606_0000181 | Ga0495606_0000181_45323_46363 | 329 |
| 235 | 3300046515 | Ga0495620_0000461 | Ga0495620_0000461_14122_15162 | 329 |
| 236 | 3300046517 | Ga0495630_0027565 | Ga0495630_0027565_1158_2201 | 329 |
| 237 | 3300046518 | Ga0495631_0042799 | Ga0495631_0042799_719_1777 | 329 |
| 238 | 3300046518 | Ga0495631_0063084 | Ga0495631_0063084_135_1175 | 329 |
| 239 | 3300046523 | Ga0495644_0000041 | Ga0495644_0000041_40124_41182 | 329 |
| 240 | 3300046524 | Ga0495648_0001919 | Ga0495648_0001919_11987_13060 | 329 |
| 241 | 3300046524 | Ga0495648_0071191 | Ga0495648_0071191_147_1205 | 329 |
| 242 | 3300046528 | Ga0495642_0013842 | Ga0495642_0013842_565_1623 | 329 |
| 243 | 3300046531 | Ga0495665_0002545 | Ga0495665_0002545_7513_8634 | 329 |
| 244 | 3300046533 | Ga0495640_0017487 | Ga0495640_0017487_3926_4969 | 329 |
| 245 | 3300046533 | Ga0495640_0070630 | Ga0495640_0070630_276_1397 | 329 |
| 246 | 3300046538 | Ga0495609_0012356 | Ga0495609_0012356_345_1403 | 329 |
| 247 | 3300046542 | Ga0495597_0039375 | Ga0495597_0039375_121_1170 | 329 |
| 248 | 3300046543 | Ga0495645_0011203 | Ga0495645_0011203_4709_5752 | 329 |
| 249 | 3300046557 | Ga0495622_0016288 | Ga0495622_0016288_1262_2449 | 329 |
| 250 | 3300046557 | Ga0495622_0017158 | Ga0495622_0017158_1103_2224 | 329 |
| 251 | 3300046558 | Ga0495633_0003836 | Ga0495633_0003836_2533_3591 | 329 |
| 252 | 3300046642 | Ga0495634_0015884 | Ga0495634_0015884_1037_2158 | 329 |
| 253 | 3300046642 | Ga0495634_0030202 | Ga0495634_0030202_128_1171 | 329 |
| 254 | 3300046660 | Ga0495625_0013870 | Ga0495625_0013870_1869_2927 | 329 |
| 255 | 3300046663 | Ga0495635_0034371 | Ga0495635_0034371_615_1736 | 329 |
| 256 | 3300046663 | Ga0495635_0184150 | Ga0495635_0184150_184_1227 | 329 |
| 257 | 3300046681 | Ga0495647_0017164 | Ga0495647_0017164_265_1386 | 329 |
| 258 | 3300046683 | Ga0495658_0002382 | Ga0495658_0002382_7150_8271 | 329 |
| 259 | 3300046684 | Ga0495669_0015280 | Ga0495669_0015280_2082_3131 | 329 |
| 260 | 3300046689 | Ga0495613_0002505 | Ga0495613_0002505_10949_12136 | 329 |
| 261 | 3300046689 | Ga0495613_0033746 | Ga0495613_0033746_207_1328 | 329 |
| 262 | 3300046689 | Ga0495613_0065069 | Ga0495613_0065069_45_1043 | 329 |
| 263 | 3300046689 | Ga0495613_0196917 | Ga0495613_0196917_210_1202 | 329 |
| 264 | 3300046690 | Ga0495624_0016425 | Ga0495624_0016425_1565_2686 | 329 |
| 265 | 3300046691 | Ga0495670_0186417 | Ga0495670_0186417_19_1068 | 329 |
| 266 | 3300046794 | Ga0495589_0003628 | Ga0495589_0003628_3767_4816 | 329 |
| 267 | 3300046810 | Ga0495660_0000078 | Ga0495660_0000078_13860_14900 | 329 |
| 268 | 3300047315 | Ga0495581_0009274 | Ga0495581_0009274_3359_4480 | 329 |
| 269 | 3300047315 | Ga0495581_0042625 | Ga0495581_0042625_108_1295 | 329 |
| 270 | 3300047315 | Ga0495581_0076094 | Ga0495581_0076094_912_1910 | 329 |
| 271 | 3300047319 | Ga0495674_0015507 | Ga0495674_0015507_3140_4183 | 329 |
| 272 | 3300047319 | Ga0495674_0102316 | Ga0495674_0102316_128_1249 | 329 |
| 273 | 3300047321 | Ga0495676_0057656 | Ga0495676_0057656_776_1897 | 329 |
