F394231
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 203 | 298 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10495223|Ga0111539_104952232 |
| Length | 149 |
| Sequence | MGLDGRIAFHDRRTKRRGRNAVCYILNHMVQYLRTRFDAAFAALSDATRRGVLEQLGRADASITDLADKFHMTLTGMKKHVGVLEQAGLVTTEKVGRVRTCKLGLRRLDEEAAWIERHRQLWAARFDELDQVVEELKRKEKVDGRKKRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 111 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 112 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 118 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 129 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 130 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 131 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 132 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 133 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 134 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 135 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 136 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 137 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 138 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 139 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 143 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 144 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 148 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 151 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 155 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 156 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 157 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 178 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 193 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 194 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 195 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 196 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 197 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 198 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 200 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 201 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 202 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.35 |
| Nodule | 0 |
| Rhizoplane | 5.03 |
| Rhizosphere | 89.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10110883 | 3300003320 | Bacteria | 1384 |
| 2 | Ga0065715_10029033 | 3300005293 | Bacteria | 1465 |
| 3 | Ga0065715_10051117 | 3300005293 | Bacteria | 1066 |
| 4 | Ga0070658_10496559 | 3300005327 | Bacteria | 1054 |
| 5 | Ga0070683_100209283 | 3300005329 | Bacteria | 1852 |
| 6 | Ga0070670_100249454 | 3300005331 | Bacteria | 1546 |
| 7 | Ga0068869_100677404 | 3300005334 | Bacteria | 878 |
| 8 | Ga0070666_10086323 | 3300005335 | Bacteria | 2150 |
| 9 | Ga0070666_10199374 | 3300005335 | Bacteria | 1408 |
| 10 | Ga0070682_100280784 | 3300005337 | Bacteria | 1214 |
| 11 | Ga0070660_100651698 | 3300005339 | Bacteria | 882 |
| 12 | Ga0070660_101448568 | 3300005339 | Bacteria | 584 |
| 13 | Ga0070668_100638489 | 3300005347 | Bacteria | 934 |
| 14 | Ga0070668_101100588 | 3300005347 | Bacteria | 717 |
| 15 | Ga0070675_100093564 | 3300005354 | Bacteria | 2521 |
| 16 | Ga0070673_100598320 | 3300005364 | Bacteria | 1006 |
| 17 | Ga0070659_100278584 | 3300005366 | Bacteria | 1391 |
| 18 | Ga0070659_100803199 | 3300005366 | Bacteria | 818 |
| 19 | Ga0070659_101622400 | 3300005366 | Bacteria | 578 |
| 20 | Ga0070667_100292344 | 3300005367 | Bacteria | 1465 |
| 21 | Ga0070710_10232302 | 3300005437 | Bacteria | 1178 |
| 22 | Ga0070711_100053525 | 3300005439 | Bacteria | 2782 |
| 23 | Ga0070705_100530877 | 3300005440 | Bacteria | 899 