F408164
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 200 | 321 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100359389|Ga0070660_1003593891 |
| Length | 234 |
| Sequence | MKVEIWSDVACPWCYLGKRRFESALDSFEHEADVELRWRSFELDPGAPAVREGDPVQRLADKYGMSRTDAVAANARLTGLAADAGLEYHLDKLRSGNTFDAHRLIHLAADKGIQDDVKERFLRAYFTEVEPIGDREALARIAVDAGLAADDVNDVLATDRYADAVRADEAQASAYGISGVPFLVIDEKYGVSGAQSPDVLLEALRRAWATANPLTMVDDATGDGGACEGDSCAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 2 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 3 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 138 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 144 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 147 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 153 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 154 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 159 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 164 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 165 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 166 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 167 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 168 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 187 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 188 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 189 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 198 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 200 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.16 |
| Metatranscriptomes | 0.31 |
| Isolates | 1.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.68 |
| Nodule | 0 |
| Rhizoplane | 1.84 |
| Rhizosphere | 90.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10012373 | 3300003323 | Bacteria | 1677 |
| 2 | rootH1_10035738 | 3300003323 | Bacteria | 1214 |
| 3 | rootH1_10094004 | 3300003323 | Bacteria | 7545 |
| 4 | JGI25405J52794_10012012 | 3300003911 | Bacteria | 1662 |
| 5 | Ga0065714_10183790 | 3300005288 | Unclassified | 953 |
| 6 | Ga0065714_10184875 | 3300005288 | Bacteria | 949 |
| 7 | Ga0065704_10104337 | 3300005289 | Bacteria | 2108 |
| 8 | Ga0065715_10003675 | 3300005293 | Bacteria | 7379 |
| 9 | Ga0065715_10120613 | 3300005293 | Bacteria | 2252 |
| 10 | Ga0065707_10006934 | 3300005295 | Bacteria | 3086 |
| 11 | Ga0070676_10014068 | 3300005328 | Bacteria | 4391 |
| 12 | Ga0070676_10226485 | 3300005328 | Unclassified | 1237 |
| 13 | Ga0070690_100015536 | 3300005330 | Bacteria | 4545 |
| 14 | Ga0070690_100104711 | 3300005330 | Unclassified | 1880 |
| 15 | Ga0070670_100026031 | 3300005331 | Bacteria | 5035 |
| 16 | Ga0068869_100077897 | 3300005334 | Bacteria | 2467 |
| 17 | Ga0070666_10002995 | 3300005335 | Bacteria | 10241 |
| 18 | Ga0068868_100008394 | 3300005338 | Bacteria | 7393 |
| 19 | Ga0068868_100961717 | 3300005338 | Bacteria | 779 |
| 20 | Ga0070660_100359389 | 3300005339 | Bacteria | 1200 |
| 21 | Ga0070689_100032565 | 3300005340 | Bacteria | 3966 |
| 22 | Ga0070689_100044341 | 3300005340 | Bacteria | 3421 |
| 23 | Ga0070689_100101572 | 3300005340 | Bacteria | 2276 |
| 24 | Ga0070687_100018912 | 3300005343 | Bacteria | 3196 |
| 25 | Ga0070661_100147944 | 3300005344 | Bacteria | 1774 |
| 26 | Ga0070661_100336798 | 3300005344 | Bacteria | 1181 |
| 27 | Ga0070692_10153892 | 3300005345 | Bacteria | 1312 |
| 28 | Ga0070668_100102881 | 3300005347 | Bacteria | 2265 |
| 29 | Ga0070668_100112924 | 3300005347 | Bacteria | 2164 |
| 30 | Ga0070669_100032843 | 3300005353 | Bacteria | 3750 |
| 31 | Ga0070669_100173033 | 3300005353 | Bacteria | 1685 |
| 32 | Ga0070675_100017181 | 3300005354 | Bacteria | 5751 |
| 33 | Ga0070675_100018282 | 3300005354 | Bacteria | 5579 |
| 34 | Ga0070675_100021865 | 3300005354 | Bacteria | 5110 |
| 35 | Ga0070675_100134711 | 3300005354 | Bacteria | 2108 |
| 36 | Ga0070671_100203308 | 3300005355 | Bacteria | 1680 |
| 37 | Ga0070674_100523385 | 3300005356 | Bacteria | 991 |
| 38 | Ga0070673_100011011 | 3300005364 | Bacteria | 6157 |
| 39 | Ga0070673_100055168 | 3300005364 | Bacteria | 3130 |
| 40 | Ga0070673_100207009 | 3300005364 | Bacteria | 1692 |
| 41 | Ga0070673_100266543 | 3300005364 | Bacteria | 1498 |
| 42 | Ga0070673_100549642 | 3300005364 | Bacteria | 1049 |
| 43 | Ga0070688_100031961 | 3300005365 | Bacteria | 3170 |
| 44 | Ga0070659_100152064 | 3300005366 | Bacteria | 1888 |
| 45 | Ga0070659_100201865 | 3300005366 | Unclassified | 1637 |
| 46 | Ga0070667_100010723 | 3300005367 | Bacteria | 7572 |
| 47 | Ga0070714_100729867 | 3300005435 | Bacteria | 957 |
| 48 | Ga0070701_10017541 | 3300005438 | Bacteria | 3347 |
| 49 | Ga0070701_10179178 | 3300005438 | Bacteria | 1239 |
| 50 | Ga0070705_100171872 | 3300005440 | Bacteria | 1459 |
| 51 | Ga0070700_100010378 | 3300005441 | Bacteria | 5140 |
| 52 | Ga0070663_100044439 | 3300005455 | Bacteria | 3132 |
| 53 | Ga0070663_100442457 | 3300005455 | Bacteria | 1070 |
| 54 | Ga0070678_100195876 | 3300005456 | Bacteria | 1664 |
| 55 | Ga0070662_100011433 | 3300005457 | Bacteria | 5859 |
| 56 | Ga0070681_10546175 | 3300005458 | Bacteria | 1072 |
| 57 | Ga0068867_100019426 | 3300005459 | Bacteria | 4842 |
| 58 | Ga0068867_100154034 | 3300005459 | Bacteria | 1807 |
| 59 | Ga0070685_10089718 | 3300005466 | Bacteria | 1859 |
| 60 | Ga0070679_100015494 | 3300005530 | Bacteria | 7327 |
| 61 | Ga0070684_100184780 | 3300005535 | Bacteria | 1896 |
| 62 | Ga0070672_100011201 | 3300005543 | Bacteria | 6250 |
| 63 | Ga0070686_100005345 | 3300005544 | Bacteria | 7103 |
| 64 | Ga0070686_100084548 | 3300005544 | Unclassified | 2109 |
| 65 | Ga0070686_100177007 | 3300005544 | Bacteria | 1513 |
| 66 | Ga0070665_100196402 | 3300005548 | Bacteria | 2019 |
| 67 | Ga0070665_100307104 | 3300005548 | Bacteria | 1590 |
| 68 | Ga0070704_100815019 | 3300005549 | Bacteria | 835 |
| 69 | Ga0070664_100171530 | 3300005564 | Bacteria | 1924 |