| 274 | 3300047323 | Ga0495683_0130103 | Ga0495683_0130103_10_1068 | 329 |
| 275 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_1451067_1452107 | 329 |
| 276 | 3300047469 | Ga0495673_0000010 | Ga0495673_0000010_290253_291293 | 329 |
| 277 | 3300047471 | Ga0495684_0243643 | Ga0495684_0243643_55_1098 | 329 |
| 278 | 3300047472 | Ga0495686_0067399 | Ga0495686_0067399_901_1941 | 329 |
| 279 | 3300047673 | Ga0495593_0009057 | Ga0495593_0009057_3439_4560 | 329 |
| 280 | 3300048089 | Ga0495614_0008732 | Ga0495614_0008732_237_1424 | 329 |
| 281 | 3300048089 | Ga0495614_0019587 | Ga0495614_0019587_644_1765 | 329 |
| 282 | 3300048905 | Ga0496102_0004927 | Ga0496102_0004927_4638_5687 | 329 |
| 283 | 3300048907 | Ga0496104_0101225 | Ga0496104_0101225_1633_2736 | 329 |
| 284 | 3300048908 | Ga0496105_0043828 | Ga0496105_0043828_1477_2580 | 329 |
| 285 | 3300048909 | Ga0496106_0151419 | Ga0496106_0151419_279_1328 | 329 |
| 286 | 3300048909 | Ga0496106_0254970 | Ga0496106_0254970_226_1329 | 329 |
| 287 | 3300048910 | Ga0496107_0013544 | Ga0496107_0013544_2230_3222 | 329 |
| 288 | 3300048913 | Ga0496110_0104065 | Ga0496110_0104065_35_1027 | 329 |
| 289 | 3300048915 | Ga0496112_0035115 | Ga0496112_0035115_2467_3510 | 329 |
| 290 | 3300048917 | Ga0496114_0131026 | Ga0496114_0131026_1059_2051 | 329 |
| 291 | 3300048918 | Ga0496115_0039098 | Ga0496115_0039098_164_1207 | 329 |
| 292 | 3300048918 | Ga0496115_0128205 | Ga0496115_0128205_263_1312 | 329 |
| 293 | 3300048924 | Ga0496121_0006812 | Ga0496121_0006812_8072_9112 | 329 |
| 294 | 3300048924 | Ga0496121_0022765 | Ga0496121_0022765_1455_2495 | 329 |
| 295 | 3300048929 | Ga0496126_0117127 | Ga0496126_0117127_715_1755 | 329 |
| 296 | 3300049460 | Ga0495682_0000540 | Ga0495682_0000540_19031_20071 | 329 |
| 297 | 3300049584 | Ga0501068_0033487 | Ga0501068_0033487_1907_2905 | 329 |
| 298 | 3300049823 | Ga0501044_0033717 | Ga0501044_0033717_3533_4531 | 329 |
| 299 | 3300053077 | Ga0495601_0006095 | Ga0495601_0006095_4795_5838 | 329 |
| 300 | 3300053078 | Ga0495612_0004289 | Ga0495612_0004289_4802_5845 | 329 |
| 301 | 3300053085 | Ga0495619_0015190 | Ga0495619_0015190_254_1297 | 329 |
| 302 | 3300053119 | Ga0500595_002366 | Ga0500595_002366_7928_8977 | 329 |
| 303 | 3300053119 | Ga0500595_008469 | Ga0500595_008469_1737_2735 | 329 |
| 304 | 3300053133 | Ga0500655_001603 | Ga0500655_001603_316_1356 | 329 |
| 305 | 3300053737 | Ga0500601_000032 | Ga0500601_000032_7497_8534 | 329 |
| 306 | 3300060353 | Ga0501082_0036172 | Ga0501082_0036172_3186_4184 | 329 |
| 307 | iso_pu_bacteria | 2508501128 | 2509154449 | 329 |
| 308 | iso_pu_bacteria | 2824753945 | 2824757602 | 329 |
| 309 | iso_pu_bacteria | 2824763712 | 2824764192 | 329 |
| 310 | iso_pu_bacteria | 2904711408 | 2904713419 | 329 |
| 311 | iso_pu_bacteria | 8005301065 | 8005306224 | 329 |
| 312 | iso_pu_bacteria | 8005688590 | 8005694079 | 329 |
| 313 | iso_pu_bacteria | 8006933436 | 8006941681 | 329 |
| 314 | iso_pu_bacteria | 8006973647 | 8006981395 | 329 |
| 315 | 2162886011 | MRS1b_contig_948318 | MRS1b_0941.00000020 | 330 |
| 316 | 2162886012 | MBSR1b_contig_868394 | MBSR1b_0808.00005170 | 330 |
