F404391

General Info

Members Datasets Scaffolds Average Seq Length
317 214 292 294

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2932422444|2932426856
Length 325
Sequence AWLVAFGLTFSLTSPVLAQSATAQKAPTTRDRISVVVEGSGPDVILIPGLASSRDIWRGLAARLQQSHRLHLVQVAGFAGAPAAHDPQGPVIGPTAEAVADYIEREHLQAPAIIGHSLGGEAALMLSARHPERVSRLMIVDALPFYSLLLDPSATSEKATPGAAAFRDTLLTATDAQMEAMQTTSLARLAKTETARPSLLAASLRSDRQTVANATYELMTSDLRPELSRITVPVHVIYAYDTSYGIPVGNVDATFQSAYAATPQVSFQRIDGSYHFVMLDQPEQFERAVIDFLSPTTRTIKPIRLPDEFSTGASMPVPVGKNQEQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
4 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
5 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
6 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
7 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
8 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
9 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
10 2643221583 Caulobacter sp. Root655 Isolate Unclassified
11 2643221584 Caulobacter sp. Root656 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
15 2818991435 Caulobacter henricii 536 Isolate Unclassified
16 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
17 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
18 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
19 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
20 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
21 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
123 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
126 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
127 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
128 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
129 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
202 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 8052494512 Pseudomonas putida LD6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.85
Metatranscriptomes 1.26
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.09
Nodule 0
Rhizoplane 1.26
Rhizosphere 68.14
Stem 0
Stem Tuber 0.32
Unclassified 14.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1489589 2162886007 Bacteria 5693
2 SwRhRL2b_contig_1609021 2162886007 Bacteria 2189
3 SwRhRL2b_contig_3792225 2162886007 Bacteria 1757
4 JGI24739J22299_10000861 3300001989 Bacteria 11204
5 JGI24737J22298_10004627 3300001990 Bacteria 4788
6 JGI24737J22298_10005181 3300001990 Bacteria 4512
7 JGI24735J21928_10000171 3300002067 Bacteria 23201
8 JGI24738J21930_10000580 3300002075 Bacteria 10491
9 rootH1_10084043 3300003316 Bacteria 2154
10 rootH2_10009044 3300003320 Bacteria 1341
11 rootL2_10036646 3300003322 Bacteria 6967
12 rootL2_10343894 3300003322 Bacteria 1138
13 Ga0055526_1018543 3300003771 Bacteria 2591
14 Ga0055524_1016997 3300003775 Bacteria 2582
15 Ga0055536_1001560 3300003781 Bacteria 13736
16 Ga0055528_1008785 3300003790 Bacteria 4281
17 Ga0055530_10002634 3300003791 Bacteria 11252
18 Ga0055531_10000965 3300003794 Bacteria 23016
19 Ga0065165_1002272 3300005262 Bacteria 16947
20 Ga0065704_10003204 3300005289 Bacteria 4455
21 Ga0065704_10071383 3300005289 Bacteria 11381
22 Ga0065704_10071804 3300005289 Bacteria 9892
23 Ga0070658_10000085 3300005327 Bacteria 87440
24 Ga0070683_100195657 3300005329 Bacteria 1920
25 Ga0070670_100083815 3300005331 Bacteria 2739
26 Ga0070677_10000588 3300005333 Bacteria 12270
27 Ga0070666_10088867 3300005335 Bacteria 2120
28 Ga0070666_10250972 3300005335 Bacteria 1253
29 Ga0070660_100184949 3300005339 Bacteria 1687
30 Ga0070671_100020231 3300005355 Bacteria 5426
31 Ga0070713_100081775 3300005436 Bacteria 2757
32 Ga0070663_100001578 3300005455 Bacteria 12540
33 Ga0070663_100119866 3300005455 Bacteria 1986
34 Ga0070681_10025446 3300005458 Bacteria 5953
35 Ga0068856_100033689 3300005614 Bacteria 5016
36 Ga0068856_100403933 3300005614 Bacteria 1386
37 Ga0068859_100025117 3300005617 Bacteria 5980
38 Ga0068864_100073219 3300005618 Bacteria 2987
39 Ga0068863_100044677 3300005841 Bacteria 4204
40 Ga0068862_100085609 3300005844 Bacteria 2739
41 Ga0068862_100126566 3300005844 Bacteria 2256
42 Ga0081539_10003747 3300005985 Bacteria 18067
43 Ga0081539_10024852 3300005985 Bacteria 3873
44 Ga0075369_10018994 3300006186 Bacteria 2802
45 Ga0075366_10011310 3300006195 Bacteria 5036
46 Ga0075434_100104687 3300006871 Bacteria 2839
47 Ga0097620_100025117 3300006931 Bacteria 5980
48 Ga0105251_10011896 3300009011 Bacteria 4943
49 Ga0105244_10000016 3300009036 Bacteria 255363
50 Ga0105244_10002121 3300009036 Bacteria 15248
51 Ga0105244_10002562 3300009036 Bacteria 13643
52 Ga0105244_10019600 3300009036 Bacteria 3772
