F394231

General Info

Members Datasets Scaffolds Average Seq Length
298 203 298 122

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10495223|Ga0111539_104952232
Length 149
Sequence MGLDGRIAFHDRRTKRRGRNAVCYILNHMVQYLRTRFDAAFAALSDATRRGVLEQLGRADASITDLADKFHMTLTGMKKHVGVLEQAGLVTTEKVGRVRTCKLGLRRLDEEAAWIERHRQLWAARFDELDQVVEELKRKEKVDGRKKRK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
112 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
131 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
132 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
133 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
134 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
194 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
196 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
197 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 5.03
Rhizosphere 89.6
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10110883 3300003320 Bacteria 1384
2 Ga0065715_10029033 3300005293 Bacteria 1465
3 Ga0065715_10051117 3300005293 Bacteria 1066
4 Ga0070658_10496559 3300005327 Bacteria 1054
5 Ga0070683_100209283 3300005329 Bacteria 1852
6 Ga0070670_100249454 3300005331 Bacteria 1546
7 Ga0068869_100677404 3300005334 Bacteria 878
8 Ga0070666_10086323 3300005335 Bacteria 2150
9 Ga0070666_10199374 3300005335 Bacteria 1408
10 Ga0070682_100280784 3300005337 Bacteria 1214
11 Ga0070660_100651698 3300005339 Bacteria 882
12 Ga0070660_101448568 3300005339 Bacteria 584
13 Ga0070668_100638489 3300005347 Bacteria 934
14 Ga0070668_101100588 3300005347 Bacteria 717
15 Ga0070675_100093564 3300005354 Bacteria 2521
16 Ga0070673_100598320 3300005364 Bacteria 1006
17 Ga0070659_100278584 3300005366 Bacteria 1391
18 Ga0070659_100803199 3300005366 Bacteria 818
19 Ga0070659_101622400 3300005366 Bacteria 578
20 Ga0070667_100292344 3300005367 Bacteria 1465
21 Ga0070710_10232302 3300005437 Bacteria 1178
22 Ga0070711_100053525 3300005439 Bacteria 2782
23 Ga0070705_100530877 3300005440 Bacteria 899
24 Ga0070700_100721853 3300005441 Bacteria 794
25 Ga0070663_100416212 3300005455 Bacteria 1102
26 Ga0070678_100035694 3300005456 Bacteria 3474
27 Ga0070678_100053800 3300005456 Bacteria 2930
28 Ga0070678_100230919 3300005456 Bacteria 1542
29 Ga0070662_100277825 3300005457 Bacteria 1355
30 Ga0070662_100386341 3300005457 Bacteria 1153
31 Ga0070681_10376199 3300005458 Bacteria 1331
32 Ga0070698_100028937 3300005471 Bacteria 5752
33 Ga0070684_100146921 3300005535 Bacteria 2134
34 Ga0070697_100403419 3300005536 Bacteria 1186
35 Ga0070697_100537318 3300005536 Bacteria 1024
36 Ga0070672_100001616 3300005543 Bacteria 14012
37 Ga0070672_100050369 3300005543 Bacteria 3242
38 Ga0070686_101787020 3300005544 Bacteria 523
39 Ga0070665_100028176 3300005548 Bacteria 5657
40 Ga0070704_100672905 3300005549 Bacteria 915
41 Ga0070704_101215907 3300005549 Bacteria 687
42 Ga0070664_100001608 3300005564 Bacteria 18074
43 Ga0070664_100282294 3300005564 Bacteria 1497
44 Ga0068857_100002047 3300005577 Bacteria 16365
45 Ga0068854_101355729 3300005578 Bacteria 642
46 Ga0070702_100252333 3300005615 Bacteria 1196
47 Ga0068852_100384425 3300005616 Bacteria 1377
48 Ga0068864_100000091 3300005618 Bacteria 96169
49 Ga0068864_101097551 3300005618 Bacteria 792
50 Ga0068861_100371434 3300005719 Bacteria 1261
51 Ga0068863_100019604 3300005841 Bacteria 6470
52 Ga0068863_100352496 3300005841 Bacteria 1433
53 Ga0068860_100102391 3300005843 Bacteria 2732
54 Ga0068860_101093351 3300005843 Bacteria 817
55 Ga0068862_100773799 3300005844 Bacteria 935
56 Ga0068862_101166522 3300005844 Bacteria 768
57 Ga0075366_10304867 3300006195 Bacteria 974
58 Ga0097621_100299226 3300006237 Bacteria 1420
59 Ga0097621_100350403 3300006237 Bacteria 1313
60 Ga0068871_100151843 3300006358 Bacteria 1976
61 Ga0075428_100000605 3300006844 Bacteria 36581
62 Ga0075428_100004318 3300006844 Bacteria 15660
63 Ga0075431_100265128 3300006847 Bacteria 1742
64 Ga0075431_100408337 3300006847 Bacteria 1358
65 Ga0075431_100752683 3300006847 Bacteria 950
66 Ga0075434_101269997 3300006871 Bacteria 747
67 Ga0075429_100607856 3300006880 Bacteria 958
68 Ga0068865_100623939 3300006881 Bacteria 913
69 Ga0068865_100747641 3300006881 Bacteria 839
70 Ga0075436_100036106 3300006914 Bacteria 3410
71 Ga0075435_100869789 3300007076 Bacteria 786
72 Ga0105240_11535479 3300009093 Bacteria 698
