F400727

General Info

Members Datasets Scaffolds Average Seq Length
310 203 266 408

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10023400|Ga0157369_100234004
Length 405
Sequence MVSSVTDGVGEVSPSLAVPLLEPRGGIPPVTESAEDLVEVVERFANGTGPVAVDAERASGYRYSQRAYLVQLRRGGAGTALIDPIACPDLSALSAALADAEWVLHAANQDLPCLSGVGMRPTRLFDTELGARIAGYERVGLGTMSEIVLGQQLAKEHSAADWSRRPLPEAWLRYAALDVEILVDLRDALEGELSRQGKLTWAERTDPWRRTSGIHRLRTRRQLAIVRALWHARDDLARQRDIAPGRLLPDSAIIAAASVAPASADALGRLPGWGGKATRRLVPAFWPVLEQAAAEPDEGLPRPSLPGDGPPPASRWPDRDPLAAARLAAARAGLGAIAAQWGLPVENLLSPELVRRLTWTPPAEATAEAVAEVLRAGGARRWQVELTAETLAAALIPPVVTAPTP

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
6 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
7 2643221714 Streptomyces sp. Root264 Isolate Unclassified
8 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
9 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
10 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
11 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
12 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
13 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
14 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
15 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
16 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
17 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
18 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
19 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
20 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
21 2867369537 Streptomyces sp. Z26 Isolate Unclassified
22 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
23 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
24 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
25 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
26 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
27 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
28 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
29 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
30 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
31 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
32 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
33 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
34 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
35 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
36 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
37 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
38 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
79 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
84 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
85 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
86 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
87 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
88 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
89 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
104 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
191 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
192 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
193 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
194 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
195 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
196 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
199 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
200 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
201 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
202 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
203 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.81
Metatranscriptomes 0
Isolates 14.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0.65
Rhizoplane 0.32
Rhizosphere 82.9
Stem 0
Stem Tuber 0
Unclassified 11.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10005752 3300003320 Bacteria 3691
2 rootL2_10003645 3300003322 Bacteria 12504
3 rootH1_10011215 3300003323 Bacteria 2624
4 Ga0070658_10046242 3300005327 Bacteria 3522
5 Ga0070658_10242286 3300005327 Bacteria 1528
6 Ga0070658_10267530 3300005327 Bacteria 1453
7 Ga0070683_100053254 3300005329 Bacteria 3750
8 Ga0068869_100168169 3300005334 Bacteria 1711
9 Ga0070680_100002194 3300005336 Bacteria 14397
10 Ga0070680_100178337 3300005336 Bacteria 1789
11 Ga0068868_100013000 3300005338 Bacteria 6092
12 Ga0070660_100058075 3300005339 Bacteria 2999
13 Ga0070659_100014863 3300005366 Bacteria 5822
14 Ga0070659_100015310 3300005366 Bacteria 5743
15 Ga0070681_10000253 3300005458 Bacteria 42312
16 Ga0070679_100000006 3300005530 Bacteria 203959
17 Ga0070679_100136275 3300005530 Bacteria 2436
18 Ga0070684_100016930 3300005535 Bacteria 5972
19 Ga0068855_100171760 3300005563 Bacteria 2455
20 Ga0070717_10091716 3300006028 Bacteria 2566
21 Ga0075365_10129354 3300006038 Bacteria 1747
22 Ga0075363_100054013 3300006048 Bacteria 2148
23 Ga0075367_10044538 3300006178 Bacteria 2602
24 Ga0105245_10154412 3300009098 Bacteria 2173
25 Ga0157369_10000757 3300013105 Bacteria 41659