53 Ga0105244_10063601 3300009036 Bacteria 1853
54 Ga0105250_10049601 3300009092 Bacteria 1684
55 Ga0111539_10237938 3300009094 Bacteria 2119
56 Ga0105243_10009262 3300009148 Bacteria 7517
57 Ga0105248_10049241 3300009177 Bacteria 4726
58 Ga0105248_10136444 3300009177 Bacteria 2767
59 Ga0105237_10000626 3300009545 Bacteria 49404
60 Ga0105238_10044667 3300009551 Bacteria 4479
61 Ga0105239_10000438 3300010375 Bacteria 60788
62 Ga0105246_10190378 3300011119 Bacteria 1587
63 Ga0157369_10589301 3300013105 Bacteria 1148
64 Ga0157372_10009124 3300013307 Bacteria 10536
65 Ga0163163_10023537 3300014325 Bacteria 5847
66 Ga0163163_10051008 3300014325 Bacteria 4078
67 Ga0157380_10005750 3300014326 Bacteria 8676
68 Ga0182008_10000694 3300014497 Bacteria 24242
69 Ga0182008_10007972 3300014497 Bacteria 5808
70 Ga0157376_10331511 3300014969 Bacteria 1450
71 Ga0183365_10003 3300015684 Bacteria 414944
72 Ga0206356_10092040 3300020070 Bacteria 1788
73 Ga0206354_10445778 3300020081 Bacteria 2356
74 Ga0206354_11193616 3300020081 Bacteria 3712
75 Ga0206353_10901567 3300020082 Bacteria 4619
76 Ga0213873_10000016 3300021358 Bacteria 124829
77 Ga0213876_10000056 3300021384 Bacteria 135017
78 Ga0209565_1000514 3300025263 Bacteria 27884
79 Ga0209673_1000732 3300025273 Bacteria 45546
80 Ga0209676_1000832 3300025292 Bacteria 39998
81 Ga0209564_1004935 3300025295 Bacteria 7885
82 Ga0209564_1018162 3300025295 Bacteria 2696
83 Ga0209564_1018420 3300025295 Bacteria 2662
84 Ga0209564_1023801 3300025295 Bacteria 2114
85 Ga0209758_1003930 3300025297 Bacteria 12947
86 Ga0209050_1001184 3300025298 Bacteria 30681
87 Ga0209256_1001657 3300025299 Bacteria 21640
88 Ga0209256_1003829 3300025299 Bacteria 10073
89 Ga0209051_1003081 3300025303 Bacteria 11251
90 Ga0209257_1000538 3300025304 Bacteria 65300
91 Ga0209257_1004893 3300025304 Bacteria 9889
92 Ga0207696_1000018 3300025711 Bacteria 478605
93 Ga0207696_1034487 3300025711 Bacteria 1511
94 Ga0207655_1000027 3300025728 Bacteria 444552
95 Ga0207655_1000384 3300025728 Bacteria 61818
96 Ga0207655_1030486 3300025728 Bacteria 2507
97 Ga0207713_1008264 3300025735 Bacteria 6015
98 Ga0207682_10005561 3300025893 Bacteria 5127
99 Ga0207680_10021383 3300025903 Bacteria 3500
100 Ga0207647_10000765 3300025904 Bacteria 25093
101 Ga0207705_10000116 3300025909 Bacteria 89237
102 Ga0207695_10013771 3300025913 Bacteria 9623
103 Ga0207671_10000596 3300025914 Bacteria 48191
104 Ga0207657_10051337 3300025919 Bacteria 3584
105 Ga0207650_10275837 3300025925 Unclassified 1368
106 Ga0207700_10054817 3300025928 Bacteria 2994
107 Ga0207644_10006187 3300025931 Bacteria 7805
108 Ga0207706_10087416 3300025933 Bacteria 2741
109 Ga0207709_10006319 3300025935 Bacteria 6649
110 Ga0207679_10067871 3300025945 Bacteria 2677
111 Ga0207640_10062923 3300025981 Bacteria 2464
112 Ga0207678_10000499 3300026067 Bacteria 35709
113 Ga0207678_10136947 3300026067 Bacteria 2089
114 Ga0207641_10035571 3300026088 Bacteria 4150
115 Ga0207698_10000433 3300026142 Bacteria 24089
116 Ga0307515_10035278 3300028794 Bacteria 8144
117 Ga0307515_10148487 3300028794 Bacteria 2466
118 Ga0265338_10014810 3300028800 Bacteria 8630
119 Ga0265338_10059618 3300028800 Bacteria 3361
120 Ga0265324_10053143 3300029957 Bacteria 1391
121 Ga0307413_10058260 3300031824 Bacteria 2367
122 Ga0307413_10059868 3300031824 Bacteria 2342
123 Ga0307407_10356657 3300031903 Bacteria 1037
124 Ga0307409_100488820 3300031995 Bacteria 1196
125 Ga0307414_10318538 3300032004 Bacteria 1323
126 Ga0307411_10062665 3300032005 Bacteria 2481
127 Ga0307411_10331513 3300032005 Bacteria 1233
128 Ga0373931_0048499 3300035691 Bacteria 2252
129 Ga0395899_0000176 3300037312 Bacteria 94451
130 Ga0395905_0105254 3300037471 Bacteria 2649
131 Ga0436365_0869628 3300039437 Bacteria 66366
132 Ga0436365_1910105 3300039437 Bacteria 7135
133 Ga0436363_0191683 3300039450 Bacteria 1027
134 Ga0436362_0580304 3300039453 Bacteria 124869
135 Ga0439466_0001316 3300041411 Bacteria 9680
136 Ga0439443_014745 3300042003 Bacteria 1180
137 Ga0439448_0003488 3300042005 Bacteria 4357
138 Ga0439448_0007287 3300042005 Bacteria 3203
139 Ga0439450_005693 3300042008 Bacteria 2204
140 Ga0439451_000373 3300042009 Bacteria 8672
141 Ga0439452_001743 3300042010 Bacteria 8522
142 Ga0439455_0007028 3300042012 Bacteria 2365
143 Ga0439435_0005505 3300042436 Bacteria 2790
144 Ga0466972_0014704 3300044658 Bacteria 3916
145 Ga0451576_0548138 3300045051 Unclassified 1215
146 Ga0466958_0019588 3300045836 Bacteria 3940
147 Ga0495617_048931 3300046452 Bacteria 1407
148 Ga0495627_000064 3300046453 Bacteria 132648
149 Ga0495627_000341 3300046453 Bacteria 43982
150 Ga0495638_0000387 3300046460 Bacteria 54475
151 Ga0495638_0002307 3300046460 Bacteria 15708
152 Ga0495638_0004533 3300046460 Bacteria 10520
153 Ga0495638_0005523 3300046460 Bacteria 9389
154 Ga0495638_0035510 3300046460 Bacteria 3177
155 Ga0495650_0000020 3300046471 Bacteria 533839
156 Ga0495650_0010178 3300046471 Bacteria 5269
157 Ga0495650_0036561 3300046471 Bacteria 2147
158 Ga0495585_0052993 3300046492 Bacteria 2246
159 Ga0495607_0000107 3300046501 Bacteria 87580
160 Ga0495607_0068108 3300046501 Bacteria 1998
161 Ga0495583_0000001 3300046506 Bacteria 811973
162 Ga0495606_0006281 3300046507 Bacteria 11021
163 Ga0495610_0000056 3300046512 Bacteria 138703
164 Ga0495610_0001703 3300046512 Bacteria 19302
165 Ga0495610_0002390 3300046512 Bacteria 15805
166 Ga0495616_0000209 3300046513 Bacteria 48633
167 Ga0495620_0000030 3300046515 Bacteria 122177
168 Ga0495631_0000188 3300046518 Bacteria 42112
169 Ga0495631_0005679 3300046518 Bacteria 6509
170 Ga0495632_0000615 3300046519 Bacteria 32915
171 Ga0495632_0001035 3300046519 Bacteria 23990
172 Ga0495632_0019282 3300046519 Bacteria 3720
173 Ga0495632_0035123 3300046519 Bacteria 2560
174 Ga0495637_0009631 3300046520 Bacteria 4708
175 Ga0495637_0026055 3300046520 Bacteria 2630
176 Ga0495643_0000025 3300046522 Bacteria 269043
177 Ga0495643_0000473 3300046522 Bacteria 51253
178 Ga0495648_0002910 3300046524 Bacteria 15387
179 Ga0495648_0116726 3300046524 Bacteria 1442
180 Ga0495652_0108111 3300046529 Unclassified 2242
181 Ga0495654_0000010 3300046530 Bacteria 378481
182 Ga0495654_0004383 3300046530 Bacteria 8397
183 Ga0495597_0041878 3300046542 Bacteria 2044
184 Ga0495645_0272229 3300046543 Bacteria 1117
185 Ga0495668_0000031 3300046616 Bacteria 256576
186 Ga0495668_0000060 3300046616 Bacteria 193823
187 Ga0495668_0004517 3300046616 Bacteria 9846
188 Ga0495668_0037209 3300046616 Bacteria 2723
189 Ga0495668_0037958 3300046616 Bacteria 2693
190 Ga0495625_0000563 3300046660 Bacteria 54414
191 Ga0495625_0006135 3300046660 Bacteria 10765
192 Ga0495625_0009854 3300046660 Bacteria 7948
193 Ga0495625_0012052 3300046660 Bacteria 7015
194 Ga0495625_0043863 3300046660 Bacteria 3240
195 Ga0495625_0075434 3300046660 Bacteria 2359
196 Ga0495625_0176205 3300046660 Bacteria 1425
197 Ga0495625_0252385 3300046660 Bacteria 1145
198 Ga0495625_0280795 3300046660 Bacteria 1071
199 Ga0495671_0056339 3300046692 Bacteria 1946
200 Ga0495671_0082623 3300046692 Bacteria 1574
201 Ga0495589_0023634 3300046794 Bacteria 3130
202 Ga0495660_0031104 3300046810 Bacteria 3003
203 Ga0495672_0001209 3300047320 Bacteria 26035
204 Ga0495672_0003554 3300047320 Bacteria 13271
205 Ga0495683_0016644 3300047323 Bacteria 3816
206 Ga0495679_006494 3300047446 Bacteria 5019
207 Ga0495673_0000195 3300047469 Bacteria 95428
208 Ga0495681_0018243 3300047470 Bacteria 3870
209 Ga0495681_0057573 3300047470 Bacteria 1804
210 Ga0495686_0002204 3300047472 Bacteria 18924
211 Ga0495686_0011675 3300047472 Bacteria 6185
212 Ga0495686_0014125 3300047472 Bacteria 5507
213 Ga0495686_0114715 3300047472 Bacteria 1612
214 Ga0495686_0138466 3300047472 Bacteria 1438
215 Ga0495686_0242599 3300047472 Bacteria 1015
216 Ga0495626_0111829 3300048091 Bacteria 1182
217 Ga0496107_0000073 3300048910 Bacteria 48489
218 Ga0496109_0485827 3300048912 Bacteria 1166
219 Ga0496114_0029066 3300048917 Bacteria 4540
220 Ga0496115_0258908 3300048918 Bacteria 1431
221 Ga0496116_0056838 3300048919 Bacteria 2562
222 Ga0496117_0001325 3300048920 Bacteria 36399
223 Ga0496117_0002677 3300048920 Bacteria 22017
224 Ga0496117_0006977 3300048920 Bacteria 11195
225 Ga0496118_0000632 3300048921 Bacteria 57785
226 Ga0496118_0028109 3300048921 Bacteria 4744
227 Ga0496121_0002640 3300048924 Bacteria 26981
228 Ga0496121_0013241 3300048924 Bacteria 8884
229 Ga0496121_0140569 3300048924 Bacteria 1792
230 Ga0496122_0005255 3300048925 Bacteria 15519
231 Ga0496122_0070790 3300048925 Bacteria 2489
232 Ga0496123_0072417 3300048926 Bacteria 2144
233 Ga0496123_0112325 3300048926 Bacteria 1554
234 Ga0496124_0014454 3300048927 Bacteria 7633
235 Ga0496124_0029981 3300048927 Bacteria 4837
236 Ga0496125_0000232 3300048928 Bacteria 114025
237 Ga0496125_0000414 3300048928 Bacteria 79745
238 Ga0496125_0039323 3300048928 Bacteria 4076
239 Ga0496125_0065634 3300048928 Bacteria 2873
240 Ga0496126_0050503 3300048929 Bacteria 3789
241 Ga0496126_0119511 3300048929 Bacteria 2287
242 Ga0496126_0132330 3300048929 Bacteria 2154
243 Ga0495678_008789 3300049459 Bacteria 5059
244 Ga0501032_0036682 3300049569 Bacteria 3345
245 Ga0501033_0037080 3300049570 Bacteria 3650
246 Ga0501034_0017108 3300049571 Bacteria 7438
247 Ga0501034_0053722 3300049571 Unclassified 4056
248 Ga0501034_0190774 3300049571 Bacteria 2011
249 Ga0501034_0477283 3300049571 Bacteria 1162
250 Ga0501037_0079909 3300049573 Bacteria 2373
251 Ga0501038_0157498 3300049574 Bacteria 1848
252 Ga0501039_0086115 3300049575 Bacteria 2447
253 Ga0501043_0070487 3300049579 Bacteria 2746
254 Ga0501043_0240827 3300049579 Bacteria 1395
255 Ga0501046_0176574 3300049580 Bacteria 1600
256 Ga0501047_0000480 3300049581 Bacteria 43454
257 Ga0501238_001790 3300049671 Bacteria 2508
258 Ga0501080_0061559 3300049742 Bacteria 3494
259 Ga0501083_0002317 3300049744 Bacteria 13009
260 Ga0501035_0026999 3300049822 Bacteria 5250
261 Ga0501035_0077926 3300049822 Unclassified 2929
262 Ga0501044_0293554 3300049823 Bacteria 1556
263 nmdc:mga0k408_68905_c1 3300050493 Bacteria 2064
264 nmdc:mga0sz30_9371_c1 3300050516 Bacteria 3724
265 Ga0500578_0000387 3300053086 Bacteria 54007
266 Ga0500578_0248975 3300053086 Bacteria 1071
267 Ga0500651_0032487 3300053093 Bacteria 3289
268 Ga0500554_001100 3300053102 Bacteria 5247
269 Ga0500556_0002634 3300053104 Bacteria 5610
270 Ga0500556_0005331 3300053104 Bacteria 3635
271 Ga0500562_000388 3300053108 Bacteria 10696
272 Ga0500594_0000328 3300053118 Bacteria 10626
273 Ga0500608_000367 3300053122 Bacteria 17481
274 Ga0500618_000627 3300053125 Bacteria 21344
275 Ga0500658_0006135 3300053134 Bacteria 4474
276 Ga0500659_0006380 3300053135 Bacteria 6549
277 Ga0500559_0000045 3300053136 Bacteria 99550
278 Ga0500559_0004480 3300053136 Bacteria 6618
279 Ga0500559_0038317 3300053136 Bacteria 2081
280 Ga0500568_0001086 3300053139 Bacteria 18326
281 Ga0500604_0000073 3300053151 Bacteria 35955
282 Ga0500616_0000267 3300053153 Bacteria 78217
283 Ga0500616_0006272 3300053153 Bacteria 7824
284 Ga0500616_0052670 3300053153 Bacteria 2139
285 Ga0500622_0000389 3300053156 Bacteria 42477
286 Ga0500622_0006702 3300053156 Bacteria 6637
287 Ga0500622_0006923 3300053156 Bacteria 6497
288 Ga0500622_0007563 3300053156 Bacteria 6156
289 Ga0500645_000888 3300053730 Bacteria 17345
290 Ga0500609_000030 3300053731 Bacteria 19108
291 Ga0501082_0045930 3300060353 Bacteria 3766
292 Ga0466962_0027866 3300061719 Bacteria 2708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053135 Ga0500659_0006380 Ga0500659_0006380_4931_5716 228
2 3300009551 Ga0105238_10044667 Ga0105238_100446673 242
3 iso_pu_bacteria 2928531327 2928531665 248
4 3300053086 Ga0500578_0248975 Ga0500578_0248975_15_767 250
5 3300048925 Ga0496122_0070790 Ga0496122_0070790_1370_2176 253
6 3300013105 Ga0157369_10589301 Ga0157369_105893011 258
7 3300014497 Ga0182008_10000694 Ga0182008_100006946 258
8 3300009036 Ga0105244_10063601 Ga0105244_100636012 259
9 3300009036 Ga0105244_10002121 Ga0105244_1000212115 260
10 3300025728 Ga0207655_1000384 Ga0207655_10003842 260
11 3300048924 Ga0496121_0013241 Ga0496121_0013241_2988_3881 260
12 3300005329 Ga0070683_100195657 Ga0070683_1001956572 261
13 3300021358 Ga0213873_10000016 Ga0213873_1000001645 261
14 3300021384 Ga0213876_10000056 Ga0213876_1000005693 261
15 3300032004 Ga0307414_10318538 Ga0307414_103185382 261
16 3300039437 Ga0436365_0869628 Ga0436365_0869628_43340_44290 261
17 3300039453 Ga0436362_0580304 Ga0436362_0580304_43340_44290 261
18 3300046543 Ga0495645_0272229 Ga0495645_0272229_40_867 261
19 3300048924 Ga0496121_0140569 Ga0496121_0140569_31_819 262
20 3300042436 Ga0439435_0005505 Ga0439435_0005505_1384_2217 263
21 3300049571 Ga0501034_0053722 Ga0501034_0053722_705_1637 263
22 3300015684 Ga0183365_10003 Ga0183365_1000334 264
23 3300009011 Ga0105251_10011896 Ga0105251_100118963 268
24 3300009092 Ga0105250_10049601 Ga0105250_100496012 268
25 3300025711 Ga0207696_1034487 Ga0207696_10344871 268
26 3300025735 Ga0207713_1008264 Ga0207713_10082643 268
27 3300046660 Ga0495625_0075434 Ga0495625_0075434_672_1553 268
28 3300048917 Ga0496114_0029066 Ga0496114_0029066_1649_2548 268
29 3300048927 Ga0496124_0029981 Ga0496124_0029981_1671_2570 268
30 3300048928 Ga0496125_0065634 Ga0496125_0065634_1174_2073 268
31 3300046542 Ga0495597_0041878 Ga0495597_0041878_1033_1956 269
32 3300046616 Ga0495668_0037209 Ga0495668_0037209_1599_2480 269
33 3300047470 Ga0495681_0018243 Ga0495681_0018243_356_1276 269
34 3300053136 Ga0500559_0004480 Ga0500559_0004480_3624_4508 269
35 3300046501 Ga0495607_0068108 Ga0495607_0068108_685_1605 270
36 3300046512 Ga0495610_0002390 Ga0495610_0002390_340_1242 270
37 3300025913 Ga0207695_10013771 Ga0207695_100137714 271
38 3300005355 Ga0070671_100020231 Ga0070671_1000202314 272
39 3300005614 Ga0068856_100403933 Ga0068856_1004039332 272
40 3300025931 Ga0207644_10006187 Ga0207644_100061873 272
41 3300031824 Ga0307413_10058260 Ga0307413_100582602 272
42 3300031903 Ga0307407_10356657 Ga0307407_103566571 272
43 3300031995 Ga0307409_100488820 Ga0307409_1004888202 272
44 3300032005 Ga0307411_10062665 Ga0307411_100626652 272
45 3300042005 Ga0439448_0007287 Ga0439448_0007287_1154_2083 272
46 3300042012 Ga0439455_0007028 Ga0439455_0007028_746_1675 272
47 3300048920 Ga0496117_0002677 Ga0496117_0002677_18651_19550 272
48 3300048921 Ga0496118_0028109 Ga0496118_0028109_2322_3221 272
49 3300042005 Ga0439448_0003488 Ga0439448_0003488_735_1679 273
50 3300042008 Ga0439450_005693 Ga0439450_005693_506_1450 273
51 3300046512 Ga0495610_0001703 Ga0495610_0001703_14830_15747 273
52 3300014326 Ga0157380_10005750 Ga0157380_100057507 274
53 3300025945 Ga0207679_10067871 Ga0207679_100678712 274
54 3300005335 Ga0070666_10250972 Ga0070666_102509721 275
55 3300020081 Ga0206354_10445778 Ga0206354_104457781 275
56 3300037312 Ga0395899_0000176 Ga0395899_0000176_65087_66010 275
57 3300046660 Ga0495625_0176205 Ga0495625_0176205_333_1169 275
58 3300005617 Ga0068859_100025117 Ga0068859_1000251175 276
59 3300005618 Ga0068864_100073219 Ga0068864_1000732194 276
60 3300006931 Ga0097620_100025117 Ga0097620_1000251174 276
61 3300009094 Ga0111539_10237938 Ga0111539_102379382 276
62 3300011119 Ga0105246_10190378 Ga0105246_101903782 276
63 3300014325 Ga0163163_10023537 Ga0163163_100235374 276
64 3300042003 Ga0439443_014745 Ga0439443_014745_276_1115 276
65 3300046794 Ga0495589_0023634 Ga0495589_0023634_107_1021 276
66 3300047469 Ga0495673_0000195 Ga0495673_0000195_71768_72682 276
67 3300005335 Ga0070666_10088867 Ga0070666_100888672 277
68 3300005985 Ga0081539_10003747 Ga0081539_1000374712 277
69 3300025903 Ga0207680_10021383 Ga0207680_100213832 277
70 3300031824 Ga0307413_10059868 Ga0307413_100598682 277
71 3300032005 Ga0307411_10331513 Ga0307411_103315132 277
72 3300046616 Ga0495668_0000060 Ga0495668_0000060_88542_89402 277
73 3300053136 Ga0500559_0000045 Ga0500559_0000045_57663_58580 277
74 3300010375 Ga0105239_10000438 Ga0105239_1000043839 278
75 3300013307 Ga0157372_10009124 Ga0157372_100091242 278
76 3300020070 Ga0206356_10092040 Ga0206356_100920401 278
77 3300049571 Ga0501034_0017108 Ga0501034_0017108_3889_4821 278
78 3300049571 Ga0501034_0190774 Ga0501034_0190774_571_1422 278
79 3300035691 Ga0373931_0048499 Ga0373931_0048499_1000_1905 279
80 3300001990 JGI24737J22298_10005181 JGI24737J22298_100051813 281
81 iso_pu_bacteria 2884960567 2884965217 281
82 3300029957 Ga0265324_10053143 Ga0265324_100531432 282
83 3300053122 Ga0500608_000367 Ga0500608_000367_10995_11876 282
84 3300053153 Ga0500616_0006272 Ga0500616_0006272_4754_5629 282
85 3300003781 Ga0055536_1001560 Ga0055536_10015604 283
86 3300003791 Ga0055530_10002634 Ga0055530_100026344 283
87 3300005841 Ga0068863_100044677 Ga0068863_1000446774 283
88 3300005985 Ga0081539_10024852 Ga0081539_100248523 283
89 3300006186 Ga0075369_10018994 Ga0075369_100189944 283
90 3300006195 Ga0075366_10011310 Ga0075366_100113103 283
91 3300025292 Ga0209676_1000832 Ga0209676_10008328 283
92 3300025295 Ga0209564_1018162 Ga0209564_10181622 283
93 3300025298 Ga0209050_1001184 Ga0209050_100118427 283
94 3300025303 Ga0209051_1003081 Ga0209051_10030813 283
95 3300025304 Ga0209257_1004893 Ga0209257_10048937 283
96 3300026088 Ga0207641_10035571 Ga0207641_100355714 283
97 3300046522 Ga0495643_0000025 Ga0495643_0000025_19216_20088 283
98 3300047472 Ga0495686_0114715 Ga0495686_0114715_363_1244 283
99 3300047472 Ga0495686_0138466 Ga0495686_0138466_455_1345 283
100 3300048927 Ga0496124_0014454 Ga0496124_0014454_4642_5523 283
101 3300048928 Ga0496125_0039323 Ga0496125_0039323_2048_2974 283
102 3300048929 Ga0496126_0132330 Ga0496126_0132330_760_1656 283
103 3300050493 nmdc:mga0k408_68905_c1 nmdc:mga0k408_68905_c1_1014_1895 283
104 3300050516 nmdc:mga0sz30_9371_c1 nmdc:mga0sz30_9371_c1_1706_2587 283
105 3300053136 Ga0500559_0038317 Ga0500559_0038317_36_917 283
106 3300053151 Ga0500604_0000073 Ga0500604_0000073_2591_3511 283
107 3300053156 Ga0500622_0006923 Ga0500622_0006923_2120_3001 283
108 3300053156 Ga0500622_0007563 Ga0500622_0007563_1302_2192 283
109 iso_pu_bacteria 2585428106 2587919342 283
110 iso_pu_bacteria 2643221640 2644225169 283
111 iso_pu_bacteria 2643221642 2644232477 283
112 iso_pu_bacteria 2857504554 2857504695 283
113 3300005614 Ga0068856_100033689 Ga0068856_1000336893 284
114 3300026142 Ga0207698_10000433 Ga0207698_1000043320 284
115 3300037471 Ga0395905_0105254 Ga0395905_0105254_367_1296 284
116 3300044658 Ga0466972_0014704 Ga0466972_0014704_1245_2174 284
117 3300046501 Ga0495607_0000107 Ga0495607_0000107_7197_8141 284
118 3300046519 Ga0495632_0000615 Ga0495632_0000615_27561_28442 284
119 3300046524 Ga0495648_0116726 Ga0495648_0116726_307_1236 284
120 3300048091 Ga0495626_0111829 Ga0495626_0111829_19_963 284
121 3300048912 Ga0496109_0485827 Ga0496109_0485827_205_1134 284
122 3300049671 Ga0501238_001790 Ga0501238_001790_640_1521 284
123 3300053156 Ga0500622_0006702 Ga0500622_0006702_3605_4486 284
124 iso_pu_bacteria 2885427238 2885429155 284
125 3300003771 Ga0055526_1018543 Ga0055526_10185432 285
126 3300003775 Ga0055524_1016997 Ga0055524_10169971 285
127 3300003790 Ga0055528_1008785 Ga0055528_10087852 285
128 3300005262 Ga0065165_1002272 Ga0065165_10022726 285
129 3300005327 Ga0070658_10000085 Ga0070658_1000008525 285
130 3300005339 Ga0070660_100184949 Ga0070660_1001849492 285
131 3300005455 Ga0070663_100001578 Ga0070663_1000015784 285
132 3300025263 Ga0209565_1000514 Ga0209565_10005145 285
133 3300025273 Ga0209673_1000732 Ga0209673_100073232 285
134 3300025295 Ga0209564_1004935 Ga0209564_10049353 285
135 3300025295 Ga0209564_1018420 Ga0209564_10184204 285
136 3300025295 Ga0209564_1023801 Ga0209564_10238014 285
137 3300025299 Ga0209256_1003829 Ga0209256_100382910 285
138 3300025909 Ga0207705_10000116 Ga0207705_1000011626 285
139 3300025919 Ga0207657_10051337 Ga0207657_100513372 285
140 3300026067 Ga0207678_10000499 Ga0207678_1000049926 285
141 3300028794 Ga0307515_10148487 Ga0307515_101484872 285
142 3300046453 Ga0495627_000341 Ga0495627_000341_21328_22254 285
143 3300046460 Ga0495638_0000387 Ga0495638_0000387_25010_25909 285
144 3300046460 Ga0495638_0004533 Ga0495638_0004533_4076_4984 285
145 3300046513 Ga0495616_0000209 Ga0495616_0000209_41207_42115 285
146 3300046518 Ga0495631_0005679 Ga0495631_0005679_4535_5431 285
147 3300046519 Ga0495632_0035123 Ga0495632_0035123_484_1392 285
148 3300046520 Ga0495637_0026055 Ga0495637_0026055_1386_2282 285
149 3300046616 Ga0495668_0004517 Ga0495668_0004517_5985_6881 285
150 3300046660 Ga0495625_0006135 Ga0495625_0006135_2891_3775 285
151 3300046660 Ga0495625_0252385 Ga0495625_0252385_218_1126 285
152 3300046692 Ga0495671_0056339 Ga0495671_0056339_933_1829 285
153 3300046810 Ga0495660_0031104 Ga0495660_0031104_291_1199 285
154 3300047323 Ga0495683_0016644 Ga0495683_0016644_2148_3056 285
155 3300047472 Ga0495686_0002204 Ga0495686_0002204_9678_10574 285
156 3300047472 Ga0495686_0014125 Ga0495686_0014125_3812_4720 285
157 3300049459 Ga0495678_008789 Ga0495678_008789_2199_3101 285
158 3300053086 Ga0500578_0000387 Ga0500578_0000387_2237_3139 285
159 3300053102 Ga0500554_001100 Ga0500554_001100_329_1237 285
160 3300053104 Ga0500556_0005331 Ga0500556_0005331_2249_3145 285
161 3300053108 Ga0500562_000388 Ga0500562_000388_3019_3915 285
162 3300053118 Ga0500594_0000328 Ga0500594_0000328_1915_2817 285
163 3300053139 Ga0500568_0001086 Ga0500568_0001086_12537_13454 285
164 3300053153 Ga0500616_0000267 Ga0500616_0000267_40847_41764 285
165 3300053156 Ga0500622_0000389 Ga0500622_0000389_40584_41486 285
166 3300053731 Ga0500609_000030 Ga0500609_000030_11847_12755 285
167 iso_pu_bacteria 2582581279 2585146999 285
168 iso_pu_bacteria 2643221552 2643779172 285
169 iso_pu_bacteria 2643221584 2643927543 285
170 3300005458 Ga0070681_10025446 Ga0070681_100254462 286
171 3300009177 Ga0105248_10049241 Ga0105248_100492418 286
172 3300009545 Ga0105237_10000626 Ga0105237_1000062641 286
173 3300014969 Ga0157376_10331511 Ga0157376_103315112 286
174 3300025299 Ga0209256_1001657 Ga0209256_100165710 286
175 3300025914 Ga0207671_10000596 Ga0207671_100005967 286
176 3300025981 Ga0207640_10062923 Ga0207640_100629233 286
177 3300028800 Ga0265338_10014810 Ga0265338_100148108 286
178 3300028800 Ga0265338_10059618 Ga0265338_100596182 286
179 3300046460 Ga0495638_0002307 Ga0495638_0002307_11321_12208 286
180 3300046460 Ga0495638_0005523 Ga0495638_0005523_3702_4613 286
181 3300046471 Ga0495650_0000020 Ga0495650_0000020_271925_272836 286
182 3300046471 Ga0495650_0036561 Ga0495650_0036561_1087_1998 286
183 3300046507 Ga0495606_0006281 Ga0495606_0006281_7518_8429 286
184 3300046512 Ga0495610_0000056 Ga0495610_0000056_58307_59218 286
185 3300046520 Ga0495637_0009631 Ga0495637_0009631_1695_2606 286
186 3300046530 Ga0495654_0000010 Ga0495654_0000010_77590_78501 286
187 3300046660 Ga0495625_0009854 Ga0495625_0009854_2371_3282 286
188 3300046660 Ga0495625_0012052 Ga0495625_0012052_697_1608 286
189 3300046660 Ga0495625_0043863 Ga0495625_0043863_1852_2763 286
190 3300046660 Ga0495625_0280795 Ga0495625_0280795_55_966 286