73 Ga0111539_10049546 3300009094 Bacteria 5007
74 Ga0111539_10495223 3300009094 Bacteria 1423
75 Ga0105245_10427589 3300009098 Bacteria 1328
76 Ga0114129_10000929 3300009147 Bacteria 38252
77 Ga0105243_11456440 3300009148 Bacteria 707
78 Ga0105241_10312598 3300009174 Bacteria 1352
79 Ga0105241_11465954 3300009174 Bacteria 656
80 Ga0105242_10520722 3300009176 Bacteria 1134
81 Ga0105248_10104803 3300009177 Bacteria 3188
82 Ga0105248_13236600 3300009177 Bacteria 518
83 Ga0105237_11490578 3300009545 Bacteria 683
84 Ga0105238_10260209 3300009551 Bacteria 1714
85 Ga0105238_10702313 3300009551 Bacteria 1023
86 Ga0105249_10047246 3300009553 Bacteria 3922
87 Ga0105249_10615444 3300009553 Bacteria 1142
88 Ga0105249_11071464 3300009553 Bacteria 876
89 Ga0105239_10237687 3300010375 Bacteria 2045
90 Ga0105246_11490419 3300011119 Bacteria 635
91 Ga0157342_1064435 3300012507 Bacteria 545
92 Ga0157374_10158256 3300013296 Bacteria 2206
93 Ga0157374_10842269 3300013296 Bacteria 934
94 Ga0157378_10072122 3300013297 Bacteria 3103
95 Ga0157378_10941120 3300013297 Bacteria 896
96 Ga0163162_11404263 3300013306 Bacteria 794
97 Ga0163162_11497223 3300013306 Bacteria 769
98 Ga0157375_10118106 3300013308 Bacteria 2758
99 Ga0157375_10181613 3300013308 Bacteria 2255
100 Ga0163163_10025346 3300014325 Bacteria 5654
101 Ga0163163_10518169 3300014325 Bacteria 1255
102 Ga0163163_11477822 3300014325 Bacteria 741
103 Ga0157379_10001284 3300014968 Bacteria 20438
104 Ga0157379_10123496 3300014968 Bacteria 2330
105 Ga0157376_11306566 3300014969 Bacteria 755
106 Ga0157376_12431613 3300014969 Bacteria 563
107 Ga0163161_10108788 3300017792 Bacteria 2070
108 Ga0163161_10548503 3300017792 Bacteria 947
109 Ga0213876_10379512 3300021384 Bacteria 752
110 Ga0207697_10030776 3300025315 Bacteria 2196
111 Ga0207680_10190812 3300025903 Bacteria 1391
112 Ga0207680_10283436 3300025903 Bacteria 1152
113 Ga0207680_10370720 3300025903 Bacteria 1008
114 Ga0207643_11064083 3300025908 Bacteria 522
115 Ga0207705_10772590 3300025909 Bacteria 746
116 Ga0207705_11157482 3300025909 Bacteria 594
117 Ga0207654_10085229 3300025911 Bacteria 1912
118 Ga0207707_10302440 3300025912 Bacteria 1383
119 Ga0207695_10138699 3300025913 Bacteria 2383
120 Ga0207695_10713070 3300025913 Bacteria 884
121 Ga0207663_10005083 3300025916 Bacteria 6605
122 Ga0207657_10299773 3300025919 Bacteria 1273
123 Ga0207681_10146383 3300025923 Bacteria 1765
124 Ga0207694_11534435 3300025924 Bacteria 562
125 Ga0207650_10242032 3300025925 Bacteria 1458
126 Ga0207659_11094913 3300025926 Bacteria 685
127 Ga0207687_10743355 3300025927 Bacteria 834
128 Ga0207690_10402375 3300025932 Bacteria 1092
129 Ga0207690_10675452 3300025932 Bacteria 848
130 Ga0207706_10195647 3300025933 Bacteria 1774
131 Ga0207686_10478253 3300025934 Bacteria 963
132 Ga0207670_10587781 3300025936 Bacteria 913
133 Ga0207704_10268495 3300025938 Bacteria 1290
134 Ga0207704_10302356 3300025938 Bacteria 1226
135 Ga0207704_10579207 3300025938 Bacteria 916
136 Ga0207691_10827583 3300025940 Bacteria 777
137 Ga0207689_10134445 3300025942 Bacteria 2036
138 Ga0207679_10293044 3300025945 Bacteria 1399
139 Ga0207679_11951366 3300025945 Bacteria 535
140 Ga0207712_10284514 3300025961 Bacteria 1351
141 Ga0207712_10699328 3300025961 Bacteria 885
142 Ga0207712_11436348 3300025961 Bacteria 617
143 Ga0207640_11693996 3300025981 Bacteria 571
144 Ga0207703_11197656 3300026035 Unclassified 730
145 Ga0207639_10542301 3300026041 Bacteria 1067
146 Ga0207678_10151375 3300026067 Bacteria 1981
147 Ga0207678_10488129 3300026067 Bacteria 1073
148 Ga0207641_10111216 3300026088 Bacteria 2429
149 Ga0207676_10000013 3300026095 Bacteria 343067
150 Ga0207676_10202424 3300026095 Bacteria 1755
151 Ga0207676_11202122 3300026095 Bacteria 751
152 Ga0207674_10003324 3300026116 Bacteria 19774
153 Ga0207674_10557854 3300026116 Bacteria 1106
154 Ga0207683_10036358 3300026121 Bacteria 4288
155 Ga0207683_10043721 3300026121 Bacteria 3915
156 Ga0207683_10139241 3300026121 Bacteria 2186
157 Ga0207698_10145125 3300026142 Bacteria 2051
158 Ga0207698_12356613 3300026142 Bacteria 544
159 Ga0207428_10177407 3300027907 Bacteria 1611
160 Ga0268266_10067638 3300028379 Bacteria 3092
161 Ga0268266_10146215 3300028379 Bacteria 2125
162 Ga0268265_11606556 3300028380 Bacteria 655
163 Ga0268264_10477484 3300028381 Bacteria 1212
