F408164

General Info

Members Datasets Scaffolds Average Seq Length
326 200 321 217

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100359389|Ga0070660_1003593891
Length 234
Sequence MKVEIWSDVACPWCYLGKRRFESALDSFEHEADVELRWRSFELDPGAPAVREGDPVQRLADKYGMSRTDAVAANARLTGLAADAGLEYHLDKLRSGNTFDAHRLIHLAADKGIQDDVKERFLRAYFTEVEPIGDREALARIAVDAGLAADDVNDVLATDRYADAVRADEAQASAYGISGVPFLVIDEKYGVSGAQSPDVLLEALRRAWATANPLTMVDDATGDGGACEGDSCAV

Samples

Sample ID Description Type Environment
1 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
2 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
3 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
200 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 0.31
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0
Rhizoplane 1.84
Rhizosphere 90.49
Stem 0
Stem Tuber 0
Unclassified 3.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10012373 3300003323 Bacteria 1677
2 rootH1_10035738 3300003323 Bacteria 1214
3 rootH1_10094004 3300003323 Bacteria 7545
4 JGI25405J52794_10012012 3300003911 Bacteria 1662
5 Ga0065714_10183790 3300005288 Unclassified 953
6 Ga0065714_10184875 3300005288 Bacteria 949
7 Ga0065704_10104337 3300005289 Bacteria 2108
8 Ga0065715_10003675 3300005293 Bacteria 7379
9 Ga0065715_10120613 3300005293 Bacteria 2252
10 Ga0065707_10006934 3300005295 Bacteria 3086
11 Ga0070676_10014068 3300005328 Bacteria 4391
12 Ga0070676_10226485 3300005328 Unclassified 1237
13 Ga0070690_100015536 3300005330 Bacteria 4545
14 Ga0070690_100104711 3300005330 Unclassified 1880
15 Ga0070670_100026031 3300005331 Bacteria 5035
16 Ga0068869_100077897 3300005334 Bacteria 2467
17 Ga0070666_10002995 3300005335 Bacteria 10241
18 Ga0068868_100008394 3300005338 Bacteria 7393
19 Ga0068868_100961717 3300005338 Bacteria 779
20 Ga0070660_100359389 3300005339 Bacteria 1200
21 Ga0070689_100032565 3300005340 Bacteria 3966
22 Ga0070689_100044341 3300005340 Bacteria 3421
23 Ga0070689_100101572 3300005340 Bacteria 2276
24 Ga0070687_100018912 3300005343 Bacteria 3196
25 Ga0070661_100147944 3300005344 Bacteria 1774
26 Ga0070661_100336798 3300005344 Bacteria 1181
27 Ga0070692_10153892 3300005345 Bacteria 1312
28 Ga0070668_100102881 3300005347 Bacteria 2265
29 Ga0070668_100112924 3300005347 Bacteria 2164
30 Ga0070669_100032843 3300005353 Bacteria 3750
31 Ga0070669_100173033 3300005353 Bacteria 1685
32 Ga0070675_100017181 3300005354 Bacteria 5751
33 Ga0070675_100018282 3300005354 Bacteria 5579
34 Ga0070675_100021865 3300005354 Bacteria 5110
35 Ga0070675_100134711 3300005354 Bacteria 2108
36 Ga0070671_100203308 3300005355 Bacteria 1680
37 Ga0070674_100523385 3300005356 Bacteria 991
38 Ga0070673_100011011 3300005364 Bacteria 6157
39 Ga0070673_100055168 3300005364 Bacteria 3130
40 Ga0070673_100207009 3300005364 Bacteria 1692
41 Ga0070673_100266543 3300005364 Bacteria 1498
42 Ga0070673_100549642 3300005364 Bacteria 1049
43 Ga0070688_100031961 3300005365 Bacteria 3170
44 Ga0070659_100152064 3300005366 Bacteria 1888
45 Ga0070659_100201865 3300005366 Unclassified 1637
46 Ga0070667_100010723 3300005367 Bacteria 7572
47 Ga0070714_100729867 3300005435 Bacteria 957
48 Ga0070701_10017541 3300005438 Bacteria 3347
49 Ga0070701_10179178 3300005438 Bacteria 1239
50 Ga0070705_100171872 3300005440 Bacteria 1459
51 Ga0070700_100010378 3300005441 Bacteria 5140
52 Ga0070663_100044439 3300005455 Bacteria 3132
53 Ga0070663_100442457 3300005455 Bacteria 1070
54 Ga0070678_100195876 3300005456 Bacteria 1664
55 Ga0070662_100011433 3300005457 Bacteria 5859
56 Ga0070681_10546175 3300005458 Bacteria 1072
57 Ga0068867_100019426 3300005459 Bacteria 4842
58 Ga0068867_100154034 3300005459 Bacteria 1807
59 Ga0070685_10089718 3300005466 Bacteria 1859
60 Ga0070679_100015494 3300005530 Bacteria 7327
61 Ga0070684_100184780 3300005535 Bacteria 1896
62 Ga0070672_100011201 3300005543 Bacteria 6250
63 Ga0070686_100005345 3300005544 Bacteria 7103
64 Ga0070686_100084548 3300005544 Unclassified 2109
65 Ga0070686_100177007 3300005544 Bacteria 1513
66 Ga0070665_100196402 3300005548 Bacteria 2019
67 Ga0070665_100307104 3300005548 Bacteria 1590
68 Ga0070704_100815019 3300005549 Bacteria 835
69 Ga0070664_100171530 3300005564 Bacteria 1924
70 Ga0070664_100184568 3300005564 Bacteria 1856
71 Ga0070664_100318290 3300005564 Bacteria 1409
72 Ga0070664_100373751 3300005564 Bacteria 1300
73 Ga0068857_100249098 3300005577 Bacteria 1628
74 Ga0068857_100533550 3300005577 Bacteria 1104
75 Ga0068856_100009951 3300005614 Bacteria 9234
76 Ga0068856_100253606 3300005614 Bacteria 1774
77 Ga0068856_100440217 3300005614 Bacteria 1324
78 Ga0070702_100284487 3300005615 Bacteria 1137
79 Ga0068852_100091271 3300005616 Bacteria 2725
80 Ga0068852_101252870 3300005616 Unclassified 763