| 70 | Ga0070664_100184568 | 3300005564 | Bacteria | 1856 |
| 71 | Ga0070664_100318290 | 3300005564 | Bacteria | 1409 |
| 72 | Ga0070664_100373751 | 3300005564 | Bacteria | 1300 |
| 73 | Ga0068857_100249098 | 3300005577 | Bacteria | 1628 |
| 74 | Ga0068857_100533550 | 3300005577 | Bacteria | 1104 |
| 75 | Ga0068856_100009951 | 3300005614 | Bacteria | 9234 |
| 76 | Ga0068856_100253606 | 3300005614 | Bacteria | 1774 |
| 77 | Ga0068856_100440217 | 3300005614 | Bacteria | 1324 |
| 78 | Ga0070702_100284487 | 3300005615 | Bacteria | 1137 |
| 79 | Ga0068852_100091271 | 3300005616 | Bacteria | 2725 |
| 80 | Ga0068852_101252870 | 3300005616 | Unclassified | 763 |
| 81 | Ga0068859_100051896 | 3300005617 | Bacteria | 4123 |
| 82 | Ga0068859_100053754 | 3300005617 | Bacteria | 4050 |
| 83 | Ga0068859_100148255 | 3300005617 | Bacteria | 2421 |
| 84 | Ga0068859_100570974 | 3300005617 | Bacteria | 1225 |
| 85 | Ga0068864_100011224 | 3300005618 | Bacteria | 7406 |
| 86 | Ga0068864_100132221 | 3300005618 | Bacteria | 2243 |
| 87 | Ga0068864_100164935 | 3300005618 | Bacteria | 2016 |
| 88 | Ga0068864_100869945 | 3300005618 | Bacteria | 889 |
| 89 | Ga0068861_100129470 | 3300005719 | Bacteria | 2047 |
| 90 | Ga0068861_100942895 | 3300005719 | Bacteria | 820 |
| 91 | Ga0068861_101017437 | 3300005719 | Bacteria | 792 |
| 92 | Ga0068870_10008656 | 3300005840 | Bacteria | 4587 |
| 93 | Ga0068863_100012206 | 3300005841 | Bacteria | 8296 |
| 94 | Ga0068863_100878461 | 3300005841 | Bacteria | 896 |
| 95 | Ga0068858_100227298 | 3300005842 | Bacteria | 1768 |
| 96 | Ga0068862_100001971 | 3300005844 | Bacteria | 18620 |
| 97 | Ga0081455_10000126 | 3300005937 | Bacteria | 88702 |
| 98 | Ga0081455_10210505 | 3300005937 | Bacteria | 1449 |
| 99 | Ga0075365_10000821 | 3300006038 | Bacteria | 12815 |
| 100 | Ga0075368_10116635 | 3300006042 | Bacteria | 1104 |
| 101 | Ga0075364_10012084 | 3300006051 | Bacteria | 5270 |
| 102 | Ga0075369_10023371 | 3300006186 | Bacteria | 2555 |
| 103 | Ga0097621_100020893 | 3300006237 | Bacteria | 5051 |
| 104 | Ga0068871_100096283 | 3300006358 | Bacteria | 2472 |
| 105 | Ga0068871_100105717 | 3300006358 | Bacteria | 2362 |
| 106 | Ga0075428_100044172 | 3300006844 | Bacteria | 4898 |
| 107 | Ga0075430_100003855 | 3300006846 | Bacteria | 12629 |
| 108 | Ga0075430_100057897 | 3300006846 | Bacteria | 3258 |
| 109 | Ga0075430_100246284 | 3300006846 | Bacteria | 1481 |
| 110 | Ga0075431_100030437 | 3300006847 | Bacteria | 5560 |
| 111 | Ga0075431_100047381 | 3300006847 | Bacteria | 4431 |
| 112 | Ga0075431_100111804 | 3300006847 | Bacteria | 2819 |
| 113 | Ga0075433_10012441 | 3300006852 | Bacteria | 6876 |
| 114 | Ga0075433_10048496 | 3300006852 | Bacteria | 3693 |
| 115 | Ga0075434_100046832 | 3300006871 | Bacteria | 4291 |
| 116 | Ga0075429_100180908 | 3300006880 | Bacteria | 1848 |
| 117 | Ga0068865_100008774 | 3300006881 | Bacteria | 6249 |
| 118 | Ga0097620_100051896 | 3300006931 | Bacteria | 4123 |
| 119 | Ga0097620_100053762 | 3300006931 | Bacteria | 4050 |
| 120 | Ga0097620_100148265 | 3300006931 | Bacteria | 2421 |
| 121 | Ga0097620_100571036 | 3300006931 | Bacteria | 1225 |
| 122 | Ga0075435_100063176 | 3300007076 | Bacteria | 3007 |
| 123 | Ga0105240_10037536 | 3300009093 | Bacteria | 6226 |
| 124 | Ga0105240_10051450 | 3300009093 | Bacteria | 5182 |
| 125 | Ga0111539_10001329 | 3300009094 | Bacteria | 32962 |
| 126 | Ga0111539_10003097 | 3300009094 | Bacteria | 22050 |
| 127 | Ga0111539_10011343 | 3300009094 | Bacteria | 11192 |
| 128 | Ga0111539_10038255 | 3300009094 | Bacteria | 5787 |
| 129 | Ga0111539_10061982 | 3300009094 | Bacteria | 4428 |
| 130 | Ga0111539_10062887 | 3300009094 | Bacteria | 4392 |
| 131 | Ga0111539_10378206 | 3300009094 | Bacteria | 1649 |
| 132 | Ga0114129_10046133 | 3300009147 | Bacteria | 6125 |
| 133 | Ga0114129_10078176 | 3300009147 | Bacteria | 4602 |
| 134 | Ga0114129_10132016 | 3300009147 | Bacteria | 3429 |
| 135 | Ga0114129_11402347 | 3300009147 | Bacteria | 862 |
| 136 | Ga0105248_10151024 | 3300009177 | Bacteria | 2621 |
| 137 | Ga0105237_10030022 | 3300009545 | Bacteria | 5523 |
| 138 | Ga0105237_10802564 | 3300009545 | Bacteria | 948 |
| 139 | Ga0105238_10277972 | 3300009551 | Bacteria | 1655 |
| 140 | Ga0105249_10037145 | 3300009553 | Bacteria | 4420 |
| 141 | Ga0105239_10045131 | 3300010375 | Bacteria | 4830 |
| 142 | Ga0105239_10334434 | 3300010375 | Bacteria | 1709 |
| 143 | Ga0105239_10612608 | 3300010375 | Bacteria | 1242 |
| 144 | Ga0105246_10017832 | 3300011119 | Bacteria | 4515 |
| 145 | Ga0157370_10458695 | 3300013104 | Bacteria | 1171 |
| 146 | Ga0157369_10009811 | 3300013105 | Bacteria | 10953 |
| 147 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 148 | Ga0157374_10184493 | 3300013296 | Bacteria | 2039 |
| 149 | Ga0157375_10093380 | 3300013308 | Bacteria | 3075 |
| 150 | Ga0163163_10288802 | 3300014325 | Bacteria | 1692 |
| 151 | Ga0163163_10311261 | 3300014325 | Unclassified | 1628 |
| 152 | Ga0157380_10037911 | 3300014326 | Bacteria | 3739 |
| 153 | Ga0157380_10047481 | 3300014326 | Bacteria | 3378 |
| 154 | Ga0157380_10434841 | 3300014326 | Bacteria | 1255 |
| 155 | Ga0157380_10819699 | 3300014326 | Bacteria | 949 |
| 156 | Ga0163161_10064341 | 3300017792 | Bacteria | 2675 |
| 157 | Ga0163161_10095051 | 3300017792 | Bacteria | 2210 |
| 158 | Ga0206353_10759943 | 3300020082 | Bacteria | 3222 |
| 159 | Ga0207682_10001452 | 3300025893 | Bacteria | 10938 |
| 160 | Ga0207680_10190019 | 3300025903 | Bacteria | 1393 |
| 161 | Ga0207645_10016609 | 3300025907 | Bacteria | 4871 |
| 162 | Ga0207643_10004455 | 3300025908 | Bacteria | 7529 |
| 163 | Ga0207707_10123357 | 3300025912 | Bacteria | 2265 |
| 164 | Ga0207695_10045362 | 3300025913 | Bacteria | 4666 |
| 165 | Ga0207695_10097871 | 3300025913 | Bacteria | 2934 |