26 Ga0157369_10001215 3300013105 Bacteria 32072
27 Ga0157369_10023400 3300013105 Bacteria 6880
28 Ga0157372_10121057 3300013307 Bacteria 3006
29 Ga0183367_1001 3300015688 Bacteria 1225545
30 Ga0207647_10044359 3300025904 Bacteria 2779
31 Ga0207707_10000646 3300025912 Bacteria 34453
32 Ga0207660_10000174 3300025917 Bacteria 41019
33 Ga0207660_10187718 3300025917 Bacteria 1608
34 Ga0207652_10000012 3300025921 Bacteria 235382
35 Ga0207652_10295541 3300025921 Bacteria 1462
36 Ga0207690_10000396 3300025932 Bacteria 28762
37 Ga0207690_10003570 3300025932 Bacteria 9259
38 Ga0207661_10012364 3300025944 Bacteria 6202
39 Ga0207661_10033816 3300025944 Bacteria 3971
40 Ga0207677_10002978 3300026023 Bacteria 8939
41 Ga0307515_10000279 3300028794 Bacteria 125422
42 Ga0307512_10001091 3300030522 Bacteria 39432
43 Ga0307512_10041511 3300030522 Bacteria 3822
44 Ga0307513_10189349 3300031456 Bacteria 1911
45 Ga0307509_10097008 3300031507 Bacteria 2997
46 Ga0307508_10011880 3300031616 Bacteria 7963
47 Ga0307508_10018573 3300031616 Bacteria 6318
48 Ga0307514_10001356 3300031649 Bacteria 30991
49 Ga0307514_10188216 3300031649 Bacteria 1319
50 Ga0307516_10006318 3300031730 Bacteria 13917
51 Ga0307507_10035360 3300033179 Bacteria 5134
52 Ga0307507_10066979 3300033179 Bacteria 3287
53 Ga0307510_10077668 3300033180 Bacteria 3254
54 Ga0307510_10118348 3300033180 Bacteria 2363
55 Ga0395898_0017605 3300037466 Bacteria 7293
56 Ga0439436_0000466 3300041404 Bacteria 10410
57 Ga0439436_0006097 3300041404 Bacteria 3699
58 Ga0439439_0003766 3300041406 Bacteria 3368
59 Ga0439439_0023361 3300041406 Bacteria 1548
60 Ga0451853_0896922 3300041512 Bacteria 2759
61 Ga0451853_1871461 3300041512 Bacteria 4494
62 Ga0439433_0023329 3300041999 Bacteria 1391
63 Ga0439449_0016212 3300042007 Bacteria 2801
64 Ga0439457_013632 3300042014 Bacteria 1825
65 Ga0450894_000646 3300042131 Bacteria 5835
66 Ga0450898_010118 3300042134 Bacteria 1522
67 Ga0450899_000861 3300042135 Bacteria 3465
68 Ga0450903_007818 3300042138 Bacteria 1754
69 Ga0439458_0010742 3300042157 Bacteria 2043
70 Ga0450908_001167 3300042184 Bacteria 5088
71 Ga0466969_0004210 3300044656 Bacteria 7636
72 Ga0466972_0021680 3300044658 Bacteria 3202
73 Ga0466972_0042101 3300044658 Bacteria 2222
74 Ga0466972_0070001 3300044658 Bacteria 1674
75 Ga0466965_0005888 3300044683 Bacteria 5536
76 Ga0466966_0002354 3300044684 Bacteria 12342
77 Ga0466966_0090343 3300044684 Bacteria 1902
78 Ga0466961_0020393 3300044693 Bacteria 4263
79 Ga0466961_0026061 3300044693 Bacteria 3759
80 Ga0466961_0076035 3300044693 Bacteria 2128
81 Ga0466961_0082482 3300044693 Bacteria 2034
82 Ga0466961_0127423 3300044693 Bacteria 1596
83 Ga0466961_0164917 3300044693 Bacteria 1380
84 Ga0466963_0001396 3300044694 Bacteria 12945
85 Ga0466963_0001518 3300044694 Bacteria 12562
86 Ga0466963_0030296 3300044694 Bacteria 3490
87 Ga0466963_0154453 3300044694 Bacteria 1595
88 Ga0466971_0000283 3300044719 Bacteria 19461
89 Ga0466971_0003895 3300044719 Bacteria 6397
90 Ga0466971_0024017 3300044719 Bacteria 2718
91 Ga0466970_0001782 3300044765 Bacteria 10376
92 Ga0466970_0012321 3300044765 Bacteria 4370
93 Ga0466970_0036874 3300044765 Bacteria 2591
94 Ga0466970_0064451 3300044765 Bacteria 1965
95 Ga0466957_0000803 3300044842 Bacteria 16018
96 Ga0466957_0007523 3300044842 Bacteria 6154
97 Ga0466957_0031120 3300044842 Bacteria 3188
98 Ga0466957_0034057 3300044842 Bacteria 3056
99 Ga0466960_0005875 3300044901 Bacteria 4892
100 Ga0466959_0000203 3300045049 Bacteria 38577
101 Ga0466959_0006096 3300045049 Bacteria 8324
102 Ga0466959_0022569 3300045049 Bacteria 4653
103 Ga0466958_0026307 3300045836 Bacteria 3438
104 Ga0466967_0017971 3300045976 Bacteria 5636
105 Ga0466967_0045185 3300045976 Bacteria 3825
106 Ga0466967_0148429 3300045976 Bacteria 2189
107 Ga0495617_010116 3300046452 Bacteria 3231
108 Ga0495627_013103 3300046453 Bacteria 2925
109 Ga0495603_0010488 3300046455 Bacteria 5614
110 Ga0495603_0045764 3300046455 Bacteria 2608
111 Ga0495629_0005470 3300046459 Bacteria 9477
112 Ga0495629_0012144 3300046459 Bacteria 6242
113 Ga0495629_0156126 3300046459 Bacteria 1585
114 Ga0495629_0186283 3300046459 Bacteria 1437
115 Ga0495638_0025474 3300046460 Bacteria 3845
116 Ga0495638_0068700 3300046460 Bacteria 2172
117 Ga0495651_0002812 3300046462 Bacteria 13493
118 Ga0495651_0003003 3300046462 Bacteria 13020
119 Ga0495651_0004966 3300046462 Bacteria 10161
120 Ga0495653_0013344 3300046463 Bacteria 6696
121 Ga0495582_0092693 3300046473 Bacteria 1686
122 Ga0495605_0023668 3300046474 Bacteria 3226
123 Ga0495639_0014305 3300046475 Bacteria 3435
124 Ga0495662_0000430 3300046476 Bacteria 18783
125 Ga0495662_0074356 3300046476 Bacteria 1648
126 Ga0495662_0077280 3300046476 Bacteria 1617
127 Ga0495664_0021126 3300046477 Bacteria 3760
128 Ga0495664_0114596 3300046477 Bacteria 1628
129 Ga0495594_0026119 3300046499 Bacteria 3140
130 Ga0495607_0020437 3300046501 Bacteria 4186
131 Ga0495606_0022550 3300046507 Bacteria 4583
132 Ga0495616_0009752 3300046513 Bacteria 5594
133 Ga0495618_0013860 3300046514 Bacteria 4904
134 Ga0495618_0118080 3300046514 Bacteria 1698
135 Ga0495620_0055268 3300046515 Bacteria 1673
136 Ga0495620_0056388 3300046515 Bacteria 1652
137 Ga0495628_0007995 3300046516 Bacteria 9113
138 Ga0495628_0048600 3300046516 Bacteria 3362
139 Ga0495628_0177330 3300046516 Bacteria 1613
140 Ga0495628_0224022 3300046516 Bacteria 1411
141 Ga0495630_0062419 3300046517 Bacteria 2799
142 Ga0495630_0177500 3300046517 Bacteria 1624
143 Ga0495631_0002917 3300046518 Bacteria 9477
144 Ga0495643_0007669 3300046522 Bacteria 6921
145 Ga0495648_0057729 3300046524 Bacteria 2325
146 Ga0495666_0008689 3300046526 Bacteria 5090
147 Ga0495666_0017805 3300046526 Bacteria 3538
148 Ga0495652_0003944 3300046529 Bacteria 14397
149 Ga0495652_0019325 3300046529 Bacteria 6069
150 Ga0495652_0037742 3300046529 Bacteria 4189
151 Ga0495665_0021529 3300046531 Bacteria 3464
152 Ga0495640_0013172 3300046533 Bacteria 6292
153 Ga0495640_0014999 3300046533 Bacteria 5841
154 Ga0495640_0162261 3300046533 Bacteria 1431
155 Ga0495587_0000705 3300046536 Bacteria 22341
156 Ga0495609_0007563 3300046538 Bacteria 5401
157 Ga0495597_0055642 3300046542 Bacteria 1734
158 Ga0495645_0018894 3300046543 Bacteria 4958
159 Ga0495645_0082761 3300046543 Bacteria 2301
160 Ga0495622_0007653 3300046557 Bacteria 5018
161 Ga0495622_0007948 3300046557 Bacteria 4916
162 Ga0495633_0013443 3300046558 Bacteria 4314
163 Ga0495667_0004948 3300046559 Bacteria 9008
164 Ga0495656_0096197 3300046615 Bacteria 1362
165 Ga0495668_0033849 3300046616 Bacteria 2869
166 Ga0495634_0003248 3300046642 Bacteria 13133
167 Ga0495635_0001134 3300046663 Bacteria 17766
168 Ga0495635_0009804 3300046663 Bacteria 6696
169 Ga0495635_0038858 3300046663 Bacteria 3294
170 Ga0495635_0063794 3300046663 Bacteria 2529
171 Ga0495661_0044823 3300046665 Bacteria 2708
172 Ga0495588_0002126 3300046674 Bacteria 8495
173 Ga0495657_0000512 3300046675 Bacteria 36227
174 Ga0495657_0159669 3300046675 Bacteria 1395
175 Ga0495623_0111945 3300046679 Bacteria 1653
176 Ga0495646_0006630 3300046680 Bacteria 7342
177 Ga0495658_0004545 3300046683 Bacteria 6820
178 Ga0495613_0001952 3300046689 Bacteria 15657
179 Ga0495613_0034636 3300046689 Bacteria 3749
180 Ga0495613_0146109 3300046689 Bacteria 1687
181 Ga0495613_0213219 3300046689 Bacteria 1357
182 Ga0495671_0017815 3300046692 Bacteria 3778
183 Ga0495649_0095747 3300046694 Bacteria 1580
184 Ga0495589_0041625 3300046794 Bacteria 2291
185 Ga0495600_0030705 3300046809 Bacteria 3480
186 Ga0495581_0002932 3300047315 Bacteria 9757
187 Ga0495581_0014770 3300047315 Bacteria 4530
188 Ga0495581_0020297 3300047315 Bacteria 3857
189 Ga0495604_0002643 3300047317 Bacteria 14381
190 Ga0495604_0026280 3300047317 Bacteria 4635
191 Ga0495636_0002071 3300047318 Bacteria 7700
192 Ga0495636_0004709 3300047318 Bacteria 5351
193 Ga0495636_0055053 3300047318 Bacteria 1672
194 Ga0495674_0005029 3300047319 Bacteria 12713
195 Ga0495674_0287185 3300047319 Bacteria 1346
196 Ga0495676_0152975 3300047321 Bacteria 1639
197 Ga0495680_0225920 3300047322 Bacteria 1334
198 Ga0495687_000755 3300047443 Bacteria 34995
199 Ga0495687_000823 3300047443 Bacteria 33188
200 Ga0495675_0002533 3300047444 Bacteria 10936
201 Ga0495675_0040379 3300047444 Bacteria 2973
202 Ga0495675_0078739 3300047444 Bacteria 2075
203 Ga0495675_0106386 3300047444 Bacteria 1753
204 Ga0495685_013207 3300047447 Bacteria 2802
205 Ga0495685_023126 3300047447 Bacteria 2139
206 Ga0495681_0000720 3300047470 Bacteria 25364
207 Ga0495681_0011306 3300047470 Bacteria 5325
208 Ga0495686_0014323 3300047472 Bacteria 5461
209 Ga0495686_0114370 3300047472 Bacteria 1615
210 Ga0495593_0003223 3300047673 Bacteria 9787
211 Ga0495602_0012458 3300048088 Bacteria 8740
212 Ga0495602_0065427 3300048088 Bacteria 3137
213 Ga0495602_0235100 3300048088 Bacteria 1374
214 Ga0495614_0010492 3300048089 Bacteria 4085
215 Ga0495614_0010621 3300048089 Bacteria 4059
216 Ga0495614_0035942 3300048089 Bacteria 2127
217 Ga0496109_0021612 3300048912 Bacteria 5693
218 Ga0501031_0098134 3300049568 Bacteria 1912
219 Ga0501031_0111743 3300049568 Bacteria 1784
220 Ga0501033_0003216 3300049570 Bacteria 13525
221 Ga0501033_0007451 3300049570 Bacteria 8523
222 Ga0501034_0010405 3300049571 Bacteria 9694
223 Ga0501034_0021289 3300049571 Bacteria 6611
224 Ga0501036_0004123 3300049572 Bacteria 11692
225 Ga0501036_0076567 3300049572 Bacteria 2830
226 Ga0501036_0204254 3300049572 Bacteria 1661
227 Ga0501037_0012468 3300049573 Bacteria 6262
228 Ga0501037_0203460 3300049573 Bacteria 1398
229 Ga0501038_0006498 3300049574 Bacteria 10820
230 Ga0501038_0015084 3300049574 Bacteria 7034
231 Ga0501038_0253748 3300049574 Bacteria 1392
232 Ga0501039_0026250 3300049575 Bacteria 4477
233 Ga0501043_0006231 3300049579 Bacteria 9579
234 Ga0501043_0007166 3300049579 Bacteria 8862
235 Ga0501046_0005141 3300049580 Bacteria 11727
236 Ga0501046_0172631 3300049580 Bacteria 1621
237 Ga0501047_0221515 3300049581 Bacteria 1748
238 Ga0501048_0003099 3300049582 Bacteria 12685
239 Ga0501070_0045281 3300049586 Bacteria 3659
240 Ga0501074_0075821 3300049590 Bacteria 2414
241 Ga0501035_0004326 3300049822 Bacteria 13481
242 Ga0501035_0013802 3300049822 Bacteria 7457
243 Ga0501035_0073237 3300049822 Bacteria 3031
244 Ga0501035_0173151 3300049822 Bacteria 1864
245 Ga0501035_0193180 3300049822 Bacteria 1749
246 Ga0501044_0068577 3300049823 Bacteria 3612
247 Ga0501044_0199747 3300049823 Bacteria 1958
248 Ga0501044_0208521 3300049823 Bacteria 1909
249 Ga0501044_0243748 3300049823 Bacteria 1740
250 Ga0501044_0303181 3300049823 Bacteria 1526
251 Ga0501045_0100879 3300049824 Bacteria 2136
252 nmdc:mga03n38_77996_c1 3300050490 Bacteria 1549
253 nmdc:mga06z11_24450_c1 3300050494 Bacteria 2850
254 Ga0495601_0007591 3300053077 Bacteria 6368
255 Ga0495612_0013699 3300053078 Bacteria 3266
256 Ga0495595_0060858 3300053084 Bacteria 1768
257 Ga0495619_0023100 3300053085 Bacteria 3984
258 Ga0500643_000484 3300053087 Bacteria 28983
259 Ga0500644_0011563 3300053088 Bacteria 2415
260 Ga0500640_043138 3300053095 Bacteria 1980
261 Ga0500560_013218 3300053107 Bacteria 2163
262 Ga0500573_0025632 3300053140 Bacteria 3391
263 Ga0500600_0059315 3300053149 Bacteria 2140
264 Ga0500633_0026343 3300053160 Bacteria 1830
265 Ga0500634_0106366 3300053161 Bacteria 1394
266 Ga0466962_0004734 3300061719 Bacteria 6542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100015310 Ga0070659_1000153103 343
2 3300025932 Ga0207690_10003570 Ga0207690_100035706 344
3 iso_pu_bacteria 2862281513 2862283999 352
4 iso_pu_bacteria 2547132111 2547407449 354
5 iso_pu_bacteria 2643221714 2644626652 354
6 iso_pu_bacteria 2946072368 2946078342 354
7 iso_pu_bacteria 2582581314 2585317508 355
8 3300006178 Ga0075367_10044538 Ga0075367_100445382 356
9 3300015688 Ga0183367_1001 Ga0183367_1001184 356
10 3300042138 Ga0450903_007818 Ga0450903_007818_174_1322 356
11 3300050490 nmdc:mga03n38_77996_c1 nmdc:mga03n38_77996_c1_104_1252 356
12 3300031507 Ga0307509_10097008 Ga0307509_100970082 357
13 3300031649 Ga0307514_10001356 Ga0307514_1000135611 357
14 3300031730 Ga0307516_10006318 Ga0307516_100063188 357
15 3300033180 Ga0307510_10077668 Ga0307510_100776683 357
16 3300047443 Ga0495687_000755 Ga0495687_000755_3483_4760 357
17 iso_pu_bacteria 2818991472 2819740188 357
18 3300044694 Ga0466963_0154453 Ga0466963_0154453_143_1297 358
19 3300046516 Ga0495628_0224022 Ga0495628_0224022_50_1204 358
20 iso_pu_bacteria 2862382967 2862391751 358
21 3300028794 Ga0307515_10000279 Ga0307515_100002793 359
22 3300030522 Ga0307512_10041511 Ga0307512_100415113 359
23 3300033179 Ga0307507_10066979 Ga0307507_100669791 359
24 3300046476 Ga0495662_0077280 Ga0495662_0077280_23_1180 359
25 3300046679 Ga0495623_0111945 Ga0495623_0111945_282_1439 359
26 3300046689 Ga0495613_0213219 Ga0495613_0213219_17_1174 359
27 3300047317 Ga0495604_0026280 Ga0495604_0026280_233_1390 359
28 3300047444 Ga0495675_0002533 Ga0495675_0002533_9718_10875 359
29 3300049823 Ga0501044_0243748 Ga0501044_0243748_441_1598 359
30 3300046694 Ga0495649_0095747 Ga0495649_0095747_153_1352 360
31 3300049581 Ga0501047_0221515 Ga0501047_0221515_382_1563 360
32 3300046517 Ga0495630_0177500 Ga0495630_0177500_283_1446 361
33 3300053087 Ga0500643_000484 Ga0500643_000484_8149_9465 361
34 3300037466 Ga0395898_0017605 Ga0395898_0017605_327_1532 362
35 3300049570 Ga0501033_0007451 Ga0501033_0007451_2161_3348 362
36 3300049571 Ga0501034_0010405 Ga0501034_0010405_4757_5944 362
37 3300049572 Ga0501036_0004123 Ga0501036_0004123_6755_7942 362
38 3300049574 Ga0501038_0253748 Ga0501038_0253748_66_1253 362
39 3300049575 Ga0501039_0026250 Ga0501039_0026250_49_1236 362
40 3300049579 Ga0501043_0006231 Ga0501043_0006231_4472_5659 362
41 3300049586 Ga0501070_0045281 Ga0501070_0045281_895_2082 362
42 3300049590 Ga0501074_0075821 Ga0501074_0075821_903_2090 362
43 3300049822 Ga0501035_0004326 Ga0501035_0004326_4408_5595 362
44 iso_pu_bacteria 2582581313 2585307344 362
45 iso_pu_bacteria 2877676314 2877678428 362
46 3300005334 Ga0068869_100168169 Ga0068869_1001681692 363
47 3300013105 Ga0157369_10001215 Ga0157369_1000121522 363
48 3300044658 Ga0466972_0021680 Ga0466972_0021680_306_1511 363
49 3300044765 Ga0466970_0012321 Ga0466970_0012321_253_1458 363
50 3300044842 Ga0466957_0007523 Ga0466957_0007523_3071_4276 363
51 3300044901 Ga0466960_0005875 Ga0466960_0005875_2571_3776 363
52 3300045836 Ga0466958_0026307 Ga0466958_0026307_508_1713 363
53 3300045976 Ga0466967_0045185 Ga0466967_0045185_1880_3085 363
54 3300053149 Ga0500600_0059315 Ga0500600_0059315_842_2038 363
55 3300013105 Ga0157369_10000757 Ga0157369_1000075735 364
56 iso_pu_bacteria 2784132148 2784591173 364
57 iso_pu_bacteria 3006493962 3006499609 364
58 iso_pu_bacteria 8023623736 8023624706 364
59 3300031616 Ga0307508_10011880 Ga0307508_100118806 365
60 3300046529 Ga0495652_0003944 Ga0495652_0003944_412_1587 365
61 iso_pu_bacteria 2947224130 2947226236 365
62 3300005336 Ga0070680_100178337 Ga0070680_1001783371 366
63 3300005366 Ga0070659_100014863 Ga0070659_1000148633 366
64 3300005530 Ga0070679_100136275 Ga0070679_1001362752 366
65 3300005563 Ga0068855_100171760 Ga0068855_1001717601 366
66 3300013307 Ga0157372_10121057 Ga0157372_101210572 366
67 3300025904 Ga0207647_10044359 Ga0207647_100443592 366
68 3300025917 Ga0207660_10187718 Ga0207660_101877181 366
69 3300025921 Ga0207652_10295541 Ga0207652_102955411 366
70 3300025932 Ga0207690_10000396 Ga0207690_1000039613 366
71 3300030522 Ga0307512_10001091 Ga0307512_1000109110 366
72 3300031616 Ga0307508_10018573 Ga0307508_100185732 366
73 3300049568 Ga0501031_0098134 Ga0501031_0098134_190_1368 366
74 3300049574 Ga0501038_0006498 Ga0501038_0006498_2653_3831 366
75 3300049822 Ga0501035_0193180 Ga0501035_0193180_478_1656 366
76 iso_pu_bacteria 2811994917 2812478028 366
77 3300047444 Ga0495675_0040379 Ga0495675_0040379_653_2065 367
78 iso_pu_bacteria 8048406513 8048411185 367
79 3300005327 Ga0070658_10242286 Ga0070658_102422861 368
80 3300005338 Ga0068868_100013000 Ga0068868_1000130004 368
81 3300026023 Ga0207677_10002978 Ga0207677_100029784 368
82 3300044694 Ga0466963_0001396 Ga0466963_0001396_204_1388 368
83 3300049568 Ga0501031_0111743 Ga0501031_0111743_400_1584 368
84 3300049571 Ga0501034_0021289 Ga0501034_0021289_3187_4371 368
85 3300049572 Ga0501036_0076567 Ga0501036_0076567_1431_2615 368
86 3300049572 Ga0501036_0204254 Ga0501036_0204254_325_1509 368
87 3300049573 Ga0501037_0012468 Ga0501037_0012468_195_1379 368
88 3300049573 Ga0501037_0203460 Ga0501037_0203460_93_1277 368
89 3300049574 Ga0501038_0015084 Ga0501038_0015084_4358_5542 368
90 3300049579 Ga0501043_0007166 Ga0501043_0007166_2719_3903 368
91 3300049580 Ga0501046_0005141 Ga0501046_0005141_6963_8147 368
92 3300049580 Ga0501046_0172631 Ga0501046_0172631_383_1567 368
93 3300049582 Ga0501048_0003099 Ga0501048_0003099_6256_7440 368
94 3300049822 Ga0501035_0013802 Ga0501035_0013802_4107_5291 368
95 3300049822 Ga0501035_0173151 Ga0501035_0173151_142_1326 368
96 3300049823 Ga0501044_0068577 Ga0501044_0068577_1482_2666 368
97 3300049823 Ga0501044_0208521 Ga0501044_0208521_567_1751 368
98 3300049823 Ga0501044_0303181 Ga0501044_0303181_134_1318 368
99 3300049824 Ga0501045_0100879 Ga0501045_0100879_38_1222 368
100 3300053084 Ga0495595_0060858 Ga0495595_0060858_392_1660 368
101 3300003322 rootL2_10003645 rootL2_100036456 369
102 3300003323 rootH1_10011215 rootH1_100112153 369
103 3300041404 Ga0439436_0000466 Ga0439436_0000466_2815_4002 369
104 3300041406 Ga0439439_0023361 Ga0439439_0023361_196_1383 369
105 3300041512 Ga0451853_0896922 Ga0451853_0896922_952_2139 369
106 3300042007 Ga0439449_0016212 Ga0439449_0016212_417_1604 369
107 3300044658 Ga0466972_0070001 Ga0466972_0070001_70_1257 369
108 3300044683 Ga0466965_0005888 Ga0466965_0005888_4078_5265 369
109 3300044684 Ga0466966_0002354 Ga0466966_0002354_10896_12083 369
110 3300044684 Ga0466966_0090343 Ga0466966_0090343_27_1307 369
111 3300044693 Ga0466961_0020393 Ga0466961_0020393_232_1419 369
112 3300044694 Ga0466963_0030296 Ga0466963_0030296_232_1419 369
113 3300044719 Ga0466971_0000283 Ga0466971_0000283_3849_5036 369
114 3300044765 Ga0466970_0001782 Ga0466970_0001782_8054_9241 369
115 3300044842 Ga0466957_0000803 Ga0466957_0000803_14572_15759 369
116 3300045049 Ga0466959_0022569 Ga0466959_0022569_3200_4387 369
117 3300045976 Ga0466967_0017971 Ga0466967_0017971_389_1576 369
118 3300046453 Ga0495627_013103 Ga0495627_013103_1048_2235 369
119 3300046455 Ga0495603_0010488 Ga0495603_0010488_4023_5210 369
120 3300046459 Ga0495629_0156126 Ga0495629_0156126_194_1381 369
121 3300046476 Ga0495662_0074356 Ga0495662_0074356_441_1628 369
122 3300046515 Ga0495620_0055268 Ga0495620_0055268_43_1230 369
123 3300046615 Ga0495656_0096197 Ga0495656_0096197_141_1328 369
124 3300046674 Ga0495588_0002126 Ga0495588_0002126_969_2156 369
125 3300046675 Ga0495657_0159669 Ga0495657_0159669_125_1312 369
126 3300046689 Ga0495613_0146109 Ga0495613_0146109_417_1604 369
127 3300047318 Ga0495636_0004709 Ga0495636_0004709_2334_3521 369
128 3300047321 Ga0495676_0152975 Ga0495676_0152975_51_1238 369
129 3300048912 Ga0496109_0021612 Ga0496109_0021612_485_1672 369
130 3300049823 Ga0501044_0199747 Ga0501044_0199747_157_1344 369
131 3300005327 Ga0070658_10267530 Ga0070658_102675301 370
132 3300047444 Ga0495675_0106386 Ga0495675_0106386_552_1742 370
133 3300005327 Ga0070658_10046242 Ga0070658_100462425 371
134 3300009098 Ga0105245_10154412 Ga0105245_101544122 371
135 3300013105 Ga0157369_10023400 Ga0157369_100234004 371
136 3300041404 Ga0439436_0006097 Ga0439436_0006097_2116_3309 371
137 3300041406 Ga0439439_0003766 Ga0439439_0003766_1468_2661 371
138 3300041999 Ga0439433_0023329 Ga0439433_0023329_66_1259 371
139 3300042014 Ga0439457_013632 Ga0439457_013632_160_1353 371
140 3300042131 Ga0450894_000646 Ga0450894_000646_1303_2496 371
141 3300042134 Ga0450898_010118 Ga0450898_010118_129_1322 371
142 3300042135 Ga0450899_000861 Ga0450899_000861_1158_2351 371
143 3300042184 Ga0450908_001167 Ga0450908_001167_406_1599 371
144 3300042157 Ga0439458_0010742 Ga0439458_0010742_714_1994 373
145 3300044693 Ga0466961_0082482 Ga0466961_0082482_222_1484 373
146 3300006028 Ga0070717_10091716 Ga0070717_100917162 374
147 3300044658 Ga0466972_0042101 Ga0466972_0042101_167_1372 375
148 3300049570 Ga0501033_0003216 Ga0501033_0003216_4338_5543 375
149 3300049822 Ga0501035_0073237 Ga0501035_0073237_1735_2940 375
150 3300044693 Ga0466961_0164917 Ga0466961_0164917_25_1239 378
151 iso_pu_bacteria 2784746768 2785372213 378
152 iso_pu_bacteria 2786546132 2786673293 378
153 iso_pu_bacteria 2954380949 2954383375 378
154 iso_pu_bacteria 2954673503 2954679596 378
155 iso_pu_bacteria 2954701450 2954709193 378
156 iso_pu_bacteria 2954711539 2954713693 378
157 iso_pu_bacteria 2954721474 2954723656 378
158 iso_pu_bacteria 2954731030 2954738176 378
159 iso_pu_bacteria 2954740390 2954742559 378
160 iso_pu_bacteria 2954749733 2954757036 378
161 iso_pu_bacteria 2954759201 2954761523 378
162 3300031456 Ga0307513_10189349 Ga0307513_101893492 379
163 3300041512 Ga0451853_1871461 Ga0451853_1871461_2482_3717 379
164 3300044719 Ga0466971_0024017 Ga0466971_0024017_1352_2605 379
165 3300044765 Ga0466970_0036874 Ga0466970_0036874_299_1552 379
166 3300044842 Ga0466957_0034057 Ga0466957_0034057_186_1439 379
167 3300047472 Ga0495686_0114370 Ga0495686_0114370_233_1513 379
168 3300050494 nmdc:mga06z11_24450_c1 nmdc:mga06z11_24450_c1_1230_2510 379
169 iso_pu_bacteria 8025524527 8025529257 379
170 3300005329 Ga0070683_100053254 Ga0070683_1000532544 380
171 3300005339 Ga0070660_100058075 Ga0070660_1000580753 380
172 3300005535 Ga0070684_100016930 Ga0070684_1000169304 380
173 3300025944 Ga0207661_10012364 Ga0207661_100123646 380
174 3300044693 Ga0466961_0127423 Ga0466961_0127423_55_1335 380
175 3300044765 Ga0466970_0064451 Ga0466970_0064451_57_1337 380
176 iso_pu_bacteria 2616644814 2616699152 380
177 iso_pu_bacteria 2767802112 2768646262 380
178 iso_pu_bacteria 2862290372 2862293417 380
179 iso_pu_bacteria 2912715099 2912716929 380
180 iso_pu_bacteria 8008574985 8008576527 380
181 3300005336 Ga0070680_100002194 Ga0070680_10000219411 381
182 3300005458 Ga0070681_10000253 Ga0070681_100002535 381
183 3300005530 Ga0070679_100000006 Ga0070679_10000000632 381
184 3300006048 Ga0075363_100054013 Ga0075363_1000540132 381
185 3300025912 Ga0207707_10000646 Ga0207707_1000064628 381
186 3300025917 Ga0207660_10000174 Ga0207660_1000017442 381
187 3300025921 Ga0207652_10000012 Ga0207652_10000012157 381
188 3300025944 Ga0207661_10033816 Ga0207661_100338162 381
189 3300044694 Ga0466963_0001518 Ga0466963_0001518_7143_8414 381
190 3300045976 Ga0466967_0148429 Ga0466967_0148429_121_1392 381
191 iso_pu_bacteria 2811994879 2812355284 381
192 iso_pu_bacteria 2946064051 2946070608 381
193 iso_pu_bacteria 8025413630 8025419109 382
194 3300033180 Ga0307510_10118348 Ga0307510_101183482 383
195 3300047318 Ga0495636_0002071 Ga0495636_0002071_25_1299 383
196 3300047443 Ga0495687_000823 Ga0495687_000823_16276_17550 383
197 3300047447 Ga0495685_023126 Ga0495685_023126_82_1356 383
198 iso_pu_bacteria 2784746763 2785340545 383
199 iso_pu_bacteria 2808606375 2808914233 383
200 3300006038 Ga0075365_10129354 Ga0075365_101293541 384
201 3300031649 Ga0307514_10188216 Ga0307514_101882161 384
202 3300033179 Ga0307507_10035360 Ga0307507_100353604 384
203 3300044693 Ga0466961_0026061 Ga0466961_0026061_299_1555 384
204 3300044842 Ga0466957_0031120 Ga0466957_0031120_1857_3128 384
205 3300046452 Ga0495617_010116 Ga0495617_010116_783_2060 384
206 3300046455 Ga0495603_0045764 Ga0495603_0045764_541_1818 384
207 3300046459 Ga0495629_0005470 Ga0495629_0005470_7826_9103 384
208 3300046459 Ga0495629_0012144 Ga0495629_0012144_1110_2387 384
209 3300046459 Ga0495629_0186283 Ga0495629_0186283_31_1308 384
210 3300046460 Ga0495638_0025474 Ga0495638_0025474_1002_2279 384
211 3300046460 Ga0495638_0068700 Ga0495638_0068700_557_1834 384
212 3300046462 Ga0495651_0002812 Ga0495651_0002812_1221_2555 384
213 3300046462 Ga0495651_0003003 Ga0495651_0003003_8085_9362 384
214 3300046462 Ga0495651_0004966 Ga0495651_0004966_3123_4394 384
215 3300046463 Ga0495653_0013344 Ga0495653_0013344_3544_4878 384
216 3300046473 Ga0495582_0092693 Ga0495582_0092693_360_1637 384
217 3300046474 Ga0495605_0023668 Ga0495605_0023668_48_1325 384
218 3300046475 Ga0495639_0014305 Ga0495639_0014305_42_1319 384
219 3300046476 Ga0495662_0000430 Ga0495662_0000430_9769_11103 384
220 3300046477 Ga0495664_0021126 Ga0495664_0021126_1492_2769 384
221 3300046477 Ga0495664_0114596 Ga0495664_0114596_222_1556 384
222 3300046499 Ga0495594_0026119 Ga0495594_0026119_1808_3085 384
223 3300046501 Ga0495607_0020437 Ga0495607_0020437_1284_2561 384
224 3300046507 Ga0495606_0022550 Ga0495606_0022550_738_2015 384
225 3300046513 Ga0495616_0009752 Ga0495616_0009752_2034_3311 384
226 3300046514 Ga0495618_0013860 Ga0495618_0013860_2871_4148 384
227 3300046514 Ga0495618_0118080 Ga0495618_0118080_211_1488 384
228 3300046515 Ga0495620_0056388 Ga0495620_0056388_15_1292 384
229 3300046516 Ga0495628_0007995 Ga0495628_0007995_1640_2974 384
230 3300046516 Ga0495628_0048600 Ga0495628_0048600_832_2109 384
231 3300046516 Ga0495628_0177330 Ga0495628_0177330_344_1576 384
232 3300046517 Ga0495630_0062419 Ga0495630_0062419_247_1524 384
233 3300046518 Ga0495631_0002917 Ga0495631_0002917_8187_9464 384
234 3300046522 Ga0495643_0007669 Ga0495643_0007669_1696_2973 384
235 3300046524 Ga0495648_0057729 Ga0495648_0057729_395_1672 384
236 3300046526 Ga0495666_0008689 Ga0495666_0008689_226_1560 384
237 3300046526 Ga0495666_0017805 Ga0495666_0017805_233_1510 384
238 3300046529 Ga0495652_0019325 Ga0495652_0019325_701_1978 384
239 3300046529 Ga0495652_0037742 Ga0495652_0037742_1635_2969 384
240 3300046531 Ga0495665_0021529 Ga0495665_0021529_2031_3365 384
241 3300046533 Ga0495640_0013172 Ga0495640_0013172_3268_4602 384
242 3300046533 Ga0495640_0014999 Ga0495640_0014999_3757_5034 384
243 3300046533 Ga0495640_0162261 Ga0495640_0162261_84_1361 384
244 3300046536 Ga0495587_0000705 Ga0495587_0000705_13446_14723 384
245 3300046538 Ga0495609_0007563 Ga0495609_0007563_1177_2454 384
246 3300046542 Ga0495597_0055642 Ga0495597_0055642_259_1536 384
247 3300046543 Ga0495645_0018894 Ga0495645_0018894_2866_4143 384
248 3300046543 Ga0495645_0082761 Ga0495645_0082761_196_1467 384
249 3300046557 Ga0495622_0007653 Ga0495622_0007653_113_1390 384
250 3300046557 Ga0495622_0007948 Ga0495622_0007948_125_1402 384
251 3300046558 Ga0495633_0013443 Ga0495633_0013443_3015_4292 384
252 3300046559 Ga0495667_0004948 Ga0495667_0004948_5856_7190 384
253 3300046616 Ga0495668_0033849 Ga0495668_0033849_94_1371 384
254 3300046642 Ga0495634_0003248 Ga0495634_0003248_10369_11646 384
255 3300046663 Ga0495635_0001134 Ga0495635_0001134_16053_17330 384
256 3300046663 Ga0495635_0009804 Ga0495635_0009804_5112_6383 384
257 3300046663 Ga0495635_0038858 Ga0495635_0038858_193_1527 384
258 3300046663 Ga0495635_0063794 Ga0495635_0063794_254_1531 384
259 3300046665 Ga0495661_0044823 Ga0495661_0044823_646_1923 384
260 3300046675 Ga0495657_0000512 Ga0495657_0000512_3198_4475 384
261 3300046680 Ga0495646_0006630 Ga0495646_0006630_1220_2497 384
262 3300046683 Ga0495658_0004545 Ga0495658_0004545_3928_5205 384
263 3300046689 Ga0495613_0001952 Ga0495613_0001952_3795_5072 384
264 3300046689 Ga0495613_0034636 Ga0495613_0034636_725_2059 384
265 3300046692 Ga0495671_0017815 Ga0495671_0017815_848_2125 384
266 3300046794 Ga0495589_0041625 Ga0495589_0041625_655_1932 384
267 3300046809 Ga0495600_0030705 Ga0495600_0030705_73_1407 384
268 3300047315 Ga0495581_0002932 Ga0495581_0002932_2636_3913 384
269 3300047315 Ga0495581_0014770 Ga0495581_0014770_1435_2769 384
270 3300047315 Ga0495581_0020297 Ga0495581_0020297_249_1526 384
271 3300047317 Ga0495604_0002643 Ga0495604_0002643_11640_12974 384
272 3300047318 Ga0495636_0055053 Ga0495636_0055053_62_1339 384
273 3300047319 Ga0495674_0005029 Ga0495674_0005029_5222_6556 384
274 3300047319 Ga0495674_0287185 Ga0495674_0287185_26_1303 384
275 3300047322 Ga0495680_0225920 Ga0495680_0225920_17_1294 384
276 3300047444 Ga0495675_0078739 Ga0495675_0078739_38_1372 384
277 3300047447 Ga0495685_013207 Ga0495685_013207_1342_2619 384
278 3300047470 Ga0495681_0000720 Ga0495681_0000720_2846_4123 384
279 3300047470 Ga0495681_0011306 Ga0495681_0011306_1338_2615 384
280 3300047472 Ga0495686_0014323 Ga0495686_0014323_2840_4117 384
281 3300047673 Ga0495593_0003223 Ga0495593_0003223_5275_6552 384
282 3300048088 Ga0495602_0012458 Ga0495602_0012458_53_1330 384
283 3300048088 Ga0495602_0065427 Ga0495602_0065427_36_1370 384
284 3300048088 Ga0495602_0235100 Ga0495602_0235100_39_1316 384
285 3300048089 Ga0495614_0010492 Ga0495614_0010492_375_1652 384
286 3300048089 Ga0495614_0010621 Ga0495614_0010621_373_1650 384
287 3300048089 Ga0495614_0035942 Ga0495614_0035942_67_1344 384
288 3300053077 Ga0495601_0007591 Ga0495601_0007591_2910_4244 384
289 3300053078 Ga0495612_0013699 Ga0495612_0013699_293_1564 384
290 3300053085 Ga0495619_0023100 Ga0495619_0023100_413_1747 384
291 3300053088 Ga0500644_0011563 Ga0500644_0011563_720_1997 384
292 3300053095 Ga0500640_043138 Ga0500640_043138_77_1354 384
293 3300053107 Ga0500560_013218 Ga0500560_013218_373_1650 384
294 3300053140 Ga0500573_0025632 Ga0500573_0025632_2053_3330 384
295 3300053160 Ga0500633_0026343 Ga0500633_0026343_395_1672 384
296 3300053161 Ga0500634_0106366 Ga0500634_0106366_23_1300 384
297 iso_pu_bacteria 2862507626 2862514049 384
298 iso_pu_bacteria 2867369537 2867374451 384
299 iso_pu_bacteria 2990059506 2990067196 384
300 iso_pu_bacteria 8008558824 8008563587 384
301 iso_pu_bacteria 2643221601 2644016632 387
302 iso_pu_bacteria 2643221631 2644174972 387
303 iso_pu_bacteria 2995463766 2995464829 387
304 3300044719 Ga0466971_0003895 Ga0466971_0003895_3726_5000 388
305 3300061719 Ga0466962_0004734 Ga0466962_0004734_4861_6135 388
306 3300003320 rootH2_10005752 rootH2_100057523 389
307 3300044656 Ga0466969_0004210 Ga0466969_0004210_3960_5255 389
308 3300044693 Ga0466961_0076035 Ga0466961_0076035_498_1793 389
309 3300045049 Ga0466959_0000203 Ga0466959_0000203_16054_17325 389
310 3300045049 Ga0466959_0006096 Ga0466959_0006096_2321_3616 389

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18305

DNA_pol_A_exoN

3' to 5' exonuclease C-terminal domain

309

395

0.99

PF00570

HRDC

HRDC domain

222

289

0.96

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

29

194

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mpr-assembly1.cif.gz_A brucella melitensis nrnc 0.87 48 208
5zo3-assembly1.cif.gz_A apo form of the nuclease 0.8697 42 208
7mpr-assembly2.cif.gz_B brucella melitensis nrnc 0.8596 48 208
7mpm-assembly1.cif.gz_A bartonella henselae nrnc bound to paa 0.8585 48 208
7mqe-assembly1.cif.gz_K bartonella henselae nrnc complexed with pagg. c1 reconstruction. 0.8521 47 208
ID Description Score Start End Superfamily
3cymA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9328 15 217 3.30.420.10
af_I6XF17_15_224_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.93 13 211 3.30.420.10
af_I6XF17_332_429_1.10.150.80 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;HRDC domain 0.926 294 382 1.10.150.80
3cymA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9112 15 217 3.30.420.10
3cymA03 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;HRDC domain 0.8888 294 383 1.10.150.80
ID Description Score Start End GO Terms
AF-A0A7K2N1A3-F1-model_v4 Ribonuclease D 0.9971 295 381
AF-A0A3M2IRL1-F1-model_v4 Ribonuclease D 0.978 295 383
AF-A0A132NJZ5-F1-model_v4 3'-5' exonuclease 0.9742 295 381 GO:0004527
AF-A0A7K2NYG6-F1-model_v4 Ribonuclease D 0.9681 18 215 GO:0003676
GO:0006139
GO:0008408
AF-A0A7K2NYG6-F1-model_v4 Ribonuclease D 0.9633 18 215 GO:0003676
GO:0006139
GO:0008408

Feature Viewer

pLDDT pTM Quality
83.73 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map