164 Ga0265338_10000006 3300028800 Bacteria 570804
165 Ga0307511_10311796 3300030521 Bacteria 702
166 Ga0316182_1407811 3300030745 Bacteria 871
167 Ga0265762_1147552 3300030760 Bacteria 558
168 Ga0265332_10007317 3300031238 Bacteria 4992
169 Ga0265325_10000007 3300031241 Bacteria 208874
170 Ga0265339_10000199 3300031249 Bacteria 49797
171 Ga0265331_10024936 3300031250 Bacteria 3020
172 Ga0307509_10151183 3300031507 Bacteria 2236
173 Ga0307408_100260513 3300031548 Bacteria 1435
174 Ga0265313_10000741 3300031595 Bacteria 33487
175 Ga0265342_10022915 3300031712 Bacteria 3962
176 Ga0307409_101683552 3300031995 Bacteria 663
177 Ga0307416_100349055 3300032002 Bacteria 1496
178 Ga0307416_101001183 3300032002 Bacteria 939
179 Ga0307415_100096891 3300032126 Bacteria 2151
180 Ga0373928_0204568 3300035084 Bacteria 571
181 Ga0373937_0015435 3300036401 Bacteria 6752
182 Ga0395900_0759280 3300037418 Bacteria 900
183 Ga0436364_0234011 3300037853 Bacteria 3833
184 Ga0436365_1466577 3300039437 Bacteria 1104
185 Ga0451793_1204802 3300041452 Bacteria 592
186 Ga0451855_1774085 3300041511 Bacteria 564
187 Ga0439437_025100 3300042000 Bacteria 733
188 Ga0439450_184445 3300042008 Bacteria 555
189 Ga0450896_086811 3300042133 Bacteria 531
190 Ga0450905_016502 3300042142 Bacteria 1066
191 Ga0439458_0098886 3300042157 Bacteria 756
192 Ga0439459_0214953 3300042438 Bacteria 530
193 Ga0439464_0065800 3300042439 Bacteria 1066
194 Ga0439460_0025354 3300042461 Bacteria 1650
195 Ga0453684_0204211 3300044712 Bacteria 2301
196 Ga0451576_1022642 3300045051 Bacteria 866
197 Ga0495621_0105579 3300046539 Bacteria 1076
198 Ga0496102_0303792 3300048905 Bacteria 1504
199 Ga0496103_0915537 3300048906 Bacteria 549
200 Ga0496104_0138117 3300048907 Bacteria 2342
201 Ga0496104_0784370 3300048907 Bacteria 859
202 Ga0496105_0548532 3300048908 Bacteria 902
203 Ga0496106_0238741 3300048909 Bacteria 1452
204 Ga0496107_0974417 3300048910 Bacteria 616
205 Ga0496108_0066758 3300048911 Bacteria 3034
206 Ga0496108_1082489 3300048911 Bacteria 682
207 Ga0496109_0220304 3300048912 Bacteria 1784
208 Ga0496110_0260212 3300048913 Bacteria 1579
209 Ga0496111_0229272 3300048914 Bacteria 1380
210 Ga0496112_0116086 3300048915 Bacteria 2647
211 Ga0496114_1371088 3300048917 Bacteria 594
212 Ga0496117_0264533 3300048920 Bacteria 930
213 Ga0496118_0174336 3300048921 Bacteria 1309
214 Ga0501292_057211 3300049515 Bacteria 701
215 Ga0501032_0004174 3300049569 Bacteria 10946
216 Ga0501033_0034507 3300049570 Bacteria 3794
217 Ga0501033_0961556 3300049570 Bacteria 572
218 Ga0501034_0002379 3300049571 Bacteria 22851
219 Ga0501036_0092205 3300049572 Bacteria 2559
220 Ga0501036_0187915 3300049572 Bacteria 1739
221 Ga0501036_0221222 3300049572 Bacteria 1590
222 Ga0501036_0264768 3300049572 Bacteria 1440
223 Ga0501037_0010726 3300049573 Bacteria 6734
224 Ga0501037_0133240 3300049573 Bacteria 1781
225 Ga0501037_1033654 3300049573 Bacteria 534
226 Ga0501038_0059148 3300049574 Bacteria 3283
227 Ga0501038_0123152 3300049574 Bacteria 2136
228 Ga0501042_0762260 3300049578 Bacteria 704
229 Ga0501043_0072392 3300049579 Bacteria 2707
230 Ga0501043_0243036 3300049579 Bacteria 1388
231 Ga0501043_0368594 3300049579 Bacteria 1089
232 Ga0501046_0013161 3300049580 Bacteria 7020
233 Ga0501046_0378417 3300049580 Bacteria 1025
234 Ga0501047_0000315 3300049581 Bacteria 55857
235 Ga0501047_0002340 3300049581 Bacteria 18119
236 Ga0501047_0016398 3300049581 Bacteria 7072
237 Ga0501048_0329834 3300049582 Bacteria 1087
238 Ga0501067_0000119 3300049583 Bacteria 43944
239 Ga0501068_0046569 3300049584 Bacteria 2615
240 Ga0501070_0004828 3300049586 Bacteria 11520
241 Ga0501071_0213986 3300049587 Unclassified 1450
242 Ga0501071_0662999 3300049587 Bacteria 803
243 Ga0501072_0002403 3300049588 Bacteria 14040
244 Ga0501073_0002435 3300049589 Bacteria 13916
245 Ga0501074_0014434 3300049590 Bacteria 5748
246 Ga0501075_0035742 3300049591 Bacteria 3707
247 Ga0501075_0510863 3300049591 Bacteria 917
248 Ga0501076_0176521 3300049592 Bacteria 1741
249 Ga0501076_0242195 3300049592 Bacteria 1476
250 Ga0501076_0949504 3300049592 Bacteria 709
251 Ga0501219_010996 3300049703 Bacteria 686
252 Ga0501079_0002546 3300049741 Bacteria 13238
253 Ga0501080_0002008 3300049742 Bacteria 17577
254 Ga0501080_0157462 3300049742 Bacteria 2098
255 Ga0501080_0447173 3300049742 Bacteria 1159
256 Ga0501080_0730613 3300049742 Bacteria 872
257 Ga0501080_1038191 3300049742 Bacteria 710
258 Ga0501081_0246309 3300049743 Bacteria 1304
259 Ga0501081_0755711 3300049743 Bacteria 731
260 Ga0501083_0000646 3300049744 Bacteria 22541
261 Ga0501083_0397054 3300049744 Bacteria 897
262 Ga0501035_0028207 3300049822 Bacteria 5124
263 Ga0501035_0080117 3300049822 Bacteria 2884
264 Ga0501035_0402601 3300049822 Bacteria 1138
265 Ga0501044_0000956 3300049823 Bacteria 34699
266 Ga0501044_0004556 3300049823 Bacteria 15500
267 Ga0501044_0172355 3300049823 Bacteria 2134
268 nmdc:mga05p37_13_c1 3300050507 Bacteria 139062
269 nmdc:mga05p37_22605_c1 3300050507 Bacteria 7626
270 nmdc:mga09592_269151_c1 3300050508 Bacteria 1478
271 nmdc:mga09592_545387_c1 3300050508 Bacteria 996
272 nmdc:mga09592_6180_c1 3300050508 Bacteria 9748
273 nmdc:mga0qj67_33657_c1 3300050509 Bacteria 3999
274 nmdc:mga06r32_4901_c1 3300050510 Bacteria 12057
275 nmdc:mga06r32_73640_c1 3300050510 Bacteria 3309
276 nmdc:mga08y16_67235_c1 3300050511 Bacteria 3739
277 nmdc:mga08y16_9713_c1 3300050511 Bacteria 10101
278 nmdc:mga0n895_64627_c1 3300050512 Bacteria 3620
279 nmdc:mga08x19_10374_c1 3300050514 Bacteria 5592
280 nmdc:mga08x19_52245_c1 3300050514 Bacteria 2628
281 nmdc:mga0a205_498632_c1 3300050515 Bacteria 1075
282 Ga0500651_0293120 3300053093 Bacteria 935
283 Ga0500555_039926 3300053103 Bacteria 1309
284 Ga0500592_020418 3300053116 Bacteria 1066
285 Ga0500595_008648 3300053119 Bacteria 4153
286 Ga0500619_001037 3300053154 Bacteria 4808
287 Ga0500645_000154 3300053730 Bacteria 53453
288 Ga0501084_0445310 3300054114 Unclassified 1095
289 Ga0501084_0530348 3300054114 Bacteria 995
290 Ga0501084_0582812 3300054114 Bacteria 945
291 Ga0590071_000843 3300059421 Bacteria 8545
292 Ga0590074_007441 3300059423 Bacteria 1821
293 Ga0590075_000790 3300059424 Bacteria 8354
294 Ga0501082_0005653 3300060353 Bacteria 10848
295 Ga0501082_0293512 3300060353 Bacteria 1416
296 Ga0530510_0341320 3300061734 Bacteria 1124
297 Ga0530510_0711833 3300061734 Bacteria 765
298 Ga0530510_1267383 3300061734 Bacteria 565

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0221222 Ga0501036_0221222_47_409 113
2 3300005327 Ga0070658_10496559 Ga0070658_104965591 118
3 3300005354 Ga0070675_100093564 Ga0070675_1000935643 118
4 3300005364 Ga0070673_100598320 Ga0070673_1005983202 118
5 3300005367 Ga0070667_100292344 Ga0070667_1002923443 118
6 3300005543 Ga0070672_100001616 Ga0070672_10000161613 118
7 3300005549 Ga0070704_101215907 Ga0070704_1012159071 118
8 3300005564 Ga0070664_100282294 Ga0070664_1002822942 118
9 3300005616 Ga0068852_100384425 Ga0068852_1003844251 118
10 3300005841 Ga0068863_100352496 Ga0068863_1003524963 118
11 3300006237 Ga0097621_100299226 Ga0097621_1002992262 118
12 3300013296 Ga0157374_10158256 Ga0157374_101582563 118
13 3300013308 Ga0157375_10181613 Ga0157375_101816132 118
14 3300003320 rootH2_10110883 rootH2_101108832 119
15 3300005293 Ga0065715_10029033 Ga0065715_100290332 119
16 3300005293 Ga0065715_10051117 Ga0065715_100511172 119
17 3300005329 Ga0070683_100209283 Ga0070683_1002092833 119
18 3300005331 Ga0070670_100249454 Ga0070670_1002494543 119
19 3300005334 Ga0068869_100677404 Ga0068869_1006774042 119
20 3300005335 Ga0070666_10086323 Ga0070666_100863232 119
21 3300005335 Ga0070666_10199374 Ga0070666_101993743 119
22 3300005337 Ga0070682_100280784 Ga0070682_1002807841 119
23 3300005339 Ga0070660_100651698 Ga0070660_1006516982 119
24 3300005339 Ga0070660_101448568 Ga0070660_1014485682 119
25 3300005347 Ga0070668_100638489 Ga0070668_1006384892 119
26 3300005347 Ga0070668_101100588 Ga0070668_1011005881 119
27 3300005366 Ga0070659_100278584 Ga0070659_1002785842 119
28 3300005366 Ga0070659_100803199 Ga0070659_1008031991 119
29 3300005366 Ga0070659_101622400 Ga0070659_1016224001 119
30 3300005437 Ga0070710_10232302 Ga0070710_102323022 119
31 3300005439 Ga0070711_100053525 Ga0070711_1000535253 119
32 3300005440 Ga0070705_100530877 Ga0070705_1005308772 119
33 3300005441 Ga0070700_100721853 Ga0070700_1007218532 119
34 3300005455 Ga0070663_100416212 Ga0070663_1004162123 119
35 3300005456 Ga0070678_100035694 Ga0070678_1000356943 119
36 3300005456 Ga0070678_100053800 Ga0070678_1000538003 119
37 3300005456 Ga0070678_100230919 Ga0070678_1002309191 119
38 3300005457 Ga0070662_100277825 Ga0070662_1002778252 119
39 3300005457 Ga0070662_100386341 Ga0070662_1003863412 119
40 3300005458 Ga0070681_10376199 Ga0070681_103761993 119
41 3300005471 Ga0070698_100028937 Ga0070698_1000289377 119
42 3300005535 Ga0070684_100146921 Ga0070684_1001469212 119
43 3300005536 Ga0070697_100403419 Ga0070697_1004034192 119
44 3300005536 Ga0070697_100537318 Ga0070697_1005373181 119
45 3300005543 Ga0070672_100050369 Ga0070672_1000503691 119
46 3300005544 Ga0070686_101787020 Ga0070686_1017870202 119
47 3300005548 Ga0070665_100028176 Ga0070665_1000281765 119
48 3300005549 Ga0070704_100672905 Ga0070704_1006729051 119
49 3300005564 Ga0070664_100001608 Ga0070664_10000160817 119
50 3300005577 Ga0068857_100002047 Ga0068857_10000204717 119
51 3300005578 Ga0068854_101355729 Ga0068854_1013557292 119
52 3300005615 Ga0070702_100252333 Ga0070702_1002523332 119
53 3300005618 Ga0068864_100000091 Ga0068864_10000009171 119
54 3300005618 Ga0068864_101097551 Ga0068864_1010975512 119
55 3300005719 Ga0068861_100371434 Ga0068861_1003714342 119
56 3300005841 Ga0068863_100019604 Ga0068863_1000196044 119
57 3300005843 Ga0068860_100102391 Ga0068860_1001023915 119
58 3300005843 Ga0068860_101093351 Ga0068860_1010933512 119
59 3300005844 Ga0068862_100773799 Ga0068862_1007737992 119
60 3300005844 Ga0068862_101166522 Ga0068862_1011665222 119
61 3300006195 Ga0075366_10304867 Ga0075366_103048672 119
62 3300006237 Ga0097621_100350403 Ga0097621_1003504033 119
63 3300006358 Ga0068871_100151843 Ga0068871_1001518432 119
64 3300006844 Ga0075428_100000605 Ga0075428_10000060511 119
65 3300006844 Ga0075428_100004318 Ga0075428_10000431810 119
66 3300006847 Ga0075431_100265128 Ga0075431_1002651285 119
67 3300006847 Ga0075431_100408337 Ga0075431_1004083372 119
68 3300006847 Ga0075431_100752683 Ga0075431_1007526832 119
69 3300006871 Ga0075434_101269997 Ga0075434_1012699972 119
70 3300006880 Ga0075429_100607856 Ga0075429_1006078562 119
71 3300006881 Ga0068865_100623939 Ga0068865_1006239392 119
72 3300006881 Ga0068865_100747641 Ga0068865_1007476412 119
73 3300006914 Ga0075436_100036106 Ga0075436_1000361063 119
74 3300007076 Ga0075435_100869789 Ga0075435_1008697892 119
75 3300009093 Ga0105240_11535479 Ga0105240_115354792 119
76 3300009094 Ga0111539_10049546 Ga0111539_100495464 119
77 3300009094 Ga0111539_10495223 Ga0111539_104952232 119
78 3300009098 Ga0105245_10427589 Ga0105245_104275891 119
79 3300009147 Ga0114129_10000929 Ga0114129_1000092931 119
80 3300009148 Ga0105243_11456440 Ga0105243_114564401 119
81 3300009174 Ga0105241_10312598 Ga0105241_103125983 119
82 3300009174 Ga0105241_11465954 Ga0105241_114659542 119
83 3300009176 Ga0105242_10520722 Ga0105242_105207222 119
84 3300009177 Ga0105248_10104803 Ga0105248_101048036 119
85 3300009177 Ga0105248_13236600 Ga0105248_132366001 119
86 3300009545 Ga0105237_11490578 Ga0105237_114905781 119
87 3300009551 Ga0105238_10260209 Ga0105238_102602093 119
88 3300009551 Ga0105238_10702313 Ga0105238_107023132 119
89 3300009553 Ga0105249_10047246 Ga0105249_100472462 119
90 3300009553 Ga0105249_10615444 Ga0105249_106154441 119
91 3300009553 Ga0105249_11071464 Ga0105249_110714642 119
92 3300010375 Ga0105239_10237687 Ga0105239_102376873 119
93 3300011119 Ga0105246_11490419 Ga0105246_114904191 119
94 3300012507 Ga0157342_1064435 Ga0157342_10644351 119
95 3300013296 Ga0157374_10842269 Ga0157374_108422692 119
96 3300013297 Ga0157378_10072122 Ga0157378_100721221 119
97 3300013297 Ga0157378_10941120 Ga0157378_109411202 119
98 3300013306 Ga0163162_11404263 Ga0163162_114042632 119
99 3300013306 Ga0163162_11497223 Ga0163162_114972232 119
100 3300013308 Ga0157375_10118106 Ga0157375_101181062 119
101 3300014325 Ga0163163_10025346 Ga0163163_100253465 119
102 3300014325 Ga0163163_10518169 Ga0163163_105181692 119
103 3300014325 Ga0163163_11477822 Ga0163163_114778222 119
104 3300014968 Ga0157379_10001284 Ga0157379_100012845 119
105 3300014968 Ga0157379_10123496 Ga0157379_101234963 119
106 3300014969 Ga0157376_11306566 Ga0157376_113065662 119
107 3300014969 Ga0157376_12431613 Ga0157376_124316132 119
108 3300017792 Ga0163161_10108788 Ga0163161_101087883 119
109 3300017792 Ga0163161_10548503 Ga0163161_105485031 119
110 3300021384 Ga0213876_10379512 Ga0213876_103795122 119
111 3300025315 Ga0207697_10030776 Ga0207697_100307764 119
112 3300025903 Ga0207680_10190812 Ga0207680_101908123 119
113 3300025903 Ga0207680_10283436 Ga0207680_102834362 119
114 3300025903 Ga0207680_10370720 Ga0207680_103707201 119
115 3300025908 Ga0207643_11064083 Ga0207643_110640831 119
116 3300025909 Ga0207705_10772590 Ga0207705_107725902 119
117 3300025909 Ga0207705_11157482 Ga0207705_111574822 119
118 3300025911 Ga0207654_10085229 Ga0207654_100852291 119
119 3300025912 Ga0207707_10302440 Ga0207707_103024402 119
120 3300025913 Ga0207695_10138699 Ga0207695_101386993 119
121 3300025913 Ga0207695_10713070 Ga0207695_107130701 119
122 3300025916 Ga0207663_10005083 Ga0207663_100050835 119
123 3300025919 Ga0207657_10299773 Ga0207657_102997733 119
124 3300025923 Ga0207681_10146383 Ga0207681_101463832 119
125 3300025924 Ga0207694_11534435 Ga0207694_115344351 119
126 3300025925 Ga0207650_10242032 Ga0207650_102420322 119
127 3300025926 Ga0207659_11094913 Ga0207659_110949132 119
128 3300025927 Ga0207687_10743355 Ga0207687_107433552 119
129 3300025932 Ga0207690_10402375 Ga0207690_104023753 119
130 3300025932 Ga0207690_10675452 Ga0207690_106754522 119
131 3300025933 Ga0207706_10195647 Ga0207706_101956472 119
132 3300025934 Ga0207686_10478253 Ga0207686_104782532 119
133 3300025936 Ga0207670_10587781 Ga0207670_105877812 119
134 3300025938 Ga0207704_10268495 Ga0207704_102684952 119
135 3300025938 Ga0207704_10302356 Ga0207704_103023562 119
136 3300025938 Ga0207704_10579207 Ga0207704_105792072 119
137 3300025940 Ga0207691_10827583 Ga0207691_108275832 119
138 3300025942 Ga0207689_10134445 Ga0207689_101344452 119
139 3300025945 Ga0207679_10293044 Ga0207679_102930442 119
140 3300025945 Ga0207679_11951366 Ga0207679_119513662 119
141 3300025961 Ga0207712_10284514 Ga0207712_102845142 119
142 3300025961 Ga0207712_10699328 Ga0207712_106993282 119
143 3300025961 Ga0207712_11436348 Ga0207712_114363482 119
144 3300025981 Ga0207640_11693996 Ga0207640_116939961 119
145 3300026035 Ga0207703_11197656 Ga0207703_111976562 119
146 3300026041 Ga0207639_10542301 Ga0207639_105423013 119
147 3300026067 Ga0207678_10151375 Ga0207678_101513753 119
148 3300026067 Ga0207678_10488129 Ga0207678_104881292 119
149 3300026088 Ga0207641_10111216 Ga0207641_101112163 119
150 3300026095 Ga0207676_10000013 Ga0207676_10000013130 119
151 3300026095 Ga0207676_10202424 Ga0207676_102024242 119
152 3300026095 Ga0207676_11202122 Ga0207676_112021222 119
153 3300026116 Ga0207674_10003324 Ga0207674_1000332422 119
154 3300026116 Ga0207674_10557854 Ga0207674_105578542 119
155 3300026121 Ga0207683_10036358 Ga0207683_100363584 119
156 3300026121 Ga0207683_10043721 Ga0207683_100437213 119
157 3300026121 Ga0207683_10139241 Ga0207683_101392414 119
158 3300026142 Ga0207698_10145125 Ga0207698_101451253 119
159 3300026142 Ga0207698_12356613 Ga0207698_123566131 119
160 3300027907 Ga0207428_10177407 Ga0207428_101774072 119
161 3300028379 Ga0268266_10067638 Ga0268266_100676385 119
162 3300028379 Ga0268266_10146215 Ga0268266_101462153 119
163 3300028380 Ga0268265_11606556 Ga0268265_116065561 119
164 3300028381 Ga0268264_10477484 Ga0268264_104774842 119
165 3300028800 Ga0265338_10000006 Ga0265338_10000006109 119
166 3300030521 Ga0307511_10311796 Ga0307511_103117962 119
167 3300030745 Ga0316182_1407811 Ga0316182_14078111 119
168 3300030760 Ga0265762_1147552 Ga0265762_11475521 119
169 3300031238 Ga0265332_10007317 Ga0265332_100073176 119
170 3300031241 Ga0265325_10000007 Ga0265325_10000007109 119
171 3300031249 Ga0265339_10000199 Ga0265339_1000019913 119
172 3300031250 Ga0265331_10024936 Ga0265331_100249362 119
173 3300031507 Ga0307509_10151183 Ga0307509_101511833 119
174 3300031548 Ga0307408_100260513 Ga0307408_1002605132 119
175 3300031595 Ga0265313_10000741 Ga0265313_1000074126 119
176 3300031712 Ga0265342_10022915 Ga0265342_100229154 119
177 3300031995 Ga0307409_101683552 Ga0307409_1016835521 119
178 3300032002 Ga0307416_100349055 Ga0307416_1003490552 119
179 3300032002 Ga0307416_101001183 Ga0307416_1010011832 119
180 3300032126 Ga0307415_100096891 Ga0307415_1000968912 119
181 3300035084 Ga0373928_0204568 Ga0373928_0204568_104_469 119
182 3300036401 Ga0373937_0015435 Ga0373937_0015435_5340_5705 119
183 3300037418 Ga0395900_0759280 Ga0395900_0759280_337_702 119
184 3300037853 Ga0436364_0234011 Ga0436364_0234011_2249_2614 119
185 3300039437 Ga0436365_1466577 Ga0436365_1466577_162_524 119
186 3300041452 Ga0451793_1204802 Ga0451793_1204802_28_393 119
187 3300041511 Ga0451855_1774085 Ga0451855_1774085_37_402 119
188 3300042000 Ga0439437_025100 Ga0439437_025100_343_708 119
189 3300042008 Ga0439450_184445 Ga0439450_184445_29_394 119
190 3300042133 Ga0450896_086811 Ga0450896_086811_85_450 119
191 3300042142 Ga0450905_016502 Ga0450905_016502_20_385 119
192 3300042157 Ga0439458_0098886 Ga0439458_0098886_263_628 119
193 3300042438 Ga0439459_0214953 Ga0439459_0214953_145_510 119
194 3300042439 Ga0439464_0065800 Ga0439464_0065800_353_718 119
195 3300042461 Ga0439460_0025354 Ga0439460_0025354_1000_1365 119
196 3300044712 Ga0453684_0204211 Ga0453684_0204211_297_662 119
197 3300045051 Ga0451576_1022642 Ga0451576_1022642_338_703 119
198 3300046539 Ga0495621_0105579 Ga0495621_0105579_63_437 119
199 3300048905 Ga0496102_0303792 Ga0496102_0303792_281_646 119
200 3300048906 Ga0496103_0915537 Ga0496103_0915537_24_389 119
201 3300048907 Ga0496104_0138117 Ga0496104_0138117_374_739 119
202 3300048907 Ga0496104_0784370 Ga0496104_0784370_305_670 119
203 3300048908 Ga0496105_0548532 Ga0496105_0548532_494_889 119
204 3300048909 Ga0496106_0238741 Ga0496106_0238741_248_613 119
205 3300048910 Ga0496107_0974417 Ga0496107_0974417_192_557 119
206 3300048911 Ga0496108_0066758 Ga0496108_0066758_343_708 119
207 3300048911 Ga0496108_1082489 Ga0496108_1082489_273_638 119
208 3300048912 Ga0496109_0220304 Ga0496109_0220304_449_814 119
209 3300048913 Ga0496110_0260212 Ga0496110_0260212_862_1227 119
210 3300048914 Ga0496111_0229272 Ga0496111_0229272_162_527 119
211 3300048915 Ga0496112_0116086 Ga0496112_0116086_1303_1668 119
212 3300048917 Ga0496114_1371088 Ga0496114_1371088_181_546 119
213 3300048920 Ga0496117_0264533 Ga0496117_0264533_331_696 119
214 3300048921 Ga0496118_0174336 Ga0496118_0174336_368_733 119
215 3300049515 Ga0501292_057211 Ga0501292_057211_66_431 119
216 3300049569 Ga0501032_0004174 Ga0501032_0004174_4218_4583 119
217 3300049570 Ga0501033_0034507 Ga0501033_0034507_270_635 119
218 3300049570 Ga0501033_0961556 Ga0501033_0961556_172_537 119
219 3300049571 Ga0501034_0002379 Ga0501034_0002379_12264_12629 119
220 3300049572 Ga0501036_0092205 Ga0501036_0092205_1935_2300 119
221 3300049572 Ga0501036_0187915 Ga0501036_0187915_1030_1395 119
222 3300049572 Ga0501036_0264768 Ga0501036_0264768_836_1201 119
223 3300049573 Ga0501037_0010726 Ga0501037_0010726_935_1300 119
224 3300049573 Ga0501037_0133240 Ga0501037_0133240_985_1350 119
225 3300049573 Ga0501037_1033654 Ga0501037_1033654_71_436 119
226 3300049574 Ga0501038_0059148 Ga0501038_0059148_567_932 119
227 3300049574 Ga0501038_0123152 Ga0501038_0123152_325_690 119
228 3300049578 Ga0501042_0762260 Ga0501042_0762260_36_401 119
229 3300049579 Ga0501043_0072392 Ga0501043_0072392_1225_1590 119
230 3300049579 Ga0501043_0243036 Ga0501043_0243036_711_1076 119
231 3300049579 Ga0501043_0368594 Ga0501043_0368594_682_1047 119
232 3300049580 Ga0501046_0013161 Ga0501046_0013161_5253_5618 119
233 3300049580 Ga0501046_0378417 Ga0501046_0378417_547_912 119
234 3300049581 Ga0501047_0000315 Ga0501047_0000315_42984_43349 119
235 3300049581 Ga0501047_0002340 Ga0501047_0002340_15574_15939 119
236 3300049581 Ga0501047_0016398 Ga0501047_0016398_1477_1842 119
237 3300049582 Ga0501048_0329834 Ga0501048_0329834_470_835 119
238 3300049583 Ga0501067_0000119 Ga0501067_0000119_11837_12202 119
239 3300049584 Ga0501068_0046569 Ga0501068_0046569_1903_2268 119
240 3300049586 Ga0501070_0004828 Ga0501070_0004828_4095_4460 119
241 3300049587 Ga0501071_0213986 Ga0501071_0213986_279_644 119
242 3300049587 Ga0501071_0662999 Ga0501071_0662999_413_778 119
243 3300049588 Ga0501072_0002403 Ga0501072_0002403_13477_13842 119
244 3300049589 Ga0501073_0002435 Ga0501073_0002435_534_899 119
245 3300049590 Ga0501074_0014434 Ga0501074_0014434_5074_5439 119
246 3300049591 Ga0501075_0035742 Ga0501075_0035742_3322_3687 119
247 3300049591 Ga0501075_0510863 Ga0501075_0510863_105_470 119
248 3300049592 Ga0501076_0176521 Ga0501076_0176521_156_521 119
249 3300049592 Ga0501076_0242195 Ga0501076_0242195_1014_1379 119
250 3300049592 Ga0501076_0949504 Ga0501076_0949504_59_433 119
251 3300049703 Ga0501219_010996 Ga0501219_010996_279_644 119
252 3300049741 Ga0501079_0002546 Ga0501079_0002546_643_1008 119
253 3300049742 Ga0501080_0002008 Ga0501080_0002008_4996_5361 119
254 3300049742 Ga0501080_0157462 Ga0501080_0157462_366_731 119
255 3300049742 Ga0501080_0447173 Ga0501080_0447173_386_751 119
256 3300049742 Ga0501080_0730613 Ga0501080_0730613_16_381 119
257 3300049742 Ga0501080_1038191 Ga0501080_1038191_44_409 119
258 3300049743 Ga0501081_0246309 Ga0501081_0246309_136_501 119
259 3300049743 Ga0501081_0755711 Ga0501081_0755711_248_613 119
260 3300049744 Ga0501083_0000646 Ga0501083_0000646_12069_12434 119
261 3300049744 Ga0501083_0397054 Ga0501083_0397054_13_378 119
262 3300049822 Ga0501035_0028207 Ga0501035_0028207_1669_2034 119
263 3300049822 Ga0501035_0080117 Ga0501035_0080117_936_1301 119
264 3300049822 Ga0501035_0402601 Ga0501035_0402601_48_413 119
265 3300049823 Ga0501044_0000956 Ga0501044_0000956_4365_4730 119
266 3300049823 Ga0501044_0004556 Ga0501044_0004556_8603_8968 119
267 3300049823 Ga0501044_0172355 Ga0501044_0172355_1629_1994 119
268 3300050507 nmdc:mga05p37_13_c1 nmdc:mga05p37_13_c1_86270_86635 119
269 3300050507 nmdc:mga05p37_22605_c1 nmdc:mga05p37_22605_c1_7124_7558 119
270 3300050508 nmdc:mga09592_269151_c1 nmdc:mga09592_269151_c1_274_639 119
271 3300050508 nmdc:mga09592_545387_c1 nmdc:mga09592_545387_c1_207_572 119
272 3300050508 nmdc:mga09592_6180_c1 nmdc:mga09592_6180_c1_9333_9698 119
273 3300050509 nmdc:mga0qj67_33657_c1 nmdc:mga0qj67_33657_c1_1572_1937 119
274 3300050510 nmdc:mga06r32_4901_c1 nmdc:mga06r32_4901_c1_641_1006 119
275 3300050510 nmdc:mga06r32_73640_c1 nmdc:mga06r32_73640_c1_2791_3156 119
276 3300050511 nmdc:mga08y16_67235_c1 nmdc:mga08y16_67235_c1_1042_1491 119
277 3300050511 nmdc:mga08y16_9713_c1 nmdc:mga08y16_9713_c1_8707_9141 119
278 3300050512 nmdc:mga0n895_64627_c1 nmdc:mga0n895_64627_c1_3120_3485 119
279 3300050514 nmdc:mga08x19_10374_c1 nmdc:mga08x19_10374_c1_4420_4785 119
280 3300050514 nmdc:mga08x19_52245_c1 nmdc:mga08x19_52245_c1_768_1133 119
281 3300050515 nmdc:mga0a205_498632_c1 nmdc:mga0a205_498632_c1_40_405 119
282 3300053093 Ga0500651_0293120 Ga0500651_0293120_213_578 119
283 3300053103 Ga0500555_039926 Ga0500555_039926_694_1059 119
284 3300053116 Ga0500592_020418 Ga0500592_020418_546_911 119
285 3300053119 Ga0500595_008648 Ga0500595_008648_645_1010 119
286 3300053154 Ga0500619_001037 Ga0500619_001037_3873_4238 119
287 3300053730 Ga0500645_000154 Ga0500645_000154_34671_35036 119
288 3300054114 Ga0501084_0445310 Ga0501084_0445310_26_409 119
289 3300054114 Ga0501084_0530348 Ga0501084_0530348_620_985 119
290 3300054114 Ga0501084_0582812 Ga0501084_0582812_28_393 119
291 3300059421 Ga0590071_000843 Ga0590071_000843_7945_8310 119
292 3300059423 Ga0590074_007441 Ga0590074_007441_247_612 119
293 3300059424 Ga0590075_000790 Ga0590075_000790_7649_8014 119
294 3300060353 Ga0501082_0005653 Ga0501082_0005653_5865_6230 119
295 3300060353 Ga0501082_0293512 Ga0501082_0293512_219_584 119
296 3300061734 Ga0530510_0341320 Ga0530510_0341320_522_887 119
297 3300061734 Ga0530510_0711833 Ga0530510_0711833_166_531 119
298 3300061734 Ga0530510_1267383 Ga0530510_1267383_92_457 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

44

93

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

45

91

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9479 7 87
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9471 7 80
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9441 6 80
1u2w-assembly2.cif.gz_C crystal structure of the staphylococcus aureus pi258 cadc 0.9363 7 76
6ghb-assembly1.cif.gz_B crystal structure of spx in complex with yjbh (oxidized) 0.936 25 75
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9745 20 75 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9624 20 65 1.10.10.10
3bddD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9593 18 63 1.10.10.10
af_Q54FU1_288_364_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9553 18 77 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9455 18 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1I0D8A9-F1-model_v4 Transcriptional regulator, ArsR family 0.981 7 89 GO:0003700
GO:0046685
AF-A0A1N6DJH9-F1-model_v4 Transcriptional regulator, ArsR family 0.9806 7 78 GO:0003700
AF-A0A0G3W9J0-F1-model_v4 Transcriptional regulator ArsR family 0.9779 7 89 GO:0003700
GO:0046685
AF-G8QYJ0-F1-model_v4 Putative transcriptional regulator 0.9767 7 89 GO:0003700
AF-A0A6G1SU58-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.975 10 92 GO:0003700

Feature Viewer

pLDDT pTM Quality
89.37 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map