| 166 | Ga0207671_10410121 | 3300025914 | Bacteria | 1078 |
| 167 | Ga0207660_10464940 | 3300025917 | Bacteria | 1024 |
| 168 | Ga0207662_10002849 | 3300025918 | Bacteria | 8749 |
| 169 | Ga0207657_10444441 | 3300025919 | Bacteria | 1018 |
| 170 | Ga0207681_10060547 | 3300025923 | Bacteria | 2599 |
| 171 | Ga0207650_10004533 | 3300025925 | Bacteria | 9497 |
| 172 | Ga0207659_10000879 | 3300025926 | Bacteria | 17854 |
| 173 | Ga0207659_10028782 | 3300025926 | Bacteria | 3779 |
| 174 | Ga0207659_10040722 | 3300025926 | Bacteria | 3251 |
| 175 | Ga0207659_10609260 | 3300025926 | Bacteria | 931 |
| 176 | Ga0207664_10027478 | 3300025929 | Bacteria | 4314 |
| 177 | Ga0207664_10369107 | 3300025929 | Bacteria | 1273 |
| 178 | Ga0207690_10113837 | 3300025932 | Unclassified | 1953 |
| 179 | Ga0207690_10166747 | 3300025932 | Bacteria | 1647 |
| 180 | Ga0207706_10299042 | 3300025933 | Bacteria | 1402 |
| 181 | Ga0207670_10020942 | 3300025936 | Bacteria | 4025 |
| 182 | Ga0207670_10027184 | 3300025936 | Bacteria | 3615 |
| 183 | Ga0207670_10049312 | 3300025936 | Bacteria | 2815 |
| 184 | Ga0207669_10465373 | 3300025937 | Bacteria | 1005 |
| 185 | Ga0207704_10116365 | 3300025938 | Bacteria | 1819 |
| 186 | Ga0207691_10021507 | 3300025940 | Bacteria | 6090 |
| 187 | Ga0207691_10040600 | 3300025940 | Bacteria | 4298 |
| 188 | Ga0207711_10733695 | 3300025941 | Bacteria | 921 |
| 189 | Ga0207661_10016494 | 3300025944 | Bacteria | 5450 |
| 190 | Ga0207661_10289737 | 3300025944 | Bacteria | 1465 |
| 191 | Ga0207679_10016149 | 3300025945 | Bacteria | 4951 |
| 192 | Ga0207679_10138978 | 3300025945 | Bacteria | 1961 |
| 193 | Ga0207679_10183241 | 3300025945 | Bacteria | 1734 |
| 194 | Ga0207679_10361750 | 3300025945 | Bacteria | 1267 |
| 195 | Ga0207667_10008753 | 3300025949 | Bacteria | 11993 |
| 196 | Ga0207667_10098316 | 3300025949 | Bacteria | 3020 |
| 197 | Ga0207651_10000566 | 3300025960 | Bacteria | 15605 |
| 198 | Ga0207651_10004917 | 3300025960 | Bacteria | 6817 |
| 199 | Ga0207651_10023865 | 3300025960 | Bacteria | 3771 |
| 200 | Ga0207712_10008483 | 3300025961 | Bacteria | 6497 |
| 201 | Ga0207668_10010859 | 3300025972 | Bacteria | 5517 |
| 202 | Ga0207668_10357233 | 3300025972 | Unclassified | 1223 |
| 203 | Ga0207658_10219270 | 3300025986 | Bacteria | 1599 |
| 204 | Ga0207703_10042669 | 3300026035 | Bacteria | 3639 |
| 205 | Ga0207678_10000268 | 3300026067 | Bacteria | 47323 |
| 206 | Ga0207708_10054377 | 3300026075 | Bacteria | 3052 |
| 207 | Ga0207702_10009642 | 3300026078 | Bacteria | 8106 |
| 208 | Ga0207702_10486448 | 3300026078 | Bacteria | 1202 |
| 209 | Ga0207641_10011479 | 3300026088 | Bacteria | 7272 |
| 210 | Ga0207641_10332310 | 3300026088 | Unclassified | 1444 |
| 211 | Ga0207648_10011813 | 3300026089 | Bacteria | 8206 |
| 212 | Ga0207676_10420449 | 3300026095 | Bacteria | 1253 |
| 213 | Ga0207676_10629376 | 3300026095 | Bacteria | 1033 |
| 214 | Ga0207676_10776874 | 3300026095 | Bacteria | 933 |
| 215 | Ga0207674_10027185 | 3300026116 | Bacteria | 6058 |
| 216 | Ga0207674_10343846 | 3300026116 | Bacteria | 1442 |
| 217 | Ga0207675_100104653 | 3300026118 | Bacteria | 2667 |
| 218 | Ga0207675_100542253 | 3300026118 | Bacteria | 1162 |
| 219 | Ga0207675_100780934 | 3300026118 | Bacteria | 968 |
| 220 | Ga0207683_10027605 | 3300026121 | Bacteria | 4904 |
| 221 | Ga0207698_10162925 | 3300026142 | Bacteria | 1953 |
| 222 | Ga0209813_10117640 | 3300027866 | Bacteria | 922 |
| 223 | Ga0207428_10025128 | 3300027907 | Bacteria | 4989 |
| 224 | Ga0207428_10190212 | 3300027907 | Unclassified | 1548 |
| 225 | Ga0268266_10205762 | 3300028379 | Bacteria | 1803 |
| 226 | Ga0268266_10451831 | 3300028379 | Bacteria | 1222 |
| 227 | Ga0268265_10020356 | 3300028380 | Bacteria | 4629 |
| 228 | Ga0307408_100048390 | 3300031548 | Unclassified | 3050 |
| 229 | Ga0307405_10174931 | 3300031731 | Bacteria | 1535 |
| 230 | Ga0307413_10285480 | 3300031824 | Bacteria | 1244 |
| 231 | Ga0307413_10547304 | 3300031824 | Unclassified | 938 |
| 232 | Ga0307407_10121394 | 3300031903 | Bacteria | 1657 |
| 233 | Ga0307412_10197651 | 3300031911 | Bacteria | 1525 |
| 234 | Ga0307409_100367319 | 3300031995 | Bacteria | 1363 |
| 235 | Ga0307409_100373827 | 3300031995 | Bacteria | 1352 |
| 236 | Ga0307416_100119728 | 3300032002 | Unclassified | 2343 |
| 237 | Ga0307416_100584850 | 3300032002 | Bacteria | 1194 |
| 238 | Ga0307416_101506052 | 3300032002 | Bacteria | 778 |
| 239 | Ga0307411_10746082 | 3300032005 | Bacteria | 857 |
| 240 | Ga0307415_100271306 | 3300032126 | Bacteria | 1390 |
| 241 | Ga0373932_0034406 | 3300035112 | Bacteria | 1427 |
| 242 | Ga0373941_0167330 | 3300035115 | Bacteria | 817 |
| 243 | Ga0451841_0056327 | 3300041498 | Bacteria | 1606 |
| 244 | Ga0439432_037528 | 3300042006 | Bacteria | 1546 |
| 245 | Ga0466972_0001827 | 3300044658 | Bacteria | 10424 |
| 246 | Ga0453683_0054561 | 3300044673 | Bacteria | 2501 |
| 247 | Ga0466965_0008383 | 3300044683 | Bacteria | 4781 |
| 248 | Ga0466961_0114288 | 3300044693 | Bacteria | 1697 |
| 249 | Ga0466968_0073229 | 3300044735 | Bacteria | 1494 |
| 250 | Ga0466970_0009984 | 3300044765 | Bacteria | 4808 |
| 251 | Ga0466970_0279667 | 3300044765 | Bacteria | 938 |
| 252 | Ga0466960_0349376 | 3300044901 | Bacteria | 843 |
| 253 | Ga0451576_0215969 | 3300045051 | Bacteria | 2002 |
| 254 | Ga0466967_0211380 | 3300045976 | Bacteria | 1840 |
| 255 | Ga0495649_0124304 | 3300046694 | Bacteria | 1363 |
| 256 | Ga0496105_0151033 | 3300048908 | Bacteria | 1909 |
| 257 | Ga0496109_0390895 | 3300048912 | Bacteria | 1314 |
| 258 | Ga0496109_0493826 | 3300048912 | Unclassified | 1155 |
| 259 | Ga0496112_0314832 | 3300048915 | Bacteria | 1510 |
| 260 | Ga0496113_0111854 | 3300048916 | Bacteria | 2127 |
| 261 | Ga0496115_0230562 | 3300048918 | Bacteria | 1527 |
| 262 | Ga0496117_0021676 | 3300048920 | Bacteria | 5186 |
| 263 | Ga0496118_0023094 | 3300048921 | Bacteria | 5415 |
| 264 | Ga0496119_0001250 | 3300048922 | Bacteria | 31590 |
| 265 | Ga0496123_0067091 | 3300048926 | Bacteria | 2268 |
| 266 | Ga0496124_0083713 | 3300048927 | Bacteria | 2617 |
| 267 | Ga0501038_0134839 | 3300049574 | Bacteria | 2024 |
| 268 | Ga0501042_0001970 | 3300049578 | Bacteria | 12367 |
| 269 | Ga0501042_0399199 | 3300049578 | Bacteria | 996 |
| 270 | Ga0501046_0039286 | 3300049580 | Bacteria | 3791 |
| 271 | Ga0501069_0097298 | 3300049585 | Bacteria | 1668 |
| 272 | Ga0501070_0002121 | 3300049586 | Bacteria | 17393 |
| 273 | Ga0501070_0008777 | 3300049586 | Bacteria | 8547 |
| 274 | Ga0501071_0230532 | 3300049587 | Bacteria | 1395 |
| 275 | Ga0501071_0283818 | 3300049587 | Bacteria | 1253 |
| 276 | Ga0501072_0063980 | 3300049588 | Bacteria | 2901 |
| 277 | Ga0501072_0134635 | 3300049588 | Bacteria | 1970 |
| 278 | Ga0501073_0296216 | 3300049589 | Bacteria | 1116 |
| 279 | Ga0501075_0095796 | 3300049591 | Bacteria | 2252 |
| 280 | Ga0501075_0110493 | 3300049591 | Bacteria | 2090 |
| 281 | Ga0501075_0654042 | 3300049591 | Bacteria | 801 |
| 282 | Ga0501076_0083099 | 3300049592 | Bacteria | 2571 |
| 283 | Ga0501076_0284364 | 3300049592 | Bacteria | 1355 |
| 284 | Ga0501079_0016689 | 3300049741 | Bacteria | 5608 |
| 285 | Ga0501079_0125165 | 3300049741 | Bacteria | 2000 |
| 286 | Ga0501080_0238502 | 3300049742 | Bacteria | 1660 |
| 287 | Ga0501081_0012427 | 3300049743 | Bacteria | 5596 |
| 288 | Ga0501081_0160585 | 3300049743 | Bacteria | 1619 |
| 289 | Ga0501044_0178572 | 3300049823 | Bacteria | 2091 |
| 290 | Ga0501045_0265484 | 3300049824 | Bacteria | 1278 |
| 291 | Ga0501045_0594971 | 3300049824 | Bacteria | 819 |
| 292 | nmdc:mga03n38_127743_c1 | 3300050490 | Bacteria | 1256 |
| 293 | nmdc:mga00v17_15500_c1 | 3300050491 | Bacteria | 4278 |
| 294 | nmdc:mga0yw44_16278_c1 | 3300050492 | Bacteria | 4013 |
| 295 | nmdc:mga06z11_103541_c1 | 3300050494 | Bacteria | 1566 |
| 296 | nmdc:mga04h51_40248_c1 | 3300050495 | Bacteria | 1522 |
| 297 | nmdc:mga07m45_12088_c1 | 3300050496 | Bacteria | 4554 |
| 298 | nmdc:mga05p37_125811_c1 | 3300050507 | Bacteria | 3148 |
| 299 | nmdc:mga05p37_356510_c1 | 3300050507 | Unclassified | 1721 |
| 300 | nmdc:mga05p37_50144_c1 | 3300050507 | Bacteria | 5133 |
| 301 | nmdc:mga09592_42902_c1 | 3300050508 | Bacteria | 3805 |
| 302 | nmdc:mga09592_541795_c1 | 3300050508 | Bacteria | 1000 |
| 303 | nmdc:mga09592_767540_c1 | 3300050508 | Bacteria | 817 |
| 304 | nmdc:mga0qj67_164227_c1 | 3300050509 | Bacteria | 1802 |
| 305 | nmdc:mga0qj67_232935_c1 | 3300050509 | Bacteria | 1494 |
| 306 | nmdc:mga0qj67_35890_c1 | 3300050509 | Bacteria | 3877 |
| 307 | nmdc:mga06r32_10589_c1 | 3300050510 | Bacteria | 8315 |
| 308 | nmdc:mga06r32_1419416_c1 | 3300050510 | Bacteria | 636 |
| 309 | nmdc:mga06r32_47144_c1 | 3300050510 | Bacteria | 4115 |
| 310 | nmdc:mga06r32_96075_c1 | 3300050510 | Bacteria | 2901 |
| 311 | nmdc:mga08y16_12726_c1 | 3300050511 | Bacteria | 8852 |
| 312 | nmdc:mga08y16_150021_c1 | 3300050511 | Bacteria | 2423 |
| 313 | nmdc:mga08y16_1518_c1 | 3300050511 | Bacteria | 23353 |
| 314 | nmdc:mga08y16_23799_c1 | 3300050511 | Bacteria | 6467 |
| 315 | nmdc:mga08y16_40062_c1 | 3300050511 | Bacteria | 4913 |
| 316 | nmdc:mga0n895_15006_c1 | 3300050512 | Bacteria | 7057 |
| 317 | nmdc:mga0rr50_122955_c1 | 3300050513 | Bacteria | 2068 |
| 318 | nmdc:mga0a205_3535_c1 | 3300050515 | Bacteria | 13971 |
| 319 | nmdc:mga0a205_64405_c1 | 3300050515 | Bacteria | 3540 |
| 320 | nmdc:mga0sz30_10784_c2 | 3300050516 | Bacteria | 2555 |
| 321 | Ga0501084_0011959 | 3300054114 | Bacteria | 7187 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025929 | Ga0207664_10027478 | Ga0207664_100274784 | 174 |
| 2 | 3300050510 | nmdc:mga06r32_1419416_c1 | nmdc:mga06r32_1419416_c1_32_592 | 176 |
| 3 | 3300005353 | Ga0070669_100032843 | Ga0070669_1000328433 | 187 |
| 4 | 3300005354 | Ga0070675_100018282 | Ga0070675_1000182822 | 187 |
| 5 | 3300005364 | Ga0070673_100011011 | Ga0070673_1000110113 | 187 |
| 6 | 3300005544 | Ga0070686_100084548 | Ga0070686_1000845481 | 187 |
| 7 | 3300025923 | Ga0207681_10060547 | Ga0207681_100605472 | 187 |
| 8 | 3300025936 | Ga0207670_10049312 | Ga0207670_100493122 | 187 |
| 9 | 3300049578 | Ga0501042_0399199 | Ga0501042_0399199_263_919 | 189 |
| 10 | 3300026118 | Ga0207675_100542253 | Ga0207675_1005422532 | 191 |
| 11 | 3300005293 | Ga0065715_10003675 | Ga0065715_1000367510 | 196 |
| 12 | 3300005328 | Ga0070676_10226485 | Ga0070676_102264852 | 196 |
| 13 | 3300005330 | Ga0070690_100104711 | Ga0070690_1001047112 | 196 |
| 14 | 3300005340 | Ga0070689_100101572 | Ga0070689_1001015722 | 196 |
| 15 | 3300005347 | Ga0070668_100112924 | Ga0070668_1001129242 | 196 |
| 16 | 3300005455 | Ga0070663_100044439 | Ga0070663_1000444394 | 196 |
| 17 | 3300005466 | Ga0070685_10089718 | Ga0070685_100897182 | 196 |
| 18 | 3300005543 | Ga0070672_100011201 | Ga0070672_1000112012 | 196 |
| 19 | 3300005616 | Ga0068852_101252870 | Ga0068852_1012528701 | 196 |
| 20 | 3300006846 | Ga0075430_100246284 | Ga0075430_1002462842 | 196 |
| 21 | 3300009147 | Ga0114129_11402347 | Ga0114129_114023471 | 196 |
| 22 | 3300025940 | Ga0207691_10021507 | Ga0207691_100215072 | 196 |
| 23 | 3300025960 | Ga0207651_10004917 | Ga0207651_100049173 | 196 |
| 24 | 3300025972 | Ga0207668_10357233 | Ga0207668_103572332 | 196 |
| 25 | 3300026067 | Ga0207678_10000268 | Ga0207678_100002685 | 196 |
| 26 | 3300049587 | Ga0501071_0283818 | Ga0501071_0283818_440_1099 | 196 |
| 27 | 3300049588 | Ga0501072_0134635 | Ga0501072_0134635_311_970 | 196 |
| 28 | 3300049591 | Ga0501075_0095796 | Ga0501075_0095796_1300_1959 | 196 |
| 29 | 3300049824 | Ga0501045_0265484 | Ga0501045_0265484_426_1085 | 196 |
| 30 | 3300050508 | nmdc:mga09592_767540_c1 | nmdc:mga09592_767540_c1_58_687 | 196 |
| 31 | 3300050509 | nmdc:mga0qj67_232935_c1 | nmdc:mga0qj67_232935_c1_323_979 | 196 |
| 32 | 3300044693 | Ga0466961_0114288 | Ga0466961_0114288_995_1633 | 199 |
| 33 | 3300049578 | Ga0501042_0001970 | Ga0501042_0001970_5415_6071 | 200 |
| 34 | 3300049580 | Ga0501046_0039286 | Ga0501046_0039286_2371_3036 | 200 |
| 35 | 3300049587 | Ga0501071_0230532 | Ga0501071_0230532_138_803 | 200 |
| 36 | 3300049588 | Ga0501072_0063980 | Ga0501072_0063980_1127_1783 | 200 |
| 37 | 3300049591 | Ga0501075_0110493 | Ga0501075_0110493_477_1133 | 200 |
| 38 | 3300049592 | Ga0501076_0083099 | Ga0501076_0083099_286_951 | 200 |
| 39 | 3300049741 | Ga0501079_0016689 | Ga0501079_0016689_1163_1828 | 200 |
| 40 | 3300049743 | Ga0501081_0160585 | Ga0501081_0160585_921_1577 | 200 |
| 41 | 3300054114 | Ga0501084_0011959 | Ga0501084_0011959_1716_2381 | 200 |
| 42 | 3300005435 | Ga0070714_100729867 | Ga0070714_1007298672 | 201 |
| 43 | 3300025929 | Ga0207664_10369107 | Ga0207664_103691072 | 201 |
| 44 | 3300031548 | Ga0307408_100048390 | Ga0307408_1000483902 | 202 |
| 45 | 3300031731 | Ga0307405_10174931 | Ga0307405_101749312 | 202 |
| 46 | 3300031824 | Ga0307413_10547304 | Ga0307413_105473041 | 202 |
| 47 | 3300032002 | Ga0307416_100119728 | Ga0307416_1001197282 | 202 |
| 48 | 3300003911 | JGI25405J52794_10012012 | JGI25405J52794_100120122 | 203 |
| 49 | 3300005344 | Ga0070661_100147944 | Ga0070661_1001479442 | 203 |
| 50 | 3300042006 | Ga0439432_037528 | Ga0439432_037528_405_1037 | 203 |
| 51 | 3300005288 | Ga0065714_10184875 | Ga0065714_101848752 | 204 |
| 52 | 3300005331 | Ga0070670_100026031 | Ga0070670_1000260312 | 204 |
| 53 | 3300005344 | Ga0070661_100336798 | Ga0070661_1003367982 | 204 |
| 54 | 3300005617 | Ga0068859_100053754 | Ga0068859_1000537544 | 204 |
| 55 | 3300005618 | Ga0068864_100011224 | Ga0068864_1000112244 | 204 |
| 56 | 3300005719 | Ga0068861_100129470 | Ga0068861_1001294702 | 204 |
| 57 | 3300006931 | Ga0097620_100053762 | Ga0097620_1000537624 | 204 |
| 58 | 3300009094 | Ga0111539_10378206 | Ga0111539_103782062 | 204 |
| 59 | 3300025925 | Ga0207650_10004533 | Ga0207650_1000453312 | 204 |
| 60 | 3300025945 | Ga0207679_10183241 | Ga0207679_101832412 | 204 |
| 61 | 3300005577 | Ga0068857_100533550 | Ga0068857_1005335502 | 205 |
| 62 | 3300005614 | Ga0068856_100253606 | Ga0068856_1002536061 | 205 |
| 63 | 3300005937 | Ga0081455_10000126 | Ga0081455_1000012650 | 205 |
| 64 | 3300009093 | Ga0105240_10037536 | Ga0105240_100375364 | 205 |
| 65 | 3300009094 | Ga0111539_10062887 | Ga0111539_100628872 | 205 |
| 66 | 3300009545 | Ga0105237_10030022 | Ga0105237_100300223 | 205 |
| 67 | 3300009545 | Ga0105237_10802564 | Ga0105237_108025642 | 205 |
| 68 | 3300009551 | Ga0105238_10277972 | Ga0105238_102779722 | 205 |
| 69 | 3300010375 | Ga0105239_10334434 | Ga0105239_103344343 | 205 |
| 70 | 3300010375 | Ga0105239_10612608 | Ga0105239_106126081 | 205 |
| 71 | 3300014326 | Ga0157380_10819699 | Ga0157380_108196991 | 205 |
| 72 | 3300025913 | Ga0207695_10097871 | Ga0207695_100978712 | 205 |
| 73 | 3300025914 | Ga0207671_10410121 | Ga0207671_104101211 | 205 |
| 74 | 3300025949 | Ga0207667_10008753 | Ga0207667_100087539 | 205 |
| 75 | 3300025949 | Ga0207667_10098316 | Ga0207667_100983163 | 205 |
| 76 | 3300005293 | Ga0065715_10120613 | Ga0065715_101206132 | 206 |
| 77 | 3300005328 | Ga0070676_10014068 | Ga0070676_100140683 | 206 |
| 78 | 3300005330 | Ga0070690_100015536 | Ga0070690_1000155362 | 206 |
| 79 | 3300005334 | Ga0068869_100077897 | Ga0068869_1000778972 | 206 |
| 80 | 3300005335 | Ga0070666_10002995 | Ga0070666_100029952 | 206 |
| 81 | 3300005338 | Ga0068868_100008394 | Ga0068868_1000083946 | 206 |
| 82 | 3300005340 | Ga0070689_100032565 | Ga0070689_1000325654 | 206 |
| 83 | 3300005343 | Ga0070687_100018912 | Ga0070687_1000189122 | 206 |
| 84 | 3300005347 | Ga0070668_100102881 | Ga0070668_1001028813 | 206 |
| 85 | 3300005355 | Ga0070671_100203308 | Ga0070671_1002033082 | 206 |
| 86 | 3300005364 | Ga0070673_100055168 | Ga0070673_1000551682 | 206 |
| 87 | 3300005366 | Ga0070659_100152064 | Ga0070659_1001520642 | 206 |
| 88 | 3300005367 | Ga0070667_100010723 | Ga0070667_1000107232 | 206 |
| 89 | 3300005438 | Ga0070701_10017541 | Ga0070701_100175412 | 206 |
| 90 | 3300005440 | Ga0070705_100171872 | Ga0070705_1001718722 | 206 |
| 91 | 3300005441 | Ga0070700_100010378 | Ga0070700_1000103782 | 206 |
| 92 | 3300005456 | Ga0070678_100195876 | Ga0070678_1001958762 | 206 |
| 93 | 3300005457 | Ga0070662_100011433 | Ga0070662_1000114334 | 206 |
| 94 | 3300005459 | Ga0068867_100019426 | Ga0068867_1000194264 | 206 |
| 95 | 3300005544 | Ga0070686_100005345 | Ga0070686_1000053453 | 206 |
| 96 | 3300005549 | Ga0070704_100815019 | Ga0070704_1008150191 | 206 |
| 97 | 3300005577 | Ga0068857_100249098 | Ga0068857_1002490981 | 206 |
| 98 | 3300005615 | Ga0070702_100284487 | Ga0070702_1002844872 | 206 |
| 99 | 3300005616 | Ga0068852_100091271 | Ga0068852_1000912713 | 206 |
| 100 | 3300005617 | Ga0068859_100051896 | Ga0068859_1000518964 | 206 |
| 101 | 3300005618 | Ga0068864_100164935 | Ga0068864_1001649352 | 206 |
| 102 | 3300005840 | Ga0068870_10008656 | Ga0068870_100086563 | 206 |
| 103 | 3300005841 | Ga0068863_100012206 | Ga0068863_1000122066 | 206 |
| 104 | 3300005842 | Ga0068858_100227298 | Ga0068858_1002272983 | 206 |
| 105 | 3300005844 | Ga0068862_100001971 | Ga0068862_10000197114 | 206 |
| 106 | 3300006237 | Ga0097621_100020893 | Ga0097621_1000208935 | 206 |
| 107 | 3300006358 | Ga0068871_100105717 | Ga0068871_1001057173 | 206 |
| 108 | 3300006847 | Ga0075431_100111804 | Ga0075431_1001118043 | 206 |
| 109 | 3300006852 | Ga0075433_10012441 | Ga0075433_100124414 | 206 |
| 110 | 3300006871 | Ga0075434_100046832 | Ga0075434_1000468325 | 206 |
| 111 | 3300006880 | Ga0075429_100180908 | Ga0075429_1001809081 | 206 |
| 112 | 3300006881 | Ga0068865_100008774 | Ga0068865_1000087744 | 206 |