81 Ga0068859_100051896 3300005617 Bacteria 4123
82 Ga0068859_100053754 3300005617 Bacteria 4050
83 Ga0068859_100148255 3300005617 Bacteria 2421
84 Ga0068859_100570974 3300005617 Bacteria 1225
85 Ga0068864_100011224 3300005618 Bacteria 7406
86 Ga0068864_100132221 3300005618 Bacteria 2243
87 Ga0068864_100164935 3300005618 Bacteria 2016
88 Ga0068864_100869945 3300005618 Bacteria 889
89 Ga0068861_100129470 3300005719 Bacteria 2047
90 Ga0068861_100942895 3300005719 Bacteria 820
91 Ga0068861_101017437 3300005719 Bacteria 792
92 Ga0068870_10008656 3300005840 Bacteria 4587
93 Ga0068863_100012206 3300005841 Bacteria 8296
94 Ga0068863_100878461 3300005841 Bacteria 896
95 Ga0068858_100227298 3300005842 Bacteria 1768
96 Ga0068862_100001971 3300005844 Bacteria 18620
97 Ga0081455_10000126 3300005937 Bacteria 88702
98 Ga0081455_10210505 3300005937 Bacteria 1449
99 Ga0075365_10000821 3300006038 Bacteria 12815
100 Ga0075368_10116635 3300006042 Bacteria 1104
101 Ga0075364_10012084 3300006051 Bacteria 5270
102 Ga0075369_10023371 3300006186 Bacteria 2555
103 Ga0097621_100020893 3300006237 Bacteria 5051
104 Ga0068871_100096283 3300006358 Bacteria 2472
105 Ga0068871_100105717 3300006358 Bacteria 2362
106 Ga0075428_100044172 3300006844 Bacteria 4898
107 Ga0075430_100003855 3300006846 Bacteria 12629
108 Ga0075430_100057897 3300006846 Bacteria 3258
109 Ga0075430_100246284 3300006846 Bacteria 1481
110 Ga0075431_100030437 3300006847 Bacteria 5560
111 Ga0075431_100047381 3300006847 Bacteria 4431
112 Ga0075431_100111804 3300006847 Bacteria 2819
113 Ga0075433_10012441 3300006852 Bacteria 6876
114 Ga0075433_10048496 3300006852 Bacteria 3693
115 Ga0075434_100046832 3300006871 Bacteria 4291
116 Ga0075429_100180908 3300006880 Bacteria 1848
117 Ga0068865_100008774 3300006881 Bacteria 6249
118 Ga0097620_100051896 3300006931 Bacteria 4123
119 Ga0097620_100053762 3300006931 Bacteria 4050
120 Ga0097620_100148265 3300006931 Bacteria 2421
121 Ga0097620_100571036 3300006931 Bacteria 1225
122 Ga0075435_100063176 3300007076 Bacteria 3007
123 Ga0105240_10037536 3300009093 Bacteria 6226
124 Ga0105240_10051450 3300009093 Bacteria 5182
125 Ga0111539_10001329 3300009094 Bacteria 32962
126 Ga0111539_10003097 3300009094 Bacteria 22050
127 Ga0111539_10011343 3300009094 Bacteria 11192
128 Ga0111539_10038255 3300009094 Bacteria 5787
129 Ga0111539_10061982 3300009094 Bacteria 4428
130 Ga0111539_10062887 3300009094 Bacteria 4392
131 Ga0111539_10378206 3300009094 Bacteria 1649
132 Ga0114129_10046133 3300009147 Bacteria 6125
133 Ga0114129_10078176 3300009147 Bacteria 4602
134 Ga0114129_10132016 3300009147 Bacteria 3429
135 Ga0114129_11402347 3300009147 Bacteria 862
136 Ga0105248_10151024 3300009177 Bacteria 2621
137 Ga0105237_10030022 3300009545 Bacteria 5523
138 Ga0105237_10802564 3300009545 Bacteria 948
139 Ga0105238_10277972 3300009551 Bacteria 1655
140 Ga0105249_10037145 3300009553 Bacteria 4420
141 Ga0105239_10045131 3300010375 Bacteria 4830
142 Ga0105239_10334434 3300010375 Bacteria 1709
143 Ga0105239_10612608 3300010375 Bacteria 1242
144 Ga0105246_10017832 3300011119 Bacteria 4515
145 Ga0157370_10458695 3300013104 Bacteria 1171
146 Ga0157369_10009811 3300013105 Bacteria 10953
147 Ga0171462_1003 3300013250 Bacteria 853796
148 Ga0157374_10184493 3300013296 Bacteria 2039
149 Ga0157375_10093380 3300013308 Bacteria 3075
150 Ga0163163_10288802 3300014325 Bacteria 1692
151 Ga0163163_10311261 3300014325 Unclassified 1628
152 Ga0157380_10037911 3300014326 Bacteria 3739
153 Ga0157380_10047481 3300014326 Bacteria 3378
154 Ga0157380_10434841 3300014326 Bacteria 1255
155 Ga0157380_10819699 3300014326 Bacteria 949
156 Ga0163161_10064341 3300017792 Bacteria 2675
157 Ga0163161_10095051 3300017792 Bacteria 2210
158 Ga0206353_10759943 3300020082 Bacteria 3222
159 Ga0207682_10001452 3300025893 Bacteria 10938
160 Ga0207680_10190019 3300025903 Bacteria 1393
161 Ga0207645_10016609 3300025907 Bacteria 4871
162 Ga0207643_10004455 3300025908 Bacteria 7529
163 Ga0207707_10123357 3300025912 Bacteria 2265
164 Ga0207695_10045362 3300025913 Bacteria 4666
165 Ga0207695_10097871 3300025913 Bacteria 2934
166 Ga0207671_10410121 3300025914 Bacteria 1078
167 Ga0207660_10464940 3300025917 Bacteria 1024
168 Ga0207662_10002849 3300025918 Bacteria 8749
169 Ga0207657_10444441 3300025919 Bacteria 1018
170 Ga0207681_10060547 3300025923 Bacteria 2599
171 Ga0207650_10004533 3300025925 Bacteria 9497
172 Ga0207659_10000879 3300025926 Bacteria 17854
173 Ga0207659_10028782 3300025926 Bacteria 3779
174 Ga0207659_10040722 3300025926 Bacteria 3251
175 Ga0207659_10609260 3300025926 Bacteria 931
176 Ga0207664_10027478 3300025929 Bacteria 4314
177 Ga0207664_10369107 3300025929 Bacteria 1273
178 Ga0207690_10113837 3300025932 Unclassified 1953
179 Ga0207690_10166747 3300025932 Bacteria 1647
180 Ga0207706_10299042 3300025933 Bacteria 1402
181 Ga0207670_10020942 3300025936 Bacteria 4025
182 Ga0207670_10027184 3300025936 Bacteria 3615
183 Ga0207670_10049312 3300025936 Bacteria 2815
184 Ga0207669_10465373 3300025937 Bacteria 1005
185 Ga0207704_10116365 3300025938 Bacteria 1819
186 Ga0207691_10021507 3300025940 Bacteria 6090
187 Ga0207691_10040600 3300025940 Bacteria 4298
188 Ga0207711_10733695 3300025941 Bacteria 921
189 Ga0207661_10016494 3300025944 Bacteria 5450
190 Ga0207661_10289737 3300025944 Bacteria 1465
191 Ga0207679_10016149 3300025945 Bacteria 4951
192 Ga0207679_10138978 3300025945 Bacteria 1961
193 Ga0207679_10183241 3300025945 Bacteria 1734
194 Ga0207679_10361750 3300025945 Bacteria 1267
195 Ga0207667_10008753 3300025949 Bacteria 11993
196 Ga0207667_10098316 3300025949 Bacteria 3020
197 Ga0207651_10000566 3300025960 Bacteria 15605
198 Ga0207651_10004917 3300025960 Bacteria 6817
199 Ga0207651_10023865 3300025960 Bacteria 3771
200 Ga0207712_10008483 3300025961 Bacteria 6497
201 Ga0207668_10010859 3300025972 Bacteria 5517
202 Ga0207668_10357233 3300025972 Unclassified 1223
203 Ga0207658_10219270 3300025986 Bacteria 1599
204 Ga0207703_10042669 3300026035 Bacteria 3639
205 Ga0207678_10000268 3300026067 Bacteria 47323
206 Ga0207708_10054377 3300026075 Bacteria 3052
207 Ga0207702_10009642 3300026078 Bacteria 8106
208 Ga0207702_10486448 3300026078 Bacteria 1202
209 Ga0207641_10011479 3300026088 Bacteria 7272
210 Ga0207641_10332310 3300026088 Unclassified 1444
211 Ga0207648_10011813 3300026089 Bacteria 8206
212 Ga0207676_10420449 3300026095 Bacteria 1253
213 Ga0207676_10629376 3300026095 Bacteria 1033
214 Ga0207676_10776874 3300026095 Bacteria 933
215 Ga0207674_10027185 3300026116 Bacteria 6058
216 Ga0207674_10343846 3300026116 Bacteria 1442
217 Ga0207675_100104653 3300026118 Bacteria 2667
218 Ga0207675_100542253 3300026118 Bacteria 1162
219 Ga0207675_100780934 3300026118 Bacteria 968
220 Ga0207683_10027605 3300026121 Bacteria 4904
221 Ga0207698_10162925 3300026142 Bacteria 1953
222 Ga0209813_10117640 3300027866 Bacteria 922
223 Ga0207428_10025128 3300027907 Bacteria 4989
224 Ga0207428_10190212 3300027907 Unclassified 1548
225 Ga0268266_10205762 3300028379 Bacteria 1803
226 Ga0268266_10451831 3300028379 Bacteria 1222
227 Ga0268265_10020356 3300028380 Bacteria 4629
228 Ga0307408_100048390 3300031548 Unclassified 3050
229 Ga0307405_10174931 3300031731 Bacteria 1535
230 Ga0307413_10285480 3300031824 Bacteria 1244
231 Ga0307413_10547304 3300031824 Unclassified 938
232 Ga0307407_10121394 3300031903 Bacteria 1657
233 Ga0307412_10197651 3300031911 Bacteria 1525
234 Ga0307409_100367319 3300031995 Bacteria 1363
235 Ga0307409_100373827 3300031995 Bacteria 1352
236 Ga0307416_100119728 3300032002 Unclassified 2343
237 Ga0307416_100584850 3300032002 Bacteria 1194
238 Ga0307416_101506052 3300032002 Bacteria 778
239 Ga0307411_10746082 3300032005 Bacteria 857
240 Ga0307415_100271306 3300032126 Bacteria 1390
241 Ga0373932_0034406 3300035112 Bacteria 1427
242 Ga0373941_0167330 3300035115 Bacteria 817
243 Ga0451841_0056327 3300041498 Bacteria 1606
244 Ga0439432_037528 3300042006 Bacteria 1546
245 Ga0466972_0001827 3300044658 Bacteria 10424
246 Ga0453683_0054561 3300044673 Bacteria 2501
247 Ga0466965_0008383 3300044683 Bacteria 4781
248 Ga0466961_0114288 3300044693 Bacteria 1697
249 Ga0466968_0073229 3300044735 Bacteria 1494
250 Ga0466970_0009984 3300044765 Bacteria 4808
251 Ga0466970_0279667 3300044765 Bacteria 938
252 Ga0466960_0349376 3300044901 Bacteria 843
253 Ga0451576_0215969 3300045051 Bacteria 2002
254 Ga0466967_0211380 3300045976 Bacteria 1840
255 Ga0495649_0124304 3300046694 Bacteria 1363
256 Ga0496105_0151033 3300048908 Bacteria 1909
257 Ga0496109_0390895 3300048912 Bacteria 1314
258 Ga0496109_0493826 3300048912 Unclassified 1155
259 Ga0496112_0314832 3300048915 Bacteria 1510
260 Ga0496113_0111854 3300048916 Bacteria 2127
261 Ga0496115_0230562 3300048918 Bacteria 1527
262 Ga0496117_0021676 3300048920 Bacteria 5186
263 Ga0496118_0023094 3300048921 Bacteria 5415
264 Ga0496119_0001250 3300048922 Bacteria 31590
265 Ga0496123_0067091 3300048926 Bacteria 2268
266 Ga0496124_0083713 3300048927 Bacteria 2617
267 Ga0501038_0134839 3300049574 Bacteria 2024
268 Ga0501042_0001970 3300049578 Bacteria 12367
269 Ga0501042_0399199 3300049578 Bacteria 996
270 Ga0501046_0039286 3300049580 Bacteria 3791
271 Ga0501069_0097298 3300049585 Bacteria 1668
272 Ga0501070_0002121 3300049586 Bacteria 17393
273 Ga0501070_0008777 3300049586 Bacteria 8547
274 Ga0501071_0230532 3300049587 Bacteria 1395
275 Ga0501071_0283818 3300049587 Bacteria 1253
276 Ga0501072_0063980 3300049588 Bacteria 2901
277 Ga0501072_0134635 3300049588 Bacteria 1970
278 Ga0501073_0296216 3300049589 Bacteria 1116
279 Ga0501075_0095796 3300049591 Bacteria 2252
280 Ga0501075_0110493 3300049591 Bacteria 2090
281 Ga0501075_0654042 3300049591 Bacteria 801
282 Ga0501076_0083099 3300049592 Bacteria 2571
283 Ga0501076_0284364 3300049592 Bacteria 1355
284 Ga0501079_0016689 3300049741 Bacteria 5608
285 Ga0501079_0125165 3300049741 Bacteria 2000
286 Ga0501080_0238502 3300049742 Bacteria 1660
287 Ga0501081_0012427 3300049743 Bacteria 5596
288 Ga0501081_0160585 3300049743 Bacteria 1619
289 Ga0501044_0178572 3300049823 Bacteria 2091
290 Ga0501045_0265484 3300049824 Bacteria 1278
291 Ga0501045_0594971 3300049824 Bacteria 819
292 nmdc:mga03n38_127743_c1 3300050490 Bacteria 1256
293 nmdc:mga00v17_15500_c1 3300050491 Bacteria 4278
294 nmdc:mga0yw44_16278_c1 3300050492 Bacteria 4013
295 nmdc:mga06z11_103541_c1 3300050494 Bacteria 1566
296 nmdc:mga04h51_40248_c1 3300050495 Bacteria 1522
297 nmdc:mga07m45_12088_c1 3300050496 Bacteria 4554
298 nmdc:mga05p37_125811_c1 3300050507 Bacteria 3148
299 nmdc:mga05p37_356510_c1 3300050507 Unclassified 1721
300 nmdc:mga05p37_50144_c1 3300050507 Bacteria 5133
301 nmdc:mga09592_42902_c1 3300050508 Bacteria 3805
302 nmdc:mga09592_541795_c1 3300050508 Bacteria 1000
303 nmdc:mga09592_767540_c1 3300050508 Bacteria 817
304 nmdc:mga0qj67_164227_c1 3300050509 Bacteria 1802
305 nmdc:mga0qj67_232935_c1 3300050509 Bacteria 1494
306 nmdc:mga0qj67_35890_c1 3300050509 Bacteria 3877
307 nmdc:mga06r32_10589_c1 3300050510 Bacteria 8315
308 nmdc:mga06r32_1419416_c1 3300050510 Bacteria 636
309 nmdc:mga06r32_47144_c1 3300050510 Bacteria 4115
310 nmdc:mga06r32_96075_c1 3300050510 Bacteria 2901
311 nmdc:mga08y16_12726_c1 3300050511 Bacteria 8852
312 nmdc:mga08y16_150021_c1 3300050511 Bacteria 2423
313 nmdc:mga08y16_1518_c1 3300050511 Bacteria 23353
314 nmdc:mga08y16_23799_c1 3300050511 Bacteria 6467
315 nmdc:mga08y16_40062_c1 3300050511 Bacteria 4913
316 nmdc:mga0n895_15006_c1 3300050512 Bacteria 7057
317 nmdc:mga0rr50_122955_c1 3300050513 Bacteria 2068
318 nmdc:mga0a205_3535_c1 3300050515 Bacteria 13971
319 nmdc:mga0a205_64405_c1 3300050515 Bacteria 3540
320 nmdc:mga0sz30_10784_c2 3300050516 Bacteria 2555
321 Ga0501084_0011959 3300054114 Bacteria 7187

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025929 Ga0207664_10027478 Ga0207664_100274784 174
2 3300050510 nmdc:mga06r32_1419416_c1 nmdc:mga06r32_1419416_c1_32_592 176
3 3300005353 Ga0070669_100032843 Ga0070669_1000328433 187
4 3300005354 Ga0070675_100018282 Ga0070675_1000182822 187
5 3300005364 Ga0070673_100011011 Ga0070673_1000110113 187
6 3300005544 Ga0070686_100084548 Ga0070686_1000845481 187
7 3300025923 Ga0207681_10060547 Ga0207681_100605472 187
8 3300025936 Ga0207670_10049312 Ga0207670_100493122 187
9 3300049578 Ga0501042_0399199 Ga0501042_0399199_263_919 189
10 3300026118 Ga0207675_100542253 Ga0207675_1005422532 191
11 3300005293 Ga0065715_10003675 Ga0065715_1000367510 196
12 3300005328 Ga0070676_10226485 Ga0070676_102264852 196
13 3300005330 Ga0070690_100104711 Ga0070690_1001047112 196
14 3300005340 Ga0070689_100101572 Ga0070689_1001015722 196
15 3300005347 Ga0070668_100112924 Ga0070668_1001129242 196
16 3300005455 Ga0070663_100044439 Ga0070663_1000444394 196
17 3300005466 Ga0070685_10089718 Ga0070685_100897182 196
18 3300005543 Ga0070672_100011201 Ga0070672_1000112012 196
19 3300005616 Ga0068852_101252870 Ga0068852_1012528701 196
20 3300006846 Ga0075430_100246284 Ga0075430_1002462842 196
21 3300009147 Ga0114129_11402347 Ga0114129_114023471 196
22 3300025940 Ga0207691_10021507 Ga0207691_100215072 196
23 3300025960 Ga0207651_10004917 Ga0207651_100049173 196
24 3300025972 Ga0207668_10357233 Ga0207668_103572332 196
25 3300026067 Ga0207678_10000268 Ga0207678_100002685 196
26 3300049587 Ga0501071_0283818 Ga0501071_0283818_440_1099 196
27 3300049588 Ga0501072_0134635 Ga0501072_0134635_311_970 196
28 3300049591 Ga0501075_0095796 Ga0501075_0095796_1300_1959 196
29 3300049824 Ga0501045_0265484 Ga0501045_0265484_426_1085 196
30 3300050508 nmdc:mga09592_767540_c1 nmdc:mga09592_767540_c1_58_687 196
31 3300050509 nmdc:mga0qj67_232935_c1 nmdc:mga0qj67_232935_c1_323_979 196
32 3300044693 Ga0466961_0114288 Ga0466961_0114288_995_1633 199
33 3300049578 Ga0501042_0001970 Ga0501042_0001970_5415_6071 200
34 3300049580 Ga0501046_0039286 Ga0501046_0039286_2371_3036 200
35 3300049587 Ga0501071_0230532 Ga0501071_0230532_138_803 200
36 3300049588 Ga0501072_0063980 Ga0501072_0063980_1127_1783 200
37 3300049591 Ga0501075_0110493 Ga0501075_0110493_477_1133 200
38 3300049592 Ga0501076_0083099 Ga0501076_0083099_286_951 200
39 3300049741 Ga0501079_0016689 Ga0501079_0016689_1163_1828 200
40 3300049743 Ga0501081_0160585 Ga0501081_0160585_921_1577 200