| 317 | 3300005293 | Ga0065715_10105464 | Ga0065715_101054642 | 330 |
| 318 | 3300005445 | Ga0070708_100054788 | Ga0070708_1000547882 | 330 |
| 319 | 3300005467 | Ga0070706_100024613 | Ga0070706_1000246139 | 330 |
| 320 | 3300005467 | Ga0070706_100031383 | Ga0070706_1000313833 | 330 |
| 321 | 3300005468 | Ga0070707_100000407 | Ga0070707_10000040743 | 330 |
| 322 | 3300005468 | Ga0070707_100025054 | Ga0070707_1000250545 | 330 |
| 323 | 3300005983 | Ga0081540_1000785 | Ga0081540_100078524 | 330 |
| 324 | 3300013307 | Ga0157372_10012427 | Ga0157372_100124279 | 330 |
| 325 | 3300025898 | Ga0207692_10081074 | Ga0207692_100810741 | 330 |
| 326 | 3300025910 | Ga0207684_10042161 | Ga0207684_100421611 | 330 |
| 327 | 3300025910 | Ga0207684_10134868 | Ga0207684_101348683 | 330 |
| 328 | 3300025915 | Ga0207693_10028785 | Ga0207693_100287852 | 330 |
| 329 | 3300025916 | Ga0207663_10300363 | Ga0207663_103003631 | 330 |
| 330 | 3300025922 | Ga0207646_10000736 | Ga0207646_100007368 | 330 |
| 331 | 3300025922 | Ga0207646_10032795 | Ga0207646_100327953 | 330 |
| 332 | 3300025928 | Ga0207700_10169739 | Ga0207700_101697392 | 330 |
| 333 | 3300025939 | Ga0207665_10010065 | Ga0207665_100100656 | 330 |
| 334 | 3300048929 | Ga0496126_0045138 | Ga0496126_0045138_243_1289 | 330 |
| 335 | 3300053086 | Ga0500578_0063154 | Ga0500578_0063154_831_1832 | 330 |
| 336 | 3300053093 | Ga0500651_0054028 | Ga0500651_0054028_1176_2177 | 330 |
| 337 | 3300053140 | Ga0500573_0173122 | Ga0500573_0173122_100_1104 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yc0-assembly2.cif.gz_C-2 | acetylesterase (lgesti) w.t. | 0.9427 | 18 | 328 |
| 4ou4-assembly1.cif.gz_A-2 | crystal structure of esterase rppe mutant s159a complexed with (s)-ac-cpa | 0.9415 | 15 | 330 |
| 4ob7-assembly1.cif.gz_A-2 | crystal structure of esterase rppe mutant w187h | 0.9405 | 15 | 330 |
| 4ob8-assembly1.cif.gz_A-2 | crystal structure of a novel thermostable esterase from pseudomonas putida ecu1011 | 0.9405 | 15 | 330 |
| 4ou5-assembly1.cif.gz_A | crystal structure of esterase rppe mutant s159a/w187h | 0.9398 | 15 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ob8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9405 | 15 | 330 | 3.40.50.1820 |
| 3aikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9293 | 45 | 327 | 3.40.50.1820 |
| 4ob8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9292 | 15 | 330 | 3.40.50.1820 |
| af_Q54L36_11_325_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9287 | 24 | 328 | 3.40.50.1820 |
| 4v2iB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9215 | 18 | 329 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A136QGY0-F1-model_v4 | deleted | 0.9655 | 146 | 328 |
|
| AF-A0A136QGY0-F1-model_v4 | deleted | 0.9604 | 146 | 328 |
|
| AF-A0A165J9X0-F1-model_v4 | Alpha/beta hydrolase fold-3 | 0.9509 | 103 | 327 |
GO:0016787
|
| AF-A0A4U9HKL8-F1-model_v4 | Lipase 2 (EC 3.1.1.3) | 0.9498 | 190 | 328 |
GO:0004806
|
| AF-A0A0D5BJU0-F1-model_v4 | deleted | 0.948 | 95 | 329 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar