F396765

General Info

Members Datasets Scaffolds Average Seq Length
302 170 301 288

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221699|2644549759
Length 357
Sequence AVQIIARGPRAIAEAAAASLDSDPLLEGATYSILEEDEDKGIWRIDEVVRQFQNAVALVGQFQLGRGTQHACAAPSSAREAAXIAEAAAASLDSDPLLEGATYSILEEDEDKGIWRIDAFPNDADDARGIEARLKAQDGLTVVVEKLADADWLAMSLSGLPPVRAGRFFVYGAHDQGIVPKNTVNLKIDAGAAFGTGHHGTTVGCLMAFDELLKKERFDRVLDVGCGTGVLAIAAAKTGSKVAVGTDIDQPSVRIANENAKLNQANARFVHAFGLNDRKVRGQGPYDLVFANILAPPLVSLSQEIKEALSLGGVAILSGLLRTQERRVSAAYLSRGFILERRIHRDAWSALVLRRVG

Samples

Sample ID Description Type Environment
1 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
140 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
141 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
142 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
143 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
146 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
147 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
148 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
149 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
150 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
151 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
152 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
153 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
154 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
155 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
158 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
159 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
164 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
165 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
168 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
169 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.18
Nodule 0
Rhizoplane 2.32
Rhizosphere 68.54
Stem 0
Stem Tuber 0
Unclassified 5.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000874 3300003781 Bacteria 19576
2 Ga0055536_1001296 3300003781 Bacteria 15386
3 Ga0055531_10001593 3300003794 Bacteria 16497
4 Ga0055531_10006218 3300003794 Bacteria 6819
5 Ga0068869_100140882 3300005334 Bacteria 1862
6 Ga0070666_10156372 3300005335 Bacteria 1592
7 Ga0070660_100070956 3300005339 Bacteria 2719
8 Ga0070691_10000799 3300005341 Bacteria 12562
9 Ga0070668_100000138 3300005347 Bacteria 45978
10 Ga0070668_100002433 3300005347 Bacteria 13697
11 Ga0070668_100029830 3300005347 Bacteria 4144
12 Ga0070668_100038577 3300005347 Bacteria 3651
13 Ga0070668_100301050 3300005347 Bacteria 1345
14 Ga0070669_100011412 3300005353 Bacteria 6308
15 Ga0070671_100021051 3300005355 Bacteria 5324
16 Ga0070659_100000136 3300005366 Bacteria 56558
17 Ga0070659_100025758 3300005366 Bacteria 4523
18 Ga0070667_100002308 3300005367 Bacteria 16747
19 Ga0070667_100011928 3300005367 Bacteria 7190
20 Ga0070667_100024775 3300005367 Bacteria 4985
21 Ga0070667_100291336 3300005367 Bacteria 1468
22 Ga0070667_100531953 3300005367 Bacteria 1079
23 Ga0070679_100247899 3300005530 Bacteria 1738
24 Ga0070665_100000015 3300005548 Bacteria 462744
25 Ga0070665_100000915 3300005548 Bacteria 37838
26 Ga0070665_100004050 3300005548 Bacteria 15410
27 Ga0070665_100069000 3300005548 Bacteria 3543
28 Ga0070665_100155590 3300005548 Bacteria 2288
29 Ga0068855_100016681 3300005563 Bacteria 8832
30 Ga0068854_100167002 3300005578 Bacteria 1709
31 Ga0068859_100000075 3300005617 Bacteria 91974
32 Ga0068864_100000137 3300005618 Bacteria 70702
33 Ga0068864_100000246 3300005618 Bacteria 48529
34 Ga0068864_100283947 3300005618 Bacteria 1546
35 Ga0068864_100406324 3300005618 Bacteria 1295
36 Ga0068863_100000137 3300005841 Bacteria 77716
37 Ga0068863_100000165 3300005841 Bacteria 71079
38 Ga0068863_100002612 3300005841 Bacteria 17858
39 Ga0068863_100054925 3300005841 Bacteria 3773
40 Ga0068858_100000625 3300005842 Bacteria 36835
41 Ga0068858_100002500 3300005842 Bacteria 18548
42 Ga0068858_100192106 3300005842 Bacteria 1929
43 Ga0068860_100000051 3300005843 Bacteria 208179
44 Ga0068860_100000309 3300005843 Bacteria 67252
45 Ga0068860_100004107 3300005843 Bacteria 14910
46 Ga0068860_100017633 3300005843 Bacteria 6956
47 Ga0068860_100101982 3300005843 Bacteria 2738
48 Ga0068862_100043500 3300005844 Bacteria 3830
49 Ga0068862_100176961 3300005844 Bacteria 1913
50 Ga0068862_100179043 3300005844 Bacteria 1902
51 Ga0075366_10061494 3300006195 Bacteria 2232
52 Ga0075370_10074880 3300006353 Bacteria 1940
53 Ga0068865_100012376 3300006881 Bacteria 5368
54 Ga0097620_100000075 3300006931 Bacteria 91974
55 Ga0105240_10012411 3300009093 Bacteria 11762
56 Ga0105240_10032384 3300009093 Bacteria 6768
57 Ga0105240_10113419 3300009093 Bacteria 3275
58 Ga0105240_10478292 3300009093 Bacteria 1389
59 Ga0105247_10071243 3300009101 Bacteria 2173
60 Ga0105248_10005859 3300009177 Bacteria 13504
61 Ga0105248_10006700 3300009177 Bacteria 12634
62 Ga0105248_10019424 3300009177 Bacteria 7519
63 Ga0105248_10037451 3300009177 Bacteria 5426
64 Ga0105238_10130073 3300009551 Bacteria 2496
65 Ga0105249_10000337 3300009553 Bacteria 47466
66 Ga0105249_10162275 3300009553 Bacteria 2161
67 Ga0157373_10000864 3300013100 Bacteria 23539
68 Ga0157373_10002157 3300013100 Bacteria 14894
69 Ga0157371_10261357 3300013102 Bacteria 1248
70 Ga0157370_10010324 3300013104 Bacteria 9850
71 Ga0157369_10067329 3300013105 Bacteria 3850
72 Ga0157379_10000104 3300014968 Bacteria 57987
73 Ga0157379_10136624 3300014968 Bacteria 2209
74 Ga0183365_10001 3300015684 Bacteria 2090444
75 Ga0213876_10029124 3300021384 Bacteria 2912
76 Ga0213876_10081348 3300021384 Bacteria 1713
77 Ga0213876_10094468 3300021384 Bacteria 1584
78 Ga0209026_1021715 3300025250 Bacteria 988
79 Ga0209676_1000046 3300025292 Bacteria 409173
80 Ga0209676_1000099 3300025292 Bacteria 230048
81 Ga0209676_1003542 3300025292 Bacteria 9493
82 Ga0209758_1001746 3300025297 Bacteria 24192
83 Ga0209050_1000038 3300025298 Bacteria 412635
84 Ga0209050_1001182 3300025298 Bacteria 30758
85 Ga0209257_1000481 3300025304 Bacteria 72432
86 Ga0209257_1000957 3300025304 Bacteria 39736
87 Ga0209257_1001267 3300025304 Bacteria 31015
88 Ga0209257_1003216 3300025304 Bacteria 14408
89 Ga0207707_10012165 3300025912 Bacteria 7480
90 Ga0207707_10039565 3300025912 Bacteria 4121
91 Ga0207695_10000397 3300025913 Bacteria 98044
92 Ga0207695_10011561 3300025913 Bacteria 10678
93 Ga0207695_10013928 3300025913 Bacteria 9560
94 Ga0207695_10036505 3300025913 Bacteria 5313
95 Ga0207695_10138162 3300025913 Bacteria 2388
96 Ga0207695_10278576 3300025913 Bacteria 1566
97 Ga0207695_10573781 3300025913 Bacteria 1009
98 Ga0207671_10139461 3300025914 Bacteria 1867
99 Ga0207657_10080013 3300025919 Bacteria 2748
100 Ga0207681_10115782 3300025923 Bacteria 1957
101 Ga0207694_10033327 3300025924 Bacteria 3945
102 Ga0207694_10123452 3300025924 Bacteria 2069
103 Ga0207694_10272237 3300025924 Bacteria 1389
104 Ga0207650_10000064 3300025925 Bacteria 142969
105 Ga0207650_10069832 3300025925 Bacteria 2639
106 Ga0207650_10166502 3300025925 Bacteria 1749
107 Ga0207650_10240411 3300025925 Bacteria 1463
108 Ga0207644_10010221 3300025931 Bacteria 6185
109 Ga0207644_10208281 3300025931 Bacteria 1545
110 Ga0207690_10000153 3300025932 Bacteria 54709
111 Ga0207690_10010637 3300025932 Bacteria 5481
112 Ga0207711_10001330 3300025941 Bacteria 23385
113 Ga0207711_10003303 3300025941 Bacteria 14014
114 Ga0207711_10048099 3300025941 Bacteria 3649
115 Ga0207711_10482905 3300025941 Bacteria 1154
116 Ga0207689_10137383 3300025942 Bacteria 2013
117 Ga0207667_10162525 3300025949 Bacteria 2296
118 Ga0207712_10001365 3300025961 Bacteria 16716
119 Ga0207712_10044740 3300025961 Bacteria 3061
120 Ga0207712_10115710 3300025961 Bacteria 2019
121 Ga0207668_10000018 3300025972 Bacteria 158577
122 Ga0207668_10000238 3300025972 Bacteria 36931
123 Ga0207668_10002497 3300025972 Bacteria 10742
124 Ga0207668_10005171 3300025972 Bacteria 7677
125 Ga0207668_10048482 3300025972 Bacteria 2915
126 Ga0207668_10059135 3300025972 Bacteria 2683
127 Ga0207640_10040856 3300025981 Bacteria 2946
128 Ga0207658_10001688 3300025986 Bacteria 16763
129 Ga0207658_10001695 3300025986 Bacteria 16735
130 Ga0207658_10006972 3300025986 Bacteria 7692
131 Ga0207658_10030500 3300025986 Bacteria 3818
132 Ga0207658_10241378 3300025986 Bacteria 1531
133 Ga0207658_10533822 3300025986 Bacteria 1048
134 Ga0207703_10000811 3300026035 Bacteria 30817
135 Ga0207703_10004292 3300026035 Bacteria 11722
136 Ga0207703_10005704 3300026035 Bacteria 9987
137 Ga0207703_10353076 3300026035 Bacteria 1354
138 Ga0207641_10000019 3300026088 Bacteria 295899
139 Ga0207641_10023229 3300026088 Bacteria 5109
140 Ga0207641_10042742 3300026088 Bacteria 3803
141 Ga0207641_10083605 3300026088 Bacteria 2776
142 Ga0207676_10000302 3300026095 Bacteria 42408
143 Ga0207676_10000554 3300026095 Bacteria 31087
144 Ga0207676_10165991 3300026095 Bacteria 1918
145 Ga0207676_10377605 3300026095 Bacteria 1318
146 Ga0207675_100330732 3300026118 Bacteria 1489
147 Ga0209813_10001504 3300027866 Bacteria 5244
148 Ga0268266_10000005 3300028379 Bacteria 1448194
149 Ga0268266_10001993 3300028379 Bacteria 22852
150 Ga0268266_10047309 3300028379 Bacteria 3685
151 Ga0268265_10003460 3300028380 Bacteria 11350
152 Ga0268265_10004890 3300028380 Bacteria 9232
153 Ga0268265_10031824 3300028380 Bacteria 3813
154 Ga0268265_10137977 3300028380 Bacteria 2037
155 Ga0268265_10158257 3300028380 Bacteria 1920
156 Ga0268264_10000021 3300028381 Bacteria 481580
157 Ga0268264_10000118 3300028381 Bacteria 193487
158 Ga0268264_10017175 3300028381 Bacteria 5926
159 Ga0265337_1007316 3300028556 Bacteria 4140
160 Ga0265332_10171417 3300031238 Bacteria 906
161 Ga0265327_10000946 3300031251 Bacteria 42232
162 Ga0307513_10003729 3300031456 Bacteria 20592
163 Ga0307513_10017393 3300031456 Bacteria 8621
164 Ga0307516_10000010 3300031730 Bacteria 229720
165 Ga0307406_10041390 3300031901 Bacteria 2871
166 Ga0307412_10007752 3300031911 Bacteria 6106
167 Ga0307510_10042238 3300033180 Bacteria 4971
168 Ga0373935_0298467 3300035692 Bacteria 1138
169 Ga0373925_0181057 3300037068 Bacteria 1668
170 Ga0395899_0000026 3300037312 Bacteria 345291
171 Ga0395900_0064737 3300037418 Bacteria 3756
172 Ga0395905_0074171 3300037471 Bacteria 3189
173 Ga0395905_0164943 3300037471 Bacteria 2081
174 Ga0436364_1031751 3300037853 Bacteria 1249
175 Ga0395901_0215123 3300038443 Bacteria 2010
176 Ga0436365_0454434 3300039437 Bacteria 1667
177 Ga0436365_0595483 3300039437 Bacteria 3147
178 Ga0436361_1215974 3300039447 Bacteria 6291
179 Ga0466969_0000771 3300044656 Bacteria 17443
180 Ga0466966_0001130 3300044684 Bacteria 17143
181 Ga0466961_0005391 3300044693 Bacteria 8051
182 Ga0453684_0448758 3300044712 Bacteria 1436
183 Ga0466971_0000074 3300044719 Bacteria 36485
184 Ga0466957_0015573 3300044842 Bacteria 4441
185 Ga0466958_0002817 3300045836 Bacteria 8848
186 Ga0495638_0000764 3300046460 Bacteria 34208
187 Ga0495638_0000795 3300046460 Bacteria 33306
188 Ga0495638_0060069 3300046460 Bacteria 2352
189 Ga0495650_0014561 3300046471 Bacteria 4084
190 Ga0495585_0234108 3300046492 Bacteria 922
191 Ga0495583_0000234 3300046506 Bacteria 92118
192 Ga0495628_0222538 3300046516 Bacteria 1417
193 Ga0495631_0006450 3300046518 Bacteria 6055
194 Ga0495637_0009501 3300046520 Bacteria 4739
195 Ga0495637_0027546 3300046520 Bacteria 2541
196 Ga0495648_0001081 3300046524 Bacteria 27719
197 Ga0495652_0258172 3300046529 Bacteria 1288
198 Ga0495654_0074082 3300046530 Bacteria 1609
199 Ga0495586_0272510 3300046535 Bacteria 968
200 Ga0495609_0033715 3300046538 Bacteria 2324
201 Ga0495597_0000944 3300046542 Bacteria 22451
202 Ga0495622_0002135 3300046557 Bacteria 9636
203 Ga0495633_0004767 3300046558 Bacteria 8508
204 Ga0495668_0046607 3300046616 Bacteria 2408
205 Ga0495611_0009759 3300046648 Bacteria 4058
206 Ga0495625_0026772 3300046660 Bacteria 4350
207 Ga0495625_0106319 3300046660 Bacteria 1922
208 Ga0495669_0000004 3300046684 Bacteria 208878
209 Ga0495669_0000491 3300046684 Bacteria 18182
210 Ga0495669_0010450 3300046684 Bacteria 3924
211 Ga0495669_0203760 3300046684 Bacteria 946
212 Ga0495613_0004427 3300046689 Bacteria 10518
213 Ga0495613_0221464 3300046689 Bacteria 1328
214 Ga0495677_0019500 3300047445 Bacteria 2459
215 Ga0495673_0000403 3300047469 Bacteria 50650
216 Ga0495686_0001579 3300047472 Bacteria 24086
217 Ga0495686_0006714 3300047472 Bacteria 8751
218 Ga0495593_0057866 3300047673 Bacteria 2034
219 Ga0496101_0251591 3300048904 Bacteria 1377
220 Ga0496102_0105691 3300048905 Bacteria 2619
221 Ga0496103_0079603 3300048906 Bacteria 2059
222 Ga0496107_0040959 3300048910 Bacteria 3326
223 Ga0496115_0001222 3300048918 Bacteria 18430
224 Ga0496115_0007423 3300048918 Bacteria 8067
225 Ga0496115_0039121 3300048918 Bacteria 3766
226 Ga0496121_0000699 3300048924 Bacteria 62415
227 Ga0496122_0016718 3300048925 Bacteria 6914
228 Ga0496123_0003171 3300048926 Bacteria 18780
229 Ga0496124_0009747 3300048927 Bacteria 9829
230 Ga0496126_0013012 3300048929 Bacteria 8490
231 Ga0495678_019441 3300049459 Bacteria 3029
232 Ga0501033_0028370 3300049570 Bacteria 4205
233 Ga0501034_0002925 3300049571 Bacteria 19803
234 Ga0501034_0092999 3300049571 Bacteria 3012
235 Ga0501034_0157509 3300049571 Bacteria 2244
236 Ga0501043_0082633 3300049579 Bacteria 2525
237 Ga0501043_0265131 3300049579 Bacteria 1320
238 Ga0501047_0123360 3300049581 Bacteria 2471
239 Ga0501047_0282214 3300049581 Bacteria 1505
240 Ga0501070_0211660 3300049586 Bacteria 1591
241 Ga0501257_011900 3300049686 Bacteria 1989
242 Ga0501035_0005772 3300049822 Bacteria 11669
243 Ga0501035_0294462 3300049822 Bacteria 1369
244 Ga0501044_0003994 3300049823 Bacteria 16520
245 Ga0501044_0014747 3300049823 Bacteria 8425
246 Ga0501044_0345745 3300049823 Bacteria 1408
247 Ga0501044_0389287 3300049823 Bacteria 1308
248 nmdc:mga03n38_21373_c1 3300050490 Bacteria 1204
249 nmdc:mga0k408_118923_c1 3300050493 Bacteria 1564
250 nmdc:mga04h51_71514_c1 3300050495 Bacteria 1212
251 nmdc:mga07m45_45219_c2 3300050496 Bacteria 2273
252 Ga0500635_0000143 3300053080 Bacteria 40708
253 Ga0500578_0000080 3300053086 Bacteria 106387
254 Ga0500643_001275 3300053087 Bacteria 14883
255 Ga0500644_0000218 3300053088 Bacteria 33235
256 Ga0500644_0032352 3300053088 Bacteria 1671
257 Ga0500647_0136625 3300053091 Bacteria 1153
258 Ga0500651_0021235 3300053093 Bacteria 4047
259 Ga0500651_0022779 3300053093 Bacteria 3916
260 Ga0500651_0071068 3300053093 Bacteria 2166
261 Ga0500641_0001363 3300053096 Bacteria 8690
262 Ga0500641_0128739 3300053096 Bacteria 1092
263 Ga0500650_0165462 3300053098 Bacteria 1019
264 Ga0500555_001240 3300053103 Bacteria 8211
265 Ga0500556_0001845 3300053104 Bacteria 7673
266 Ga0500556_0004175 3300053104 Bacteria 4130
267 Ga0500556_0025499 3300053104 Bacteria 1954
268 Ga0500562_002993 3300053108 Bacteria 4213
269 Ga0500562_007199 3300053108 Bacteria 2807
270 Ga0500562_015019 3300053108 Bacteria 1985
271 Ga0500569_008505 3300053109 Bacteria 2349
272 Ga0500572_002346 3300053111 Bacteria 4577
273 Ga0500594_0000045 3300053118 Bacteria 39462
274 Ga0500595_005891 3300053119 Bacteria 5279
275 Ga0500595_016756 3300053119 Bacteria 2723
276 Ga0500608_000253 3300053122 Bacteria 20968
277 Ga0500618_000185 3300053125 Bacteria 51250
278 Ga0500559_0000002 3300053136 Bacteria 262002
279 Ga0500559_0000056 3300053136 Bacteria 88545
280 Ga0500559_0003837 3300053136 Bacteria 7273
281 Ga0500564_010353 3300053138 Bacteria 4088
282 Ga0500573_0105287 3300053140 Bacteria 1584
283 Ga0500590_129365 3300053148 Bacteria 1170
284 Ga0500616_0039301 3300053153 Bacteria 2552
285 Ga0500616_0065541 3300053153 Bacteria 1868
286 Ga0500622_0002171 3300053156 Bacteria 14534
287 Ga0500622_0002513 3300053156 Bacteria 13174
288 Ga0500622_0010453 3300053156 Bacteria 5095
289 Ga0500622_0019720 3300053156 Bacteria 3580
290 Ga0500624_010828 3300053157 Bacteria 1320
291 Ga0500636_0020342 3300053177 Bacteria 3930
292 Ga0500637_0016164 3300053178 Bacteria 3973
293 Ga0500625_097977 3300053729 Bacteria 1236
294 Ga0500645_001714 3300053730 Bacteria 10670
295 Ga0500645_004800 3300053730 Bacteria 5112
296 Ga0500645_024172 3300053730 Bacteria 1858
297 Ga0500609_002195 3300053731 Bacteria 2788
298 Ga0500552_001577 3300053733 Bacteria 2173
299 Ga0500552_019570 3300053733 Bacteria 950
300 Ga0500596_000298 3300053735 Bacteria 8796
301 Ga0466962_0002947 3300061719 Bacteria 8119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221699 2644549759 285
2 3300013100 Ga0157373_10000864 Ga0157373_1000086416 286
3 3300013100 Ga0157373_10002157 Ga0157373_100021579 286
4 3300028556 Ga0265337_1007316 Ga0265337_10073162 286
5 3300049579 Ga0501043_0265131 Ga0501043_0265131_294_1154 286
6 3300003781 Ga0055536_1001296 Ga0055536_10012969 287
7 3300003794 Ga0055531_10001593 Ga0055531_1000159310 287
8 3300005366 Ga0070659_100025758 Ga0070659_1000257583 287
9 3300005578 Ga0068854_100167002 Ga0068854_1001670023 287
10 3300005843 Ga0068860_100101982 Ga0068860_1001019822 287
11 3300005844 Ga0068862_100179043 Ga0068862_1001790432 287
12 3300013102 Ga0157371_10261357 Ga0157371_102613572 287
13 3300013104 Ga0157370_10010324 Ga0157370_100103245 287
14 3300013105 Ga0157369_10067329 Ga0157369_100673292 287
15 3300021384 Ga0213876_10094468 Ga0213876_100944682 287
16 3300025292 Ga0209676_1000099 Ga0209676_100009937 287
17 3300025298 Ga0209050_1001182 Ga0209050_10011829 287
18 3300025304 Ga0209257_1001267 Ga0209257_10012679 287
19 3300025913 Ga0207695_10278576 Ga0207695_102785762 287
20 3300025925 Ga0207650_10240411 Ga0207650_102404112 287
21 3300025932 Ga0207690_10010637 Ga0207690_100106374 287
22 3300025972 Ga0207668_10005171 Ga0207668_100051714 287
23 3300025981 Ga0207640_10040856 Ga0207640_100408563 287
24 3300028380 Ga0268265_10137977 Ga0268265_101379772 287
25 3300037312 Ga0395899_0000026 Ga0395899_0000026_263968_264831 287
26 3300039437 Ga0436365_0454434 Ga0436365_0454434_283_1146 287
27 3300039447 Ga0436361_1215974 Ga0436361_1215974_2630_3493 287
28 3300046460 Ga0495638_0000764 Ga0495638_0000764_19126_19992 287
29 3300046460 Ga0495638_0000795 Ga0495638_0000795_27935_28801 287
30 3300046460 Ga0495638_0060069 Ga0495638_0060069_717_1583 287
31 3300046471 Ga0495650_0014561 Ga0495650_0014561_1746_2612 287
32 3300046506 Ga0495583_0000234 Ga0495583_0000234_11541_12407 287
33 3300046518 Ga0495631_0006450 Ga0495631_0006450_1689_2555 287
34 3300046520 Ga0495637_0009501 Ga0495637_0009501_1742_2608 287
35 3300046520 Ga0495637_0027546 Ga0495637_0027546_129_995 287
36 3300046524 Ga0495648_0001081 Ga0495648_0001081_7320_8186 287
37 3300046558 Ga0495633_0004767 Ga0495633_0004767_4132_4995 287
38 3300047469 Ga0495673_0000403 Ga0495673_0000403_15982_16848 287
39 3300047472 Ga0495686_0001579 Ga0495686_0001579_2234_3100 287
40 3300048925 Ga0496122_0016718 Ga0496122_0016718_2898_3761 287
41 3300048926 Ga0496123_0003171 Ga0496123_0003171_4053_4916 287
42 3300048927 Ga0496124_0009747 Ga0496124_0009747_4763_5629 287
43 3300048929 Ga0496126_0013012 Ga0496126_0013012_4153_5019 287
44 3300049459 Ga0495678_019441 Ga0495678_019441_1066_1932 287
45 3300053086 Ga0500578_0000080 Ga0500578_0000080_46219_47085 287
46 3300053087 Ga0500643_001275 Ga0500643_001275_2242_3105 287
47 3300053088 Ga0500644_0000218 Ga0500644_0000218_16596_17462 287
48 3300053088 Ga0500644_0032352 Ga0500644_0032352_219_1085 287
49 3300053091 Ga0500647_0136625 Ga0500647_0136625_113_976 287
50 3300053096 Ga0500641_0001363 Ga0500641_0001363_3496_4359 287
51 3300053096 Ga0500641_0128739 Ga0500641_0128739_212_1078 287
52 3300053098 Ga0500650_0165462 Ga0500650_0165462_132_998 287
53 3300053104 Ga0500556_0001845 Ga0500556_0001845_3928_4794 287
54 3300053104 Ga0500556_0004175 Ga0500556_0004175_1761_2624 287
55 3300053104 Ga0500556_0025499 Ga0500556_0025499_179_1045 287
56 3300053108 Ga0500562_002993 Ga0500562_002993_2314_3180 287
57 3300053108 Ga0500562_007199 Ga0500562_007199_879_1742 287
58 3300053118 Ga0500594_0000045 Ga0500594_0000045_1118_1984 287
59 3300053125 Ga0500618_000185 Ga0500618_000185_11640_12506 287
60 3300053136 Ga0500559_0000056 Ga0500559_0000056_74854_75720 287
61 3300053138 Ga0500564_010353 Ga0500564_010353_2527_3393 287
62 3300053153 Ga0500616_0039301 Ga0500616_0039301_1072_1935 287
63 3300053156 Ga0500622_0002171 Ga0500622_0002171_539_1405 287
64 3300053156 Ga0500622_0002513 Ga0500622_0002513_8477_9343 287
65 3300053156 Ga0500622_0010453 Ga0500622_0010453_3785_4651 287
66 3300053156 Ga0500622_0019720 Ga0500622_0019720_2184_3050 287
67 3300053730 Ga0500645_001714 Ga0500645_001714_7965_8828 287
68 3300053730 Ga0500645_004800 Ga0500645_004800_2481_3347 287
69 3300053730 Ga0500645_024172 Ga0500645_024172_609_1472 287
70 3300053731 Ga0500609_002195 Ga0500609_002195_755_1621 287
71 3300053733 Ga0500552_001577 Ga0500552_001577_516_1379 287
72 3300003794 Ga0055531_10006218 Ga0055531_100062184 288
73 3300005334 Ga0068869_100140882 Ga0068869_1001408822 288
74 3300005335 Ga0070666_10156372 Ga0070666_101563722 288
75 3300005339 Ga0070660_100070956 Ga0070660_1000709562 288
76 3300005341 Ga0070691_10000799 Ga0070691_1000079911 288
77 3300005347 Ga0070668_100000138 Ga0070668_1000001387 288
78 3300005347 Ga0070668_100002433 Ga0070668_1000024332 288
79 3300005347 Ga0070668_100029830 Ga0070668_1000298304 288
80 3300005347 Ga0070668_100038577 Ga0070668_1000385774 288
81 3300005347 Ga0070668_100301050 Ga0070668_1003010502 288
82 3300005353 Ga0070669_100011412 Ga0070669_1000114126 288
83 3300005355 Ga0070671_100021051 Ga0070671_1000210514 288
84 3300005366 Ga0070659_100000136 Ga0070659_10000013651 288
85 3300005367 Ga0070667_100002308 Ga0070667_1000023088 288
86 3300005367 Ga0070667_100011928 Ga0070667_1000119282 288
87 3300005367 Ga0070667_100024775 Ga0070667_1000247754 288
88 3300005367 Ga0070667_100291336 Ga0070667_1002913362 288
89 3300005367 Ga0070667_100531953 Ga0070667_1005319532 288
90 3300005530 Ga0070679_100247899 Ga0070679_1002478992 288
91 3300005548 Ga0070665_100000015 Ga0070665_100000015222 288
92 3300005548 Ga0070665_100000915 Ga0070665_10000091535 288
93 3300005548 Ga0070665_100004050 Ga0070665_1000040503 288
94 3300005548 Ga0070665_100069000 Ga0070665_1000690003 288
95 3300005548 Ga0070665_100155590 Ga0070665_1001555902 288
96 3300005563 Ga0068855_100016681 Ga0068855_1000166816 288
97 3300005617 Ga0068859_100000075 Ga0068859_10000007540 288
98 3300005618 Ga0068864_100000137 Ga0068864_10000013745 288
99 3300005618 Ga0068864_100000246 Ga0068864_10000024610 288
100 3300005618 Ga0068864_100283947 Ga0068864_1002839472 288
101 3300005618 Ga0068864_100406324 Ga0068864_1004063241 288
102 3300005841 Ga0068863_100000137 Ga0068863_10000013755 288
103 3300005841 Ga0068863_100000165 Ga0068863_10000016533 288
104 3300005841 Ga0068863_100002612 Ga0068863_10000261214 288
105 3300005841 Ga0068863_100054925 Ga0068863_1000549254 288
106 3300005842 Ga0068858_100000625 Ga0068858_10000062517 288
107 3300005842 Ga0068858_100002500 Ga0068858_10000250012 288
108 3300005842 Ga0068858_100192106 Ga0068858_1001921062 288
109 3300005843 Ga0068860_100000051 Ga0068860_100000051183 288
110 3300005843 Ga0068860_100000309 Ga0068860_1000003096 288
111 3300005843 Ga0068860_100004107 Ga0068860_1000041073 288
112 3300005843 Ga0068860_100017633 Ga0068860_1000176332 288
113 3300005844 Ga0068862_100043500 Ga0068862_1000435004 288
114 3300005844 Ga0068862_100176961 Ga0068862_1001769613 288
115 3300006195 Ga0075366_10061494 Ga0075366_100614943 288
116 3300006353 Ga0075370_10074880 Ga0075370_100748802 288
117 3300006931 Ga0097620_100000075 Ga0097620_10000007540 288
118 3300009093 Ga0105240_10012411 Ga0105240_100124115 288
119 3300009093 Ga0105240_10032384 Ga0105240_100323847 288
120 3300009093 Ga0105240_10113419 Ga0105240_101134192 288
121 3300009101 Ga0105247_10071243 Ga0105247_100712432 288
122 3300009177 Ga0105248_10005859 Ga0105248_100058593 288
123 3300009177 Ga0105248_10006700 Ga0105248_100067009 288
124 3300009177 Ga0105248_10019424 Ga0105248_100194243 288
125 3300009177 Ga0105248_10037451 Ga0105248_100374515 288
126 3300009551 Ga0105238_10130073 Ga0105238_101300732 288
127 3300009553 Ga0105249_10000337 Ga0105249_1000033739 288
128 3300009553 Ga0105249_10162275 Ga0105249_101622751 288
129 3300014968 Ga0157379_10000104 Ga0157379_1000010448 288
130 3300014968 Ga0157379_10136624 Ga0157379_101366242 288
131 3300015684 Ga0183365_10001 Ga0183365_100011159 288
132 3300021384 Ga0213876_10029124 Ga0213876_100291243 288
133 3300021384 Ga0213876_10081348 Ga0213876_100813482 288
134 3300025250 Ga0209026_1021715 Ga0209026_10217151 288
135 3300025297 Ga0209758_1001746 Ga0209758_100174611 288
136 3300025298 Ga0209050_1000038 Ga0209050_100003887 288
137 3300025304 Ga0209257_1000957 Ga0209257_100095714 288
138 3300025304 Ga0209257_1003216 Ga0209257_100321614 288
139 3300025912 Ga0207707_10012165 Ga0207707_100121653 288
140 3300025912 Ga0207707_10039565 Ga0207707_100395654 288
141 3300025913 Ga0207695_10000397 Ga0207695_1000039715 288
142 3300025913 Ga0207695_10011561 Ga0207695_1001156110 288
143 3300025913 Ga0207695_10013928 Ga0207695_100139285 288
144 3300025913 Ga0207695_10036505 Ga0207695_100365053 288
145 3300025913 Ga0207695_10138162 Ga0207695_101381624 288
146 3300025913 Ga0207695_10573781 Ga0207695_105737811 288
147 3300025919 Ga0207657_10080013 Ga0207657_100800134 288
148 3300025923 Ga0207681_10115782 Ga0207681_101157822 288
149 3300025924 Ga0207694_10123452 Ga0207694_101234522 288
150 3300025924 Ga0207694_10272237 Ga0207694_102722371 288
151 3300025925 Ga0207650_10000064 Ga0207650_1000006447 288
152 3300025925 Ga0207650_10069832 Ga0207650_100698322 288
153 3300025925 Ga0207650_10166502 Ga0207650_101665023 288
154 3300025931 Ga0207644_10010221 Ga0207644_100102211 288
155 3300025931 Ga0207644_10208281 Ga0207644_102082812 288
156 3300025932 Ga0207690_10000153 Ga0207690_100001535 288
157 3300025941 Ga0207711_10001330 Ga0207711_1000133019 288
158 3300025941 Ga0207711_10003303 Ga0207711_100033035 288
159 3300025941 Ga0207711_10048099 Ga0207711_100480993 288
160 3300025941 Ga0207711_10482905 Ga0207711_104829051 288
161 3300025942 Ga0207689_10137383 Ga0207689_101373832 288
162 3300025949 Ga0207667_10162525 Ga0207667_101625253 288
163 3300025961 Ga0207712_10001365 Ga0207712_1000136514 288
164 3300025961 Ga0207712_10044740 Ga0207712_100447403 288
165 3300025961 Ga0207712_10115710 Ga0207712_101157103 288
166 3300025972 Ga0207668_10000018 Ga0207668_1000001853 288
167 3300025972 Ga0207668_10000238 Ga0207668_1000023822 288
168 3300025972 Ga0207668_10002497 Ga0207668_1000249710 288
169 3300025972 Ga0207668_10048482 Ga0207668_100484823 288
170 3300025972 Ga0207668_10059135 Ga0207668_100591352 288
171 3300025986 Ga0207658_10001688 Ga0207658_100016888 288
172 3300025986 Ga0207658_10001695 Ga0207658_100016954 288
173 3300025986 Ga0207658_10006972 Ga0207658_100069727 288
174 3300025986 Ga0207658_10030500 Ga0207658_100305004 288
175 3300025986 Ga0207658_10241378 Ga0207658_102413782 288
176 3300025986 Ga0207658_10533822 Ga0207658_105338221 288
177 3300026035 Ga0207703_10000811 Ga0207703_1000081122 288
178 3300026035 Ga0207703_10004292 Ga0207703_100042922 288
179 3300026035 Ga0207703_10005704 Ga0207703_100057046 288
180 3300026035 Ga0207703_10353076 Ga0207703_103530762 288
181 3300026088 Ga0207641_10000019 Ga0207641_1000001973 288
182 3300026088 Ga0207641_10023229 Ga0207641_100232294 288
183 3300026088 Ga0207641_10042742 Ga0207641_100427423 288
184 3300026088 Ga0207641_10083605 Ga0207641_100836052 288
185 3300026095 Ga0207676_10000302 Ga0207676_1000030218 288
186 3300026095 Ga0207676_10000554 Ga0207676_1000055410 288
187 3300026095 Ga0207676_10165991 Ga0207676_101659912 288
188 3300026095 Ga0207676_10377605 Ga0207676_103776051 288
189 3300026118 Ga0207675_100330732 Ga0207675_1003307322 288
190 3300027866 Ga0209813_10001504 Ga0209813_100015041 288
191 3300028379 Ga0268266_10000005 Ga0268266_10000005896 288
192 3300028379 Ga0268266_10001993 Ga0268266_1000199314 288
193 3300028379 Ga0268266_10047309 Ga0268266_100473093 288
194 3300028380 Ga0268265_10003460 Ga0268265_100034606 288
195 3300028380 Ga0268265_10004890 Ga0268265_100048903 288
196 3300028380 Ga0268265_10031824 Ga0268265_100318242 288
197 3300028380 Ga0268265_10158257 Ga0268265_101582573 288
198 3300028381 Ga0268264_10000021 Ga0268264_10000021258 288
199 3300028381 Ga0268264_10000118 Ga0268264_1000011822 288
200 3300028381 Ga0268264_10017175 Ga0268264_100171753 288
201 3300031238 Ga0265332_10171417 Ga0265332_101714171 288
202 3300031251 Ga0265327_10000946 Ga0265327_1000094624 288
203 3300031456 Ga0307513_10003729 Ga0307513_1000372914 288
204 3300031456 Ga0307513_10017393 Ga0307513_100173934 288
205 3300031730 Ga0307516_10000010 Ga0307516_10000010157 288
206 3300033180 Ga0307510_10042238 Ga0307510_100422383 288
207 3300035692 Ga0373935_0298467 Ga0373935_0298467_197_1063 288
208 3300037068 Ga0373925_0181057 Ga0373925_0181057_205_1071 288
209 3300037418 Ga0395900_0064737 Ga0395900_0064737_2526_3392 288
210 3300037471 Ga0395905_0074171 Ga0395905_0074171_1251_2117 288
211 3300037471 Ga0395905_0164943 Ga0395905_0164943_168_1034 288
212 3300037853 Ga0436364_1031751 Ga0436364_1031751_15_881 288
213 3300038443 Ga0395901_0215123 Ga0395901_0215123_666_1532 288
214 3300039437 Ga0436365_0595483 Ga0436365_0595483_391_1257 288
215 3300044656 Ga0466969_0000771 Ga0466969_0000771_12097_12963 288
216 3300044684 Ga0466966_0001130 Ga0466966_0001130_3650_4516 288
217 3300044693 Ga0466961_0005391 Ga0466961_0005391_2563_3429 288
218 3300044712 Ga0453684_0448758 Ga0453684_0448758_279_1145 288
219 3300044719 Ga0466971_0000074 Ga0466971_0000074_35429_36295 288
220 3300044842 Ga0466957_0015573 Ga0466957_0015573_191_1057 288
221 3300045836 Ga0466958_0002817 Ga0466958_0002817_5062_5928 288
222 3300046492 Ga0495585_0234108 Ga0495585_0234108_25_891 288
223 3300046530 Ga0495654_0074082 Ga0495654_0074082_478_1344 288
224 3300046535 Ga0495586_0272510 Ga0495586_0272510_72_938 288
225 3300046538 Ga0495609_0033715 Ga0495609_0033715_70_936 288
226 3300046542 Ga0495597_0000944 Ga0495597_0000944_17051_17917 288
227 3300046557 Ga0495622_0002135 Ga0495622_0002135_1635_2501 288
228 3300046616 Ga0495668_0046607 Ga0495668_0046607_420_1286 288
229 3300046648 Ga0495611_0009759 Ga0495611_0009759_930_1796 288
230 3300046660 Ga0495625_0026772 Ga0495625_0026772_1777_2643 288
231 3300046660 Ga0495625_0106319 Ga0495625_0106319_1042_1908 288
232 3300046684 Ga0495669_0000004 Ga0495669_0000004_48521_49387 288
233 3300046684 Ga0495669_0000491 Ga0495669_0000491_11903_12769 288
234 3300046684 Ga0495669_0010450 Ga0495669_0010450_2038_2904 288
235 3300046684 Ga0495669_0203760 Ga0495669_0203760_19_885 288
236 3300046689 Ga0495613_0004427 Ga0495613_0004427_5116_5982 288
237 3300046689 Ga0495613_0221464 Ga0495613_0221464_254_1120 288
238 3300047445 Ga0495677_0019500 Ga0495677_0019500_286_1152 288
239 3300047472 Ga0495686_0006714 Ga0495686_0006714_1421_2287 288
240 3300047673 Ga0495593_0057866 Ga0495593_0057866_902_1768 288
241 3300048904 Ga0496101_0251591 Ga0496101_0251591_110_976 288
242 3300048905 Ga0496102_0105691 Ga0496102_0105691_222_1088 288
243 3300048906 Ga0496103_0079603 Ga0496103_0079603_84_950 288
244 3300048910 Ga0496107_0040959 Ga0496107_0040959_625_1491 288
245 3300048918 Ga0496115_0001222 Ga0496115_0001222_6169_7035 288
246 3300048918 Ga0496115_0007423 Ga0496115_0007423_6602_7468 288
247 3300048924 Ga0496121_0000699 Ga0496121_0000699_36463_37329 288
248 3300049570 Ga0501033_0028370 Ga0501033_0028370_3070_3936 288
249 3300049571 Ga0501034_0002925 Ga0501034_0002925_10477_11343 288
250 3300049571 Ga0501034_0092999 Ga0501034_0092999_2135_3001 288
251 3300049571 Ga0501034_0157509 Ga0501034_0157509_166_1032 288
252 3300049579 Ga0501043_0082633 Ga0501043_0082633_339_1205 288
253 3300049581 Ga0501047_0123360 Ga0501047_0123360_1530_2396 288
254 3300049581 Ga0501047_0282214 Ga0501047_0282214_178_1044 288
255 3300049686 Ga0501257_011900 Ga0501257_011900_746_1612 288
256 3300049822 Ga0501035_0005772 Ga0501035_0005772_3321_4187 288
257 3300049822 Ga0501035_0294462 Ga0501035_0294462_393_1259 288
258 3300049823 Ga0501044_0003994 Ga0501044_0003994_9197_10063 288
259 3300049823 Ga0501044_0014747 Ga0501044_0014747_1014_1937 288
260 3300049823 Ga0501044_0345745 Ga0501044_0345745_451_1317 288
261 3300049823 Ga0501044_0389287 Ga0501044_0389287_276_1142 288
262 3300050490 nmdc:mga03n38_21373_c1 nmdc:mga03n38_21373_c1_45_911 288
263 3300050493 nmdc:mga0k408_118923_c1 nmdc:mga0k408_118923_c1_487_1353 288
264 3300050495 nmdc:mga04h51_71514_c1 nmdc:mga04h51_71514_c1_272_1138 288
265 3300050496 nmdc:mga07m45_45219_c2 nmdc:mga07m45_45219_c2_1339_2205 288
266 3300053080 Ga0500635_0000143 Ga0500635_0000143_7155_8021 288
267 3300053093 Ga0500651_0021235 Ga0500651_0021235_1714_2580 288
268 3300053103 Ga0500555_001240 Ga0500555_001240_106_972 288
269 3300053108 Ga0500562_015019 Ga0500562_015019_265_1131 288
270 3300053109 Ga0500569_008505 Ga0500569_008505_893_1759 288
271 3300053111 Ga0500572_002346 Ga0500572_002346_877_1743 288
272 3300053119 Ga0500595_005891 Ga0500595_005891_2658_3524 288
273 3300053119 Ga0500595_016756 Ga0500595_016756_927_1793 288
274 3300053122 Ga0500608_000253 Ga0500608_000253_17521_18387 288
275 3300053136 Ga0500559_0000002 Ga0500559_0000002_58540_59406 288
276 3300053136 Ga0500559_0003837 Ga0500559_0003837_5312_6178 288
277 3300053148 Ga0500590_129365 Ga0500590_129365_17_883 288
278 3300053153 Ga0500616_0065541 Ga0500616_0065541_616_1482 288
279 3300053157 Ga0500624_010828 Ga0500624_010828_175_1041 288
280 3300053177 Ga0500636_0020342 Ga0500636_0020342_880_1746 288
281 3300053178 Ga0500637_0016164 Ga0500637_0016164_2691_3557 288
282 3300053729 Ga0500625_097977 Ga0500625_097977_103_969 288
283 3300053733 Ga0500552_019570 Ga0500552_019570_74_940 288
284 3300053735 Ga0500596_000298 Ga0500596_000298_1369_2235 288
285 3300061719 Ga0466962_0002947 Ga0466962_0002947_4656_5522 288
286 3300003781 Ga0055536_1000874 Ga0055536_100087419 289
287 3300006881 Ga0068865_100012376 Ga0068865_1000123763 289
288 3300009093 Ga0105240_10478292 Ga0105240_104782922 289
289 3300025292 Ga0209676_1000046 Ga0209676_1000046208 289
290 3300025292 Ga0209676_1003542 Ga0209676_10035429 289
291 3300025304 Ga0209257_1000481 Ga0209257_100048125 289
292 3300025914 Ga0207671_10139461 Ga0207671_101394613 289
293 3300025924 Ga0207694_10033327 Ga0207694_100333274 289
294 3300031901 Ga0307406_10041390 Ga0307406_100413902 289
295 3300031911 Ga0307412_10007752 Ga0307412_100077525 289
296 3300046516 Ga0495628_0222538 Ga0495628_0222538_511_1380 289
297 3300046529 Ga0495652_0258172 Ga0495652_0258172_289_1158 289
298 3300048918 Ga0496115_0039121 Ga0496115_0039121_509_1378 289
299 3300049586 Ga0501070_0211660 Ga0501070_0211660_663_1532 289
300 3300053093 Ga0500651_0022779 Ga0500651_0022779_2734_3603 289
301 3300053093 Ga0500651_0071068 Ga0500651_0071068_460_1329 289
302 3300053140 Ga0500573_0105287 Ga0500573_0105287_269_1138 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

74

356

0.88

PF08242

Methyltransf_12

Methyltransferase domain

222

314

0.88

PF13649

Methyltransf_25

Methyltransferase domain

221

313

0.83

PF05175

MTS

Methyltransferase small domain

201

312

0.81

PF13847

Methyltransf_31

Methyltransferase domain

215

326

0.8

PF08241

Methyltransf_11

Methyltransferase domain

222

317

0.77

PF13489

Methyltransf_23

Methyltransferase domain

204

350

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9107 99 289
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9077 99 289
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8704 99 289
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8583 99 289
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.8548 150 289
ID Description Score Start End Superfamily
3cjtC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9329 92 287 3.40.50.150
3grzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9325 131 289 3.40.50.150
2nxjB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9299 133 287 3.40.50.150
3grzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9107 99 289 3.40.50.150
3grzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9098 131 289 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A381WA52-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9931 219 288
AF-A0A7Y1TPM1-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9916 222 287 GO:0005840
GO:0008168
GO:0032259
AF-A0A3M1A1I0-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9885 202 288
AF-A0A0T5ZUD6-F1-model_v4 Ribosomal protein L11 methyltransferase, ribosomal protein L11 methyltransferase (EC 2.1.1.-) 0.9883 219 286 GO:0005840
GO:0008168
GO:0032259
AF-R7JP40-F1-model_v4 deleted 0.9868 218 288

Feature Viewer

pLDDT pTM Quality
85.43 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map