41 3300054114 Ga0501084_0011959 Ga0501084_0011959_1716_2381 200
42 3300005435 Ga0070714_100729867 Ga0070714_1007298672 201
43 3300025929 Ga0207664_10369107 Ga0207664_103691072 201
44 3300031548 Ga0307408_100048390 Ga0307408_1000483902 202
45 3300031731 Ga0307405_10174931 Ga0307405_101749312 202
46 3300031824 Ga0307413_10547304 Ga0307413_105473041 202
47 3300032002 Ga0307416_100119728 Ga0307416_1001197282 202
48 3300003911 JGI25405J52794_10012012 JGI25405J52794_100120122 203
49 3300005344 Ga0070661_100147944 Ga0070661_1001479442 203
50 3300042006 Ga0439432_037528 Ga0439432_037528_405_1037 203
51 3300005288 Ga0065714_10184875 Ga0065714_101848752 204
52 3300005331 Ga0070670_100026031 Ga0070670_1000260312 204
53 3300005344 Ga0070661_100336798 Ga0070661_1003367982 204
54 3300005617 Ga0068859_100053754 Ga0068859_1000537544 204
55 3300005618 Ga0068864_100011224 Ga0068864_1000112244 204
56 3300005719 Ga0068861_100129470 Ga0068861_1001294702 204
57 3300006931 Ga0097620_100053762 Ga0097620_1000537624 204
58 3300009094 Ga0111539_10378206 Ga0111539_103782062 204
59 3300025925 Ga0207650_10004533 Ga0207650_1000453312 204
60 3300025945 Ga0207679_10183241 Ga0207679_101832412 204
61 3300005577 Ga0068857_100533550 Ga0068857_1005335502 205
62 3300005614 Ga0068856_100253606 Ga0068856_1002536061 205
63 3300005937 Ga0081455_10000126 Ga0081455_1000012650 205
64 3300009093 Ga0105240_10037536 Ga0105240_100375364 205
65 3300009094 Ga0111539_10062887 Ga0111539_100628872 205
66 3300009545 Ga0105237_10030022 Ga0105237_100300223 205
67 3300009545 Ga0105237_10802564 Ga0105237_108025642 205
68 3300009551 Ga0105238_10277972 Ga0105238_102779722 205
69 3300010375 Ga0105239_10334434 Ga0105239_103344343 205
70 3300010375 Ga0105239_10612608 Ga0105239_106126081 205
71 3300014326 Ga0157380_10819699 Ga0157380_108196991 205
72 3300025913 Ga0207695_10097871 Ga0207695_100978712 205
73 3300025914 Ga0207671_10410121 Ga0207671_104101211 205
74 3300025949 Ga0207667_10008753 Ga0207667_100087539 205
75 3300025949 Ga0207667_10098316 Ga0207667_100983163 205
76 3300005293 Ga0065715_10120613 Ga0065715_101206132 206
77 3300005328 Ga0070676_10014068 Ga0070676_100140683 206
78 3300005330 Ga0070690_100015536 Ga0070690_1000155362 206
79 3300005334 Ga0068869_100077897 Ga0068869_1000778972 206
80 3300005335 Ga0070666_10002995 Ga0070666_100029952 206
81 3300005338 Ga0068868_100008394 Ga0068868_1000083946 206
82 3300005340 Ga0070689_100032565 Ga0070689_1000325654 206
83 3300005343 Ga0070687_100018912 Ga0070687_1000189122 206
84 3300005347 Ga0070668_100102881 Ga0070668_1001028813 206
85 3300005355 Ga0070671_100203308 Ga0070671_1002033082 206
86 3300005364 Ga0070673_100055168 Ga0070673_1000551682 206
87 3300005366 Ga0070659_100152064 Ga0070659_1001520642 206
88 3300005367 Ga0070667_100010723 Ga0070667_1000107232 206
89 3300005438 Ga0070701_10017541 Ga0070701_100175412 206
90 3300005440 Ga0070705_100171872 Ga0070705_1001718722 206
91 3300005441 Ga0070700_100010378 Ga0070700_1000103782 206
92 3300005456 Ga0070678_100195876 Ga0070678_1001958762 206
93 3300005457 Ga0070662_100011433 Ga0070662_1000114334 206
94 3300005459 Ga0068867_100019426 Ga0068867_1000194264 206
95 3300005544 Ga0070686_100005345 Ga0070686_1000053453 206
96 3300005549 Ga0070704_100815019 Ga0070704_1008150191 206
97 3300005577 Ga0068857_100249098 Ga0068857_1002490981 206
98 3300005615 Ga0070702_100284487 Ga0070702_1002844872 206
99 3300005616 Ga0068852_100091271 Ga0068852_1000912713 206
100 3300005617 Ga0068859_100051896 Ga0068859_1000518964 206
101 3300005618 Ga0068864_100164935 Ga0068864_1001649352 206
102 3300005840 Ga0068870_10008656 Ga0068870_100086563 206
103 3300005841 Ga0068863_100012206 Ga0068863_1000122066 206
104 3300005842 Ga0068858_100227298 Ga0068858_1002272983 206
105 3300005844 Ga0068862_100001971 Ga0068862_10000197114 206
106 3300006237 Ga0097621_100020893 Ga0097621_1000208935 206
107 3300006358 Ga0068871_100105717 Ga0068871_1001057173 206
108 3300006847 Ga0075431_100111804 Ga0075431_1001118043 206
109 3300006852 Ga0075433_10012441 Ga0075433_100124414 206
110 3300006871 Ga0075434_100046832 Ga0075434_1000468325 206
111 3300006880 Ga0075429_100180908 Ga0075429_1001809081 206
112 3300006881 Ga0068865_100008774 Ga0068865_1000087744 206
113 3300006931 Ga0097620_100051896 Ga0097620_1000518964 206
114 3300007076 Ga0075435_100063176 Ga0075435_1000631763 206
115 3300009094 Ga0111539_10003097 Ga0111539_100030977 206
116 3300009177 Ga0105248_10151024 Ga0105248_101510243 206
117 3300009553 Ga0105249_10037145 Ga0105249_100371454 206
118 3300011119 Ga0105246_10017832 Ga0105246_100178323 206
119 3300013296 Ga0157374_10184493 Ga0157374_101844932 206
120 3300014326 Ga0157380_10047481 Ga0157380_100474813 206
121 3300017792 Ga0163161_10064341 Ga0163161_100643413 206
122 3300025893 Ga0207682_10001452 Ga0207682_100014529 206
123 3300025903 Ga0207680_10190019 Ga0207680_101900192 206
124 3300025907 Ga0207645_10016609 Ga0207645_100166094 206
125 3300025908 Ga0207643_10004455 Ga0207643_100044554 206
126 3300025918 Ga0207662_10002849 Ga0207662_100028498 206
127 3300025932 Ga0207690_10166747 Ga0207690_101667472 206
128 3300025936 Ga0207670_10020942 Ga0207670_100209424 206
129 3300025938 Ga0207704_10116365 Ga0207704_101163652 206
130 3300025940 Ga0207691_10040600 Ga0207691_100406004 206
131 3300025941 Ga0207711_10733695 Ga0207711_107336951 206
132 3300025945 Ga0207679_10016149 Ga0207679_100161494 206
133 3300025960 Ga0207651_10023865 Ga0207651_100238653 206
134 3300025961 Ga0207712_10008483 Ga0207712_100084834 206
135 3300025986 Ga0207658_10219270 Ga0207658_102192702 206
136 3300026035 Ga0207703_10042669 Ga0207703_100426692 206
137 3300026075 Ga0207708_10054377 Ga0207708_100543772 206
138 3300026088 Ga0207641_10011479 Ga0207641_100114795 206
139 3300026089 Ga0207648_10011813 Ga0207648_100118134 206
140 3300026121 Ga0207683_10027605 Ga0207683_100276052 206
141 3300026142 Ga0207698_10162925 Ga0207698_101629253 206
142 3300027907 Ga0207428_10025128 Ga0207428_100251283 206
143 3300028380 Ga0268265_10020356 Ga0268265_100203564 206
144 3300032002 Ga0307416_101506052 Ga0307416_1015060521 206
145 3300035112 Ga0373932_0034406 Ga0373932_0034406_93_734 206
146 3300035115 Ga0373941_0167330 Ga0373941_0167330_67_708 206
147 3300044673 Ga0453683_0054561 Ga0453683_0054561_104_745 206
148 3300045051 Ga0451576_0215969 Ga0451576_0215969_829_1470 206
149 3300050508 nmdc:mga09592_42902_c1 nmdc:mga09592_42902_c1_3107_3748 206
150 3300050509 nmdc:mga0qj67_164227_c1 nmdc:mga0qj67_164227_c1_1049_1696 206
151 3300050510 nmdc:mga06r32_96075_c1 nmdc:mga06r32_96075_c1_591_1268 206
152 3300050511 nmdc:mga08y16_40062_c1 nmdc:mga08y16_40062_c1_1133_1774 206
153 3300050512 nmdc:mga0n895_15006_c1 nmdc:mga0n895_15006_c1_6337_6978 206
154 3300050513 nmdc:mga0rr50_122955_c1 nmdc:mga0rr50_122955_c1_409_1050 206
155 3300050515 nmdc:mga0a205_3535_c1 nmdc:mga0a205_3535_c1_10097_10738 206
156 3300031903 Ga0307407_10121394 Ga0307407_101213942 207
157 3300031995 Ga0307409_100373827 Ga0307409_1003738272 207
158 3300032002 Ga0307416_100584850 Ga0307416_1005848502 207
159 iso_pu_bacteria 8003314358 8003324036 207
160 3300003323 rootH1_10035738 rootH1_100357383 208
161 3300003323 rootH1_10094004 rootH1_100940045 208
162 3300005614 Ga0068856_100009951 Ga0068856_1000099514 208
163 3300009093 Ga0105240_10051450 Ga0105240_100514503 208
164 3300010375 Ga0105239_10045131 Ga0105239_100451314 208
165 3300025913 Ga0207695_10045362 Ga0207695_100453622 208
166 3300026078 Ga0207702_10009642 Ga0207702_100096427 208
167 3300049823 Ga0501044_0178572 Ga0501044_0178572_170_811 208
168 3300005345 Ga0070692_10153892 Ga0070692_101538922 209
169 3300005364 Ga0070673_100549642 Ga0070673_1005496422 209
170 3300005458 Ga0070681_10546175 Ga0070681_105461751 209
171 3300005530 Ga0070679_100015494 Ga0070679_1000154945 209
172 3300005564 Ga0070664_100171530 Ga0070664_1001715302 209
173 3300005614 Ga0068856_100440217 Ga0068856_1004402172 209
174 3300006358 Ga0068871_100096283 Ga0068871_1000962833 209
175 3300006846 Ga0075430_100003855 Ga0075430_1000038553 209
176 3300006847 Ga0075431_100030437 Ga0075431_1000304375 209
177 3300009094 Ga0111539_10061982 Ga0111539_100619822 209
178 3300013105 Ga0157369_10009811 Ga0157369_1000981112 209
179 3300014325 Ga0163163_10288802 Ga0163163_102888021 209
180 3300020082 Ga0206353_10759943 Ga0206353_107599432 209
181 3300025912 Ga0207707_10123357 Ga0207707_101233572 209
182 3300025944 Ga0207661_10016494 Ga0207661_100164943 209
183 3300026078 Ga0207702_10486448 Ga0207702_104864482 209
184 3300026116 Ga0207674_10027185 Ga0207674_100271856 209
185 3300032005 Ga0307411_10746082 Ga0307411_107460822 209
186 3300044901 Ga0466960_0349376 Ga0466960_0349376_134_784 209
187 3300048912 Ga0496109_0390895 Ga0496109_0390895_608_1270 209
188 3300048915 Ga0496112_0314832 Ga0496112_0314832_184_852 209
189 3300049592 Ga0501076_0284364 Ga0501076_0284364_232_879 209
190 3300050508 nmdc:mga09592_541795_c1 nmdc:mga09592_541795_c1_235_882 209
191 3300050509 nmdc:mga0qj67_35890_c1 nmdc:mga0qj67_35890_c1_1156_1803 209
192 3300050510 nmdc:mga06r32_47144_c1 nmdc:mga06r32_47144_c1_1158_1805 209
193 3300050511 nmdc:mga08y16_150021_c1 nmdc:mga08y16_150021_c1_1400_2047 209
194 3300005288 Ga0065714_10183790 Ga0065714_101837901 210
195 3300005289 Ga0065704_10104337 Ga0065704_101043372 210
196 3300005295 Ga0065707_10006934 Ga0065707_100069342 210
197 3300005338 Ga0068868_100961717 Ga0068868_1009617171 210
198 3300005340 Ga0070689_100044341 Ga0070689_1000443412 210
199 3300005353 Ga0070669_100173033 Ga0070669_1001730333 210
200 3300005354 Ga0070675_100017181 Ga0070675_1000171813 210
201 3300005354 Ga0070675_100021865 Ga0070675_1000218653 210
202 3300005354 Ga0070675_100134711 Ga0070675_1001347112 210
203 3300005356 Ga0070674_100523385 Ga0070674_1005233852 210
204 3300005364 Ga0070673_100207009 Ga0070673_1002070093 210
205 3300005364 Ga0070673_100266543 Ga0070673_1002665432 210
206 3300005365 Ga0070688_100031961 Ga0070688_1000319613 210
207 3300005366 Ga0070659_100201865 Ga0070659_1002018652 210
208 3300005438 Ga0070701_10179178 Ga0070701_101791782 210
209 3300005459 Ga0068867_100154034 Ga0068867_1001540342 210
210 3300005535 Ga0070684_100184780 Ga0070684_1001847802 210
211 3300005544 Ga0070686_100177007 Ga0070686_1001770072 210
212 3300005548 Ga0070665_100307104 Ga0070665_1003071042 210
213 3300005564 Ga0070664_100184568 Ga0070664_1001845681 210
214 3300005564 Ga0070664_100318290 Ga0070664_1003182902 210
215 3300005564 Ga0070664_100373751 Ga0070664_1003737513 210
216 3300005617 Ga0068859_100148255 Ga0068859_1001482553 210
217 3300005617 Ga0068859_100570974 Ga0068859_1005709742 210
218 3300005618 Ga0068864_100132221 Ga0068864_1001322213 210
219 3300005618 Ga0068864_100869945 Ga0068864_1008699451 210
220 3300005719 Ga0068861_101017437 Ga0068861_1010174371 210
221 3300005841 Ga0068863_100878461 Ga0068863_1008784611 210
222 3300005937 Ga0081455_10210505 Ga0081455_102105052 210
223 3300006844 Ga0075428_100044172 Ga0075428_1000441723 210
224 3300006846 Ga0075430_100057897 Ga0075430_1000578974 210
225 3300006847 Ga0075431_100047381 Ga0075431_1000473812 210
226 3300006852 Ga0075433_10048496 Ga0075433_100484964 210
227 3300006931 Ga0097620_100148265 Ga0097620_1001482653 210
228 3300006931 Ga0097620_100571036 Ga0097620_1005710362 210
229 3300009094 Ga0111539_10001329 Ga0111539_1000132910 210
230 3300009094 Ga0111539_10011343 Ga0111539_100113439 210
231 3300009094 Ga0111539_10038255 Ga0111539_100382555 210
232 3300009147 Ga0114129_10046133 Ga0114129_100461334 210
233 3300009147 Ga0114129_10078176 Ga0114129_100781762 210
234 3300009147 Ga0114129_10132016 Ga0114129_101320163 210
235 3300013308 Ga0157375_10093380 Ga0157375_100933803 210
236 3300014325 Ga0163163_10311261 Ga0163163_103112612 210
237 3300014326 Ga0157380_10037911 Ga0157380_100379113 210
238 3300014326 Ga0157380_10434841 Ga0157380_104348412 210
239 3300025926 Ga0207659_10000879 Ga0207659_100008793 210
240 3300025926 Ga0207659_10028782 Ga0207659_100287823 210
241 3300025926 Ga0207659_10040722 Ga0207659_100407223 210
242 3300025926 Ga0207659_10609260 Ga0207659_106092602 210
243 3300025932 Ga0207690_10113837 Ga0207690_101138372 210
244 3300025933 Ga0207706_10299042 Ga0207706_102990422 210
245 3300025936 Ga0207670_10027184 Ga0207670_100271845 210
246 3300025937 Ga0207669_10465373 Ga0207669_104653732 210
247 3300025944 Ga0207661_10289737 Ga0207661_102897372 210
248 3300025945 Ga0207679_10138978 Ga0207679_101389782 210
249 3300025945 Ga0207679_10361750 Ga0207679_103617502 210
250 3300025960 Ga0207651_10000566 Ga0207651_100005663 210
251 3300025972 Ga0207668_10010859 Ga0207668_100108596 210
252 3300026088 Ga0207641_10332310 Ga0207641_103323102 210
253 3300026095 Ga0207676_10420449 Ga0207676_104204493 210
254 3300026095 Ga0207676_10629376 Ga0207676_106293762 210
255 3300026095 Ga0207676_10776874 Ga0207676_107768742 210
256 3300026116 Ga0207674_10343846 Ga0207674_103438462 210
257 3300026118 Ga0207675_100104653 Ga0207675_1001046532 210
258 3300026118 Ga0207675_100780934 Ga0207675_1007809342 210
259 3300027907 Ga0207428_10190212 Ga0207428_101902122 210
260 3300028379 Ga0268266_10451831 Ga0268266_104518312 210
261 3300048908 Ga0496105_0151033 Ga0496105_0151033_416_1090 210
262 3300048912 Ga0496109_0493826 Ga0496109_0493826_228_893 210
263 3300048916 Ga0496113_0111854 Ga0496113_0111854_214_879 210
264 3300049589 Ga0501073_0296216 Ga0501073_0296216_108_794 210
265 3300049591 Ga0501075_0654042 Ga0501075_0654042_59_712 210
266 3300049743 Ga0501081_0012427 Ga0501081_0012427_10_666 210
267 3300049824 Ga0501045_0594971 Ga0501045_0594971_21_671 210
268 3300050507 nmdc:mga05p37_125811_c1 nmdc:mga05p37_125811_c1_787_1452 210
269 3300050507 nmdc:mga05p37_356510_c1 nmdc:mga05p37_356510_c1_873_1538 210
270 3300050507 nmdc:mga05p37_50144_c1 nmdc:mga05p37_50144_c1_213_881 210
271 3300050510 nmdc:mga06r32_10589_c1 nmdc:mga06r32_10589_c1_3146_3811 210
272 3300050511 nmdc:mga08y16_12726_c1 nmdc:mga08y16_12726_c1_6392_7060 210
273 3300050511 nmdc:mga08y16_1518_c1 nmdc:mga08y16_1518_c1_12992_13657 210
274 3300050511 nmdc:mga08y16_23799_c1 nmdc:mga08y16_23799_c1_2590_3255 210
275 3300050515 nmdc:mga0a205_64405_c1 nmdc:mga0a205_64405_c1_1393_2058 210