| 113 | 3300006931 | Ga0097620_100051896 | Ga0097620_1000518964 | 206 |
| 114 | 3300007076 | Ga0075435_100063176 | Ga0075435_1000631763 | 206 |
| 115 | 3300009094 | Ga0111539_10003097 | Ga0111539_100030977 | 206 |
| 116 | 3300009177 | Ga0105248_10151024 | Ga0105248_101510243 | 206 |
| 117 | 3300009553 | Ga0105249_10037145 | Ga0105249_100371454 | 206 |
| 118 | 3300011119 | Ga0105246_10017832 | Ga0105246_100178323 | 206 |
| 119 | 3300013296 | Ga0157374_10184493 | Ga0157374_101844932 | 206 |
| 120 | 3300014326 | Ga0157380_10047481 | Ga0157380_100474813 | 206 |
| 121 | 3300017792 | Ga0163161_10064341 | Ga0163161_100643413 | 206 |
| 122 | 3300025893 | Ga0207682_10001452 | Ga0207682_100014529 | 206 |
| 123 | 3300025903 | Ga0207680_10190019 | Ga0207680_101900192 | 206 |
| 124 | 3300025907 | Ga0207645_10016609 | Ga0207645_100166094 | 206 |
| 125 | 3300025908 | Ga0207643_10004455 | Ga0207643_100044554 | 206 |
| 126 | 3300025918 | Ga0207662_10002849 | Ga0207662_100028498 | 206 |
| 127 | 3300025932 | Ga0207690_10166747 | Ga0207690_101667472 | 206 |
| 128 | 3300025936 | Ga0207670_10020942 | Ga0207670_100209424 | 206 |
| 129 | 3300025938 | Ga0207704_10116365 | Ga0207704_101163652 | 206 |
| 130 | 3300025940 | Ga0207691_10040600 | Ga0207691_100406004 | 206 |
| 131 | 3300025941 | Ga0207711_10733695 | Ga0207711_107336951 | 206 |
| 132 | 3300025945 | Ga0207679_10016149 | Ga0207679_100161494 | 206 |
| 133 | 3300025960 | Ga0207651_10023865 | Ga0207651_100238653 | 206 |
| 134 | 3300025961 | Ga0207712_10008483 | Ga0207712_100084834 | 206 |
| 135 | 3300025986 | Ga0207658_10219270 | Ga0207658_102192702 | 206 |
| 136 | 3300026035 | Ga0207703_10042669 | Ga0207703_100426692 | 206 |
| 137 | 3300026075 | Ga0207708_10054377 | Ga0207708_100543772 | 206 |
| 138 | 3300026088 | Ga0207641_10011479 | Ga0207641_100114795 | 206 |
| 139 | 3300026089 | Ga0207648_10011813 | Ga0207648_100118134 | 206 |
| 140 | 3300026121 | Ga0207683_10027605 | Ga0207683_100276052 | 206 |
| 141 | 3300026142 | Ga0207698_10162925 | Ga0207698_101629253 | 206 |
| 142 | 3300027907 | Ga0207428_10025128 | Ga0207428_100251283 | 206 |
| 143 | 3300028380 | Ga0268265_10020356 | Ga0268265_100203564 | 206 |
| 144 | 3300032002 | Ga0307416_101506052 | Ga0307416_1015060521 | 206 |
| 145 | 3300035112 | Ga0373932_0034406 | Ga0373932_0034406_93_734 | 206 |
| 146 | 3300035115 | Ga0373941_0167330 | Ga0373941_0167330_67_708 | 206 |
| 147 | 3300044673 | Ga0453683_0054561 | Ga0453683_0054561_104_745 | 206 |
| 148 | 3300045051 | Ga0451576_0215969 | Ga0451576_0215969_829_1470 | 206 |
| 149 | 3300050508 | nmdc:mga09592_42902_c1 | nmdc:mga09592_42902_c1_3107_3748 | 206 |
| 150 | 3300050509 | nmdc:mga0qj67_164227_c1 | nmdc:mga0qj67_164227_c1_1049_1696 | 206 |
| 151 | 3300050510 | nmdc:mga06r32_96075_c1 | nmdc:mga06r32_96075_c1_591_1268 | 206 |
| 152 | 3300050511 | nmdc:mga08y16_40062_c1 | nmdc:mga08y16_40062_c1_1133_1774 | 206 |
| 153 | 3300050512 | nmdc:mga0n895_15006_c1 | nmdc:mga0n895_15006_c1_6337_6978 | 206 |
| 154 | 3300050513 | nmdc:mga0rr50_122955_c1 | nmdc:mga0rr50_122955_c1_409_1050 | 206 |
| 155 | 3300050515 | nmdc:mga0a205_3535_c1 | nmdc:mga0a205_3535_c1_10097_10738 | 206 |
| 156 | 3300031903 | Ga0307407_10121394 | Ga0307407_101213942 | 207 |
| 157 | 3300031995 | Ga0307409_100373827 | Ga0307409_1003738272 | 207 |
| 158 | 3300032002 | Ga0307416_100584850 | Ga0307416_1005848502 | 207 |
| 159 | iso_pu_bacteria | 8003314358 | 8003324036 | 207 |
| 160 | 3300003323 | rootH1_10035738 | rootH1_100357383 | 208 |
| 161 | 3300003323 | rootH1_10094004 | rootH1_100940045 | 208 |
| 162 | 3300005614 | Ga0068856_100009951 | Ga0068856_1000099514 | 208 |
| 163 | 3300009093 | Ga0105240_10051450 | Ga0105240_100514503 | 208 |
| 164 | 3300010375 | Ga0105239_10045131 | Ga0105239_100451314 | 208 |
| 165 | 3300025913 | Ga0207695_10045362 | Ga0207695_100453622 | 208 |
| 166 | 3300026078 | Ga0207702_10009642 | Ga0207702_100096427 | 208 |
| 167 | 3300049823 | Ga0501044_0178572 | Ga0501044_0178572_170_811 | 208 |
| 168 | 3300005345 | Ga0070692_10153892 | Ga0070692_101538922 | 209 |
| 169 | 3300005364 | Ga0070673_100549642 | Ga0070673_1005496422 | 209 |
| 170 | 3300005458 | Ga0070681_10546175 | Ga0070681_105461751 | 209 |
| 171 | 3300005530 | Ga0070679_100015494 | Ga0070679_1000154945 | 209 |
| 172 | 3300005564 | Ga0070664_100171530 | Ga0070664_1001715302 | 209 |
| 173 | 3300005614 | Ga0068856_100440217 | Ga0068856_1004402172 | 209 |
| 174 | 3300006358 | Ga0068871_100096283 | Ga0068871_1000962833 | 209 |
| 175 | 3300006846 | Ga0075430_100003855 | Ga0075430_1000038553 | 209 |
| 176 | 3300006847 | Ga0075431_100030437 | Ga0075431_1000304375 | 209 |
| 177 | 3300009094 | Ga0111539_10061982 | Ga0111539_100619822 | 209 |
| 178 | 3300013105 | Ga0157369_10009811 | Ga0157369_1000981112 | 209 |
| 179 | 3300014325 | Ga0163163_10288802 | Ga0163163_102888021 | 209 |
| 180 | 3300020082 | Ga0206353_10759943 | Ga0206353_107599432 | 209 |
| 181 | 3300025912 | Ga0207707_10123357 | Ga0207707_101233572 | 209 |
| 182 | 3300025944 | Ga0207661_10016494 | Ga0207661_100164943 | 209 |
| 183 | 3300026078 | Ga0207702_10486448 | Ga0207702_104864482 | 209 |
| 184 | 3300026116 | Ga0207674_10027185 | Ga0207674_100271856 | 209 |
| 185 | 3300032005 | Ga0307411_10746082 | Ga0307411_107460822 | 209 |
| 186 | 3300044901 | Ga0466960_0349376 | Ga0466960_0349376_134_784 | 209 |
| 187 | 3300048912 | Ga0496109_0390895 | Ga0496109_0390895_608_1270 | 209 |
| 188 | 3300048915 | Ga0496112_0314832 | Ga0496112_0314832_184_852 | 209 |
| 189 | 3300049592 | Ga0501076_0284364 | Ga0501076_0284364_232_879 | 209 |
| 190 | 3300050508 | nmdc:mga09592_541795_c1 | nmdc:mga09592_541795_c1_235_882 | 209 |
| 191 | 3300050509 | nmdc:mga0qj67_35890_c1 | nmdc:mga0qj67_35890_c1_1156_1803 | 209 |
| 192 | 3300050510 | nmdc:mga06r32_47144_c1 | nmdc:mga06r32_47144_c1_1158_1805 | 209 |