191 3300046692 Ga0495671_0082623 Ga0495671_0082623_338_1249 286
192 3300047320 Ga0495672_0003554 Ga0495672_0003554_944_1855 286
193 3300053104 Ga0500556_0002634 Ga0500556_0002634_2619_3530 286
194 3300053134 Ga0500658_0006135 Ga0500658_0006135_2006_2917 286
195 3300053153 Ga0500616_0052670 Ga0500616_0052670_1016_1927 286
196 3300053730 Ga0500645_000888 Ga0500645_000888_6149_7060 286
197 iso_pu_bacteria 2643221545 2643750879 286
198 iso_pu_bacteria 2643221691 2644509953 286
199 3300003316 rootH1_10084043 rootH1_100840432 287
200 3300003322 rootL2_10343894 rootL2_103438941 287
201 3300005331 Ga0070670_100083815 Ga0070670_1000838155 287
202 3300005333 Ga0070677_10000588 Ga0070677_100005888 287
203 3300009177 Ga0105248_10136444 Ga0105248_101364443 287
204 3300025893 Ga0207682_10005561 Ga0207682_100055613 287
205 3300025925 Ga0207650_10275837 Ga0207650_102758372 287
206 3300028794 Ga0307515_10035278 Ga0307515_100352785 287
207 3300046529 Ga0495652_0108111 Ga0495652_0108111_158_1063 287
208 3300047470 Ga0495681_0057573 Ga0495681_0057573_118_1017 287
209 3300048910 Ga0496107_0000073 Ga0496107_0000073_4843_5757 287
210 3300048924 Ga0496121_0002640 Ga0496121_0002640_9319_10233 287
211 3300053125 Ga0500618_000627 Ga0500618_000627_15414_16346 287
212 3300045051 Ga0451576_0548138 Ga0451576_0548138_204_1136 288
213 3300046616 Ga0495668_0037958 Ga0495668_0037958_266_1189 288
214 iso_pu_bacteria 2585428106 2587918892 288
215 iso_pu_bacteria 2643221640 2644227681 288
216 iso_pu_bacteria 2643221642 2644236801 288
217 iso_pu_bacteria 2928531327 2928532723 288
218 3300003320 rootH2_10009044 rootH2_100090442 289
219 3300003322 rootL2_10036646 rootL2_100366468 289
220 3300003794 Ga0055531_10000965 Ga0055531_1000096513 289
221 3300005455 Ga0070663_100119866 Ga0070663_1001198662 289
222 3300005844 Ga0068862_100126566 Ga0068862_1001265662 289
223 3300025297 Ga0209758_1003930 Ga0209758_10039308 289
224 3300025304 Ga0209257_1000538 Ga0209257_100053859 289
225 3300026067 Ga0207678_10136947 Ga0207678_101369472 289
226 3300046492 Ga0495585_0052993 Ga0495585_0052993_398_1330 289
227 3300047472 Ga0495686_0242599 Ga0495686_0242599_93_968 289
228 3300048929 Ga0496126_0119511 Ga0496126_0119511_471_1382 289
229 3300049822 Ga0501035_0026999 Ga0501035_0026999_3753_4664 289
230 3300049823 Ga0501044_0293554 Ga0501044_0293554_514_1425 289
231 iso_pu_bacteria 2582581280 2585150416 289
232 iso_pu_bacteria 2582581293 2585198714 289
233 iso_pu_bacteria 2818991435 2819539499 289
234 iso_pu_bacteria 2818991454 2819649281 289
235 3300001989 JGI24739J22299_10000861 JGI24739J22299_100008619 290
236 3300001990 JGI24737J22298_10004627 JGI24737J22298_100046273 290
237 3300002067 JGI24735J21928_10000171 JGI24735J21928_1000017113 290
238 3300002075 JGI24738J21930_10000580 JGI24738J21930_100005803 290
239 3300025904 Ga0207647_10000765 Ga0207647_100007654 290
240 3300025933 Ga0207706_10087416 Ga0207706_100874162 290
241 3300039437 Ga0436365_1910105 Ga0436365_1910105_1035_1931 290
242 3300046471 Ga0495650_0010178 Ga0495650_0010178_2695_3627 290
243 3300049569 Ga0501032_0036682 Ga0501032_0036682_2098_3012 290
244 3300049570 Ga0501033_0037080 Ga0501033_0037080_2695_3609 290
245 3300049571 Ga0501034_0477283 Ga0501034_0477283_57_971 290
246 3300049573 Ga0501037_0079909 Ga0501037_0079909_1273_2187 290
247 3300049574 Ga0501038_0157498 Ga0501038_0157498_29_943 290
248 3300049575 Ga0501039_0086115 Ga0501039_0086115_22_936 290
249 3300049579 Ga0501043_0240827 Ga0501043_0240827_51_965 290
250 3300049580 Ga0501046_0176574 Ga0501046_0176574_334_1248 290
251 3300049581 Ga0501047_0000480 Ga0501047_0000480_23473_24363 290
252 iso_pu_bacteria 8052494512 8052497817 290
253 3300009036 Ga0105244_10019600 Ga0105244_100196004 291
254 3300020081 Ga0206354_11193616 Ga0206354_111936163 291
255 3300020082 Ga0206353_10901567 Ga0206353_109015676 291
256 3300045836 Ga0466958_0019588 Ga0466958_0019588_1718_2665 291
257 3300046452 Ga0495617_048931 Ga0495617_048931_288_1208 291
258 3300046453 Ga0495627_000064 Ga0495627_000064_108142_109062 291
259 3300046506 Ga0495583_0000001 Ga0495583_0000001_48369_49286 291
260 3300046518 Ga0495631_0000188 Ga0495631_0000188_3316_4236 291
261 3300046519 Ga0495632_0019282 Ga0495632_0019282_1140_2060 291
262 3300046530 Ga0495654_0004383 Ga0495654_0004383_87_1007 291
263 3300046616 Ga0495668_0000031 Ga0495668_0000031_3358_4305 291
264 3300046660 Ga0495625_0000563 Ga0495625_0000563_42469_43386 291
265 3300047320 Ga0495672_0001209 Ga0495672_0001209_22631_23551 291
266 3300047472 Ga0495686_0011675 Ga0495686_0011675_665_1594 291
267 3300049822 Ga0501035_0077926 Ga0501035_0077926_459_1400 291
268 3300061719 Ga0466962_0027866 Ga0466962_0027866_420_1367 291
269 iso_pu_bacteria 2510917020 2511124556 291
270 iso_pu_bacteria 2643221583 2643925748 291
271 3300005844 Ga0068862_100085609 Ga0068862_1000856093 292
272 3300006871 Ga0075434_100104687 Ga0075434_1001046872 292
273 3300014325 Ga0163163_10051008 Ga0163163_100510083 292
274 3300047446 Ga0495679_006494 Ga0495679_006494_904_1836 292
275 3300049742 Ga0501080_0061559 Ga0501080_0061559_733_1623 292
276 3300049744 Ga0501083_0002317 Ga0501083_0002317_1881_2771 292
277 3300060353 Ga0501082_0045930 Ga0501082_0045930_1460_2350 292
278 3300048918 Ga0496115_0258908 Ga0496115_0258908_355_1308 293
279 3300005436 Ga0070713_100081775 Ga0070713_1000817753 294
280 3300009036 Ga0105244_10000016 Ga0105244_1000001680 294
281 3300025728 Ga0207655_1000027 Ga0207655_1000027188 294
282 3300025928 Ga0207700_10054817 Ga0207700_100548173 294
283 3300046460 Ga0495638_0035510 Ga0495638_0035510_474_1400 294
284 3300046515 Ga0495620_0000030 Ga0495620_0000030_73435_74409 294
285 3300049579 Ga0501043_0070487 Ga0501043_0070487_1289_2257 294
286 3300041411 Ga0439466_0001316 Ga0439466_0001316_940_1827 295
287 3300042009 Ga0439451_000373 Ga0439451_000373_941_1828 295
288 3300042010 Ga0439452_001743 Ga0439452_001743_408_1295 295
289 iso_pu_bacteria 2511231025 2511378538 295
290 3300039450 Ga0436363_0191683 Ga0436363_0191683_42_1001 297
291 3300014497 Ga0182008_10007972 Ga0182008_100079721 298
292 2162886007 SwRhRL2b_contig_1609021 SwRhRL2b_0911.00007340 299
293 2162886007 SwRhRL2b_contig_3792225 SwRhRL2b_0640.00003460 299
294 3300005289 Ga0065704_10003204 Ga0065704_100032044 299
295 3300005289 Ga0065704_10071383 Ga0065704_100713837 299
296 3300009036 Ga0105244_10002562 Ga0105244_100025623 299
297 3300009148 Ga0105243_10009262 Ga0105243_100092626 299
298 3300025711 Ga0207696_1000018 Ga0207696_100001897 299
299 3300025728 Ga0207655_1030486 Ga0207655_10304864 299
300 3300025935 Ga0207709_10006319 Ga0207709_100063197 299
301 3300046519 Ga0495632_0001035 Ga0495632_0001035_14376_15281 299
302 3300046522 Ga0495643_0000473 Ga0495643_0000473_2378_3283 299
303 3300046524 Ga0495648_0002910 Ga0495648_0002910_9349_10254 299
304 3300048919 Ga0496116_0056838 Ga0496116_0056838_582_1556 299
305 3300048920 Ga0496117_0001325 Ga0496117_0001325_6619_7593 299
306 3300048920 Ga0496117_0006977 Ga0496117_0006977_5121_6026 299
307 3300048921 Ga0496118_0000632 Ga0496118_0000632_21527_22432 299
308 3300048928 Ga0496125_0000232 Ga0496125_0000232_30553_31458 299
309 3300048929 Ga0496126_0050503 Ga0496126_0050503_1881_2786 299
310 iso_pu_bacteria 2932422444 2932426856 302
311 3300053093 Ga0500651_0032487 Ga0500651_0032487_1801_2733 305
312 2162886007 SwRhRL2b_contig_1489589 SwRhRL2b_0839.00000360 306
313 3300005289 Ga0065704_10071804 Ga0065704_1007180410 306
314 3300048925 Ga0496122_0005255 Ga0496122_0005255_8897_9817 306
315 3300048926 Ga0496123_0072417 Ga0496123_0072417_770_1690 306
316 3300048926 Ga0496123_0112325 Ga0496123_0112325_269_1189 306
317 3300048928 Ga0496125_0000414 Ga0496125_0000414_45164_46084 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

42

282

0.7

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

44

288

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.8566 37 299
3ia2-assembly2.cif.gz_D pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog 0.8382 30 299
3hea-assembly1.cif.gz_A the l29p/l124i mutation of pseudomonas fluorescens esterase 0.8375 30 299
7c8l-assembly1.cif.gz_A hybrid designing of potent inhibitors of striga strigolactone receptor shhtl7 0.8354 39 301
7dq9-assembly4.cif.gz_D crystal structure of a type-a feruloyl esterase from gut alistipes shahii 0.8343 37 296
ID Description Score Start End Superfamily
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8934 37 146 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8789 31 143 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8498 37 299 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8422 37 299 3.40.50.1820
af_A0A0N7KCX9_11_155_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8419 44 146 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A523LJJ2-F1-model_v4 deleted 0.9719 35 297
AF-A0A7V8FEQ0-F1-model_v4 Alpha/beta hydrolase 0.9657 131 297
AF-A0A519VBD8-F1-model_v4 Alpha/beta hydrolase 0.9586 47 297 GO:0016020
GO:0016787
AF-A0A258F9F7-F1-model_v4 Alpha/beta hydrolase 0.9577 22 299 GO:0016787
AF-A0A258F9F7-F1-model_v4 Alpha/beta hydrolase 0.9543 22 299 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.37 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map