276 iso_pu_bacteria 2821268502 2821270029 210
277 iso_pu_bacteria 2833709550 2833710978 210
278 3300003323 rootH1_10012373 rootH1_100123732 211
279 3300005339 Ga0070660_100359389 Ga0070660_1003593891 211
280 3300005455 Ga0070663_100442457 Ga0070663_1004424571 211
281 3300005548 Ga0070665_100196402 Ga0070665_1001964023 211
282 3300005719 Ga0068861_100942895 Ga0068861_1009428951 211
283 3300006038 Ga0075365_10000821 Ga0075365_1000082112 211
284 3300006042 Ga0075368_10116635 Ga0075368_101166351 211
285 3300006051 Ga0075364_10012084 Ga0075364_100120842 211
286 3300006186 Ga0075369_10023371 Ga0075369_100233712 211
287 3300013104 Ga0157370_10458695 Ga0157370_104586952 211
288 3300013250 Ga0171462_1003 Ga0171462_1003375 211
289 3300017792 Ga0163161_10095051 Ga0163161_100950512 211
290 3300025917 Ga0207660_10464940 Ga0207660_104649402 211
291 3300025919 Ga0207657_10444441 Ga0207657_104444412 211
292 3300027866 Ga0209813_10117640 Ga0209813_101176401 211
293 3300028379 Ga0268266_10205762 Ga0268266_102057623 211
294 3300031824 Ga0307413_10285480 Ga0307413_102854802 211
295 3300031911 Ga0307412_10197651 Ga0307412_101976512 211
296 3300031995 Ga0307409_100367319 Ga0307409_1003673192 211
297 3300032126 Ga0307415_100271306 Ga0307415_1002713062 211
298 3300041498 Ga0451841_0056327 Ga0451841_0056327_333_1037 211
299 3300044658 Ga0466972_0001827 Ga0466972_0001827_563_1210 211
300 3300044683 Ga0466965_0008383 Ga0466965_0008383_3976_4656 211
301 3300044735 Ga0466968_0073229 Ga0466968_0073229_328_1008 211
302 3300044765 Ga0466970_0009984 Ga0466970_0009984_114_761 211
303 3300044765 Ga0466970_0279667 Ga0466970_0279667_231_911 211
304 3300045976 Ga0466967_0211380 Ga0466967_0211380_690_1346 211
305 3300046694 Ga0495649_0124304 Ga0495649_0124304_70_750 211
306 3300048918 Ga0496115_0230562 Ga0496115_0230562_182_865 211
307 3300048920 Ga0496117_0021676 Ga0496117_0021676_4335_5030 211
308 3300048921 Ga0496118_0023094 Ga0496118_0023094_2264_2959 211
309 3300048922 Ga0496119_0001250 Ga0496119_0001250_1327_2016 211
310 3300048926 Ga0496123_0067091 Ga0496123_0067091_572_1267 211
311 3300048927 Ga0496124_0083713 Ga0496124_0083713_566_1261 211
312 3300049574 Ga0501038_0134839 Ga0501038_0134839_1111_1791 211
313 3300049585 Ga0501069_0097298 Ga0501069_0097298_512_1216 211
314 3300049586 Ga0501070_0002121 Ga0501070_0002121_9893_10573 211
315 3300049586 Ga0501070_0008777 Ga0501070_0008777_3684_4388 211
316 3300049741 Ga0501079_0125165 Ga0501079_0125165_784_1443 211
317 3300049742 Ga0501080_0238502 Ga0501080_0238502_298_1002 211
318 3300050490 nmdc:mga03n38_127743_c1 nmdc:mga03n38_127743_c1_195_875 211
319 3300050491 nmdc:mga00v17_15500_c1 nmdc:mga00v17_15500_c1_469_1197 211
320 3300050492 nmdc:mga0yw44_16278_c1 nmdc:mga0yw44_16278_c1_2557_3237 211
321 3300050494 nmdc:mga06z11_103541_c1 nmdc:mga06z11_103541_c1_787_1467 211
322 3300050495 nmdc:mga04h51_40248_c1 nmdc:mga04h51_40248_c1_639_1367 211
323 3300050496 nmdc:mga07m45_12088_c1 nmdc:mga07m45_12088_c1_162_890 211
324 3300050516 nmdc:mga0sz30_10784_c2 nmdc:mga0sz30_10784_c2_1487_2215 211
325 iso_pu_bacteria 2773857763 2774399513 211
326 iso_pu_bacteria 8045830549 8045831612 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

2

205

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.9563 2 205
3gl5-assembly1.cif.gz_A-2 crystal structure of probable dsba oxidoreductase sco1869 from streptomyces coelicolor 0.956 2 204
5xwh-assembly1.cif.gz_A structure of frne, a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in the presence of gsh 0.9545 2 205
5cp1-assembly1.cif.gz_A-2 crystal structure of c239s mutant of a novel disulfide oxidoreductase from deinococcus radiodurans 0.9383 2 205
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.9211 2 205
ID Description Score Start End Superfamily
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9545 2 205 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9433 1 204 3.40.30.10
5cp1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9383 2 205 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9279 2 205 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9215 1 204 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Y4TGX2-F1-model_v4 DsbA family oxidoreductase 0.9918 1 206 GO:0016491
AF-A0A662Z4T3-F1-model_v4 Predicted dithiol-disulfide isomerase, DsbA family 0.9843 1 211 GO:0016491
GO:0016853
AF-A0A2T0T6A7-F1-model_v4 Putative DsbA family dithiol-disulfide isomerase 0.9813 1 204 GO:0016491
GO:0016853
AF-A0A850J1A4-F1-model_v4 DsbA family oxidoreductase 0.9804 1 209 GO:0016491
AF-A0A1I2D258-F1-model_v4 Predicted dithiol-disulfide isomerase, DsbA family 0.9787 2 205 GO:0016491
GO:0016853

Feature Viewer

pLDDT pTM Quality
95.42 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map