| 193 | 3300050511 | nmdc:mga08y16_150021_c1 | nmdc:mga08y16_150021_c1_1400_2047 | 209 |
| 194 | 3300005288 | Ga0065714_10183790 | Ga0065714_101837901 | 210 |
| 195 | 3300005289 | Ga0065704_10104337 | Ga0065704_101043372 | 210 |
| 196 | 3300005295 | Ga0065707_10006934 | Ga0065707_100069342 | 210 |
| 197 | 3300005338 | Ga0068868_100961717 | Ga0068868_1009617171 | 210 |
| 198 | 3300005340 | Ga0070689_100044341 | Ga0070689_1000443412 | 210 |
| 199 | 3300005353 | Ga0070669_100173033 | Ga0070669_1001730333 | 210 |
| 200 | 3300005354 | Ga0070675_100017181 | Ga0070675_1000171813 | 210 |
| 201 | 3300005354 | Ga0070675_100021865 | Ga0070675_1000218653 | 210 |
| 202 | 3300005354 | Ga0070675_100134711 | Ga0070675_1001347112 | 210 |
| 203 | 3300005356 | Ga0070674_100523385 | Ga0070674_1005233852 | 210 |
| 204 | 3300005364 | Ga0070673_100207009 | Ga0070673_1002070093 | 210 |
| 205 | 3300005364 | Ga0070673_100266543 | Ga0070673_1002665432 | 210 |
| 206 | 3300005365 | Ga0070688_100031961 | Ga0070688_1000319613 | 210 |
| 207 | 3300005366 | Ga0070659_100201865 | Ga0070659_1002018652 | 210 |
| 208 | 3300005438 | Ga0070701_10179178 | Ga0070701_101791782 | 210 |
| 209 | 3300005459 | Ga0068867_100154034 | Ga0068867_1001540342 | 210 |
| 210 | 3300005535 | Ga0070684_100184780 | Ga0070684_1001847802 | 210 |
| 211 | 3300005544 | Ga0070686_100177007 | Ga0070686_1001770072 | 210 |
| 212 | 3300005548 | Ga0070665_100307104 | Ga0070665_1003071042 | 210 |
| 213 | 3300005564 | Ga0070664_100184568 | Ga0070664_1001845681 | 210 |
| 214 | 3300005564 | Ga0070664_100318290 | Ga0070664_1003182902 | 210 |
| 215 | 3300005564 | Ga0070664_100373751 | Ga0070664_1003737513 | 210 |
| 216 | 3300005617 | Ga0068859_100148255 | Ga0068859_1001482553 | 210 |
| 217 | 3300005617 | Ga0068859_100570974 | Ga0068859_1005709742 | 210 |
| 218 | 3300005618 | Ga0068864_100132221 | Ga0068864_1001322213 | 210 |
| 219 | 3300005618 | Ga0068864_100869945 | Ga0068864_1008699451 | 210 |
| 220 | 3300005719 | Ga0068861_101017437 | Ga0068861_1010174371 | 210 |
| 221 | 3300005841 | Ga0068863_100878461 | Ga0068863_1008784611 | 210 |
| 222 | 3300005937 | Ga0081455_10210505 | Ga0081455_102105052 | 210 |
| 223 | 3300006844 | Ga0075428_100044172 | Ga0075428_1000441723 | 210 |
| 224 | 3300006846 | Ga0075430_100057897 | Ga0075430_1000578974 | 210 |
| 225 | 3300006847 | Ga0075431_100047381 | Ga0075431_1000473812 | 210 |
| 226 | 3300006852 | Ga0075433_10048496 | Ga0075433_100484964 | 210 |
| 227 | 3300006931 | Ga0097620_100148265 | Ga0097620_1001482653 | 210 |
| 228 | 3300006931 | Ga0097620_100571036 | Ga0097620_1005710362 | 210 |
| 229 | 3300009094 | Ga0111539_10001329 | Ga0111539_1000132910 | 210 |
| 230 | 3300009094 | Ga0111539_10011343 | Ga0111539_100113439 | 210 |
| 231 | 3300009094 | Ga0111539_10038255 | Ga0111539_100382555 | 210 |
| 232 | 3300009147 | Ga0114129_10046133 | Ga0114129_100461334 | 210 |
| 233 | 3300009147 | Ga0114129_10078176 | Ga0114129_100781762 | 210 |
| 234 | 3300009147 | Ga0114129_10132016 | Ga0114129_101320163 | 210 |
| 235 | 3300013308 | Ga0157375_10093380 | Ga0157375_100933803 | 210 |
| 236 | 3300014325 | Ga0163163_10311261 | Ga0163163_103112612 | 210 |
| 237 | 3300014326 | Ga0157380_10037911 | Ga0157380_100379113 | 210 |
| 238 | 3300014326 | Ga0157380_10434841 | Ga0157380_104348412 | 210 |
| 239 | 3300025926 | Ga0207659_10000879 | Ga0207659_100008793 | 210 |
| 240 | 3300025926 | Ga0207659_10028782 | Ga0207659_100287823 | 210 |
| 241 | 3300025926 | Ga0207659_10040722 | Ga0207659_100407223 | 210 |
| 242 | 3300025926 | Ga0207659_10609260 | Ga0207659_106092602 | 210 |
| 243 | 3300025932 | Ga0207690_10113837 | Ga0207690_101138372 | 210 |
| 244 | 3300025933 | Ga0207706_10299042 | Ga0207706_102990422 | 210 |
| 245 | 3300025936 | Ga0207670_10027184 | Ga0207670_100271845 | 210 |
| 246 | 3300025937 | Ga0207669_10465373 | Ga0207669_104653732 | 210 |
| 247 | 3300025944 | Ga0207661_10289737 | Ga0207661_102897372 | 210 |
| 248 | 3300025945 | Ga0207679_10138978 | Ga0207679_101389782 | 210 |
| 249 | 3300025945 | Ga0207679_10361750 | Ga0207679_103617502 | 210 |
| 250 | 3300025960 | Ga0207651_10000566 | Ga0207651_100005663 | 210 |
| 251 | 3300025972 | Ga0207668_10010859 | Ga0207668_100108596 | 210 |
| 252 | 3300026088 | Ga0207641_10332310 | Ga0207641_103323102 | 210 |
| 253 | 3300026095 | Ga0207676_10420449 | Ga0207676_104204493 | 210 |
| 254 | 3300026095 | Ga0207676_10629376 | Ga0207676_106293762 | 210 |
| 255 | 3300026095 | Ga0207676_10776874 | Ga0207676_107768742 | 210 |
| 256 | 3300026116 | Ga0207674_10343846 | Ga0207674_103438462 | 210 |
| 257 | 3300026118 | Ga0207675_100104653 | Ga0207675_1001046532 | 210 |
| 258 | 3300026118 | Ga0207675_100780934 | Ga0207675_1007809342 | 210 |
| 259 | 3300027907 | Ga0207428_10190212 | Ga0207428_101902122 | 210 |
| 260 | 3300028379 | Ga0268266_10451831 | Ga0268266_104518312 | 210 |
| 261 | 3300048908 | Ga0496105_0151033 | Ga0496105_0151033_416_1090 | 210 |
| 262 | 3300048912 | Ga0496109_0493826 | Ga0496109_0493826_228_893 | 210 |
| 263 | 3300048916 | Ga0496113_0111854 | Ga0496113_0111854_214_879 | 210 |
| 264 | 3300049589 | Ga0501073_0296216 | Ga0501073_0296216_108_794 | 210 |
| 265 | 3300049591 | Ga0501075_0654042 | Ga0501075_0654042_59_712 | 210 |
| 266 | 3300049743 | Ga0501081_0012427 | Ga0501081_0012427_10_666 | 210 |
| 267 | 3300049824 | Ga0501045_0594971 | Ga0501045_0594971_21_671 | 210 |
| 268 | 3300050507 | nmdc:mga05p37_125811_c1 | nmdc:mga05p37_125811_c1_787_1452 | 210 |
| 269 | 3300050507 | nmdc:mga05p37_356510_c1 | nmdc:mga05p37_356510_c1_873_1538 | 210 |
| 270 | 3300050507 | nmdc:mga05p37_50144_c1 | nmdc:mga05p37_50144_c1_213_881 | 210 |
| 271 | 3300050510 | nmdc:mga06r32_10589_c1 | nmdc:mga06r32_10589_c1_3146_3811 | 210 |
| 272 | 3300050511 | nmdc:mga08y16_12726_c1 | nmdc:mga08y16_12726_c1_6392_7060 | 210 |
| 273 | 3300050511 | nmdc:mga08y16_1518_c1 | nmdc:mga08y16_1518_c1_12992_13657 | 210 |
| 274 | 3300050511 | nmdc:mga08y16_23799_c1 | nmdc:mga08y16_23799_c1_2590_3255 | 210 |
| 275 | 3300050515 | nmdc:mga0a205_64405_c1 | nmdc:mga0a205_64405_c1_1393_2058 | 210 |
| 276 | iso_pu_bacteria | 2821268502 | 2821270029 | 210 |
| 277 | iso_pu_bacteria | 2833709550 | 2833710978 | 210 |
| 278 | 3300003323 | rootH1_10012373 | rootH1_100123732 | 211 |
| 279 | 3300005339 | Ga0070660_100359389 | Ga0070660_1003593891 | 211 |
| 280 | 3300005455 | Ga0070663_100442457 | Ga0070663_1004424571 | 211 |
| 281 | 3300005548 | Ga0070665_100196402 | Ga0070665_1001964023 | 211 |
| 282 | 3300005719 | Ga0068861_100942895 | Ga0068861_1009428951 | 211 |
| 283 | 3300006038 | Ga0075365_10000821 | Ga0075365_1000082112 | 211 |
| 284 | 3300006042 | Ga0075368_10116635 | Ga0075368_101166351 | 211 |
| 285 | 3300006051 | Ga0075364_10012084 | Ga0075364_100120842 | 211 |
| 286 | 3300006186 | Ga0075369_10023371 | Ga0075369_100233712 | 211 |
| 287 | 3300013104 | Ga0157370_10458695 | Ga0157370_104586952 | 211 |
| 288 | 3300013250 | Ga0171462_1003 | Ga0171462_1003375 | 211 |
| 289 | 3300017792 | Ga0163161_10095051 | Ga0163161_100950512 | 211 |
| 290 | 3300025917 | Ga0207660_10464940 | Ga0207660_104649402 | 211 |
| 291 | 3300025919 | Ga0207657_10444441 | Ga0207657_104444412 | 211 |
| 292 | 3300027866 | Ga0209813_10117640 | Ga0209813_101176401 | 211 |
| 293 | 3300028379 | Ga0268266_10205762 | Ga0268266_102057623 | 211 |
| 294 | 3300031824 | Ga0307413_10285480 | Ga0307413_102854802 | 211 |
| 295 | 3300031911 | Ga0307412_10197651 | Ga0307412_101976512 | 211 |
| 296 | 3300031995 | Ga0307409_100367319 | Ga0307409_1003673192 | 211 |
| 297 | 3300032126 | Ga0307415_100271306 | Ga0307415_1002713062 | 211 |
| 298 | 3300041498 | Ga0451841_0056327 | Ga0451841_0056327_333_1037 | 211 |
| 299 | 3300044658 | Ga0466972_0001827 | Ga0466972_0001827_563_1210 | 211 |
| 300 | 3300044683 | Ga0466965_0008383 | Ga0466965_0008383_3976_4656 | 211 |
| 301 | 3300044735 | Ga0466968_0073229 | Ga0466968_0073229_328_1008 | 211 |
| 302 | 3300044765 | Ga0466970_0009984 | Ga0466970_0009984_114_761 | 211 |
| 303 | 3300044765 | Ga0466970_0279667 | Ga0466970_0279667_231_911 | 211 |
| 304 | 3300045976 | Ga0466967_0211380 | Ga0466967_0211380_690_1346 | 211 |
| 305 | 3300046694 | Ga0495649_0124304 | Ga0495649_0124304_70_750 | 211 |
| 306 | 3300048918 | Ga0496115_0230562 | Ga0496115_0230562_182_865 | 211 |
| 307 | 3300048920 | Ga0496117_0021676 | Ga0496117_0021676_4335_5030 | 211 |
| 308 | 3300048921 | Ga0496118_0023094 | Ga0496118_0023094_2264_2959 | 211 |
| 309 | 3300048922 | Ga0496119_0001250 | Ga0496119_0001250_1327_2016 | 211 |
| 310 | 3300048926 | Ga0496123_0067091 | Ga0496123_0067091_572_1267 | 211 |
| 311 | 3300048927 | Ga0496124_0083713 | Ga0496124_0083713_566_1261 | 211 |
| 312 | 3300049574 | Ga0501038_0134839 | Ga0501038_0134839_1111_1791 | 211 |
| 313 | 3300049585 | Ga0501069_0097298 | Ga0501069_0097298_512_1216 | 211 |
| 314 | 3300049586 | Ga0501070_0002121 | Ga0501070_0002121_9893_10573 | 211 |
| 315 | 3300049586 | Ga0501070_0008777 | Ga0501070_0008777_3684_4388 | 211 |
| 316 | 3300049741 | Ga0501079_0125165 | Ga0501079_0125165_784_1443 | 211 |
| 317 | 3300049742 | Ga0501080_0238502 | Ga0501080_0238502_298_1002 | 211 |
| 318 | 3300050490 | nmdc:mga03n38_127743_c1 | nmdc:mga03n38_127743_c1_195_875 | 211 |
| 319 | 3300050491 | nmdc:mga00v17_15500_c1 | nmdc:mga00v17_15500_c1_469_1197 | 211 |
| 320 | 3300050492 | nmdc:mga0yw44_16278_c1 | nmdc:mga0yw44_16278_c1_2557_3237 | 211 |
| 321 | 3300050494 | nmdc:mga06z11_103541_c1 | nmdc:mga06z11_103541_c1_787_1467 | 211 |
| 322 | 3300050495 | nmdc:mga04h51_40248_c1 | nmdc:mga04h51_40248_c1_639_1367 | 211 |
| 323 | 3300050496 | nmdc:mga07m45_12088_c1 | nmdc:mga07m45_12088_c1_162_890 | 211 |
| 324 | 3300050516 | nmdc:mga0sz30_10784_c2 | nmdc:mga0sz30_10784_c2_1487_2215 | 211 |
| 325 | iso_pu_bacteria | 2773857763 | 2774399513 | 211 |
| 326 | iso_pu_bacteria | 8045830549 | 8045831612 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cnw-assembly1.cif.gz_A | crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans | 0.9563 | 2 | 205 |
| 3gl5-assembly1.cif.gz_A-2 | crystal structure of probable dsba oxidoreductase sco1869 from streptomyces coelicolor | 0.956 | 2 | 204 |
| 5xwh-assembly1.cif.gz_A | structure of frne, a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in the presence of gsh | 0.9545 | 2 | 205 |
| 5cp1-assembly1.cif.gz_A-2 | crystal structure of c239s mutant of a novel disulfide oxidoreductase from deinococcus radiodurans | 0.9383 | 2 | 205 |
| 5cnw-assembly1.cif.gz_A | crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans | 0.9211 | 2 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xwhA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9545 | 2 | 205 | 3.40.30.10 |
| 3gl5A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9433 | 1 | 204 | 3.40.30.10 |
| 5cp1A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9383 | 2 | 205 | 3.40.30.10 |
| 5xwhA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9279 | 2 | 205 | 3.40.30.10 |
| 3gl5A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9215 | 1 | 204 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4TGX2-F1-model_v4 | DsbA family oxidoreductase | 0.9918 | 1 | 206 |
GO:0016491
|
| AF-A0A662Z4T3-F1-model_v4 | Predicted dithiol-disulfide isomerase, DsbA family | 0.9843 | 1 | 211 |
GO:0016491
GO:0016853 |
| AF-A0A2T0T6A7-F1-model_v4 | Putative DsbA family dithiol-disulfide isomerase | 0.9813 | 1 | 204 |
GO:0016491
GO:0016853 |
| AF-A0A850J1A4-F1-model_v4 | DsbA family oxidoreductase | 0.9804 | 1 | 209 |
GO:0016491
|
| AF-A0A1I2D258-F1-model_v4 | Predicted dithiol-disulfide isomerase, DsbA family | 0.9787 | 2 | 205 |
GO:0016491
GO:0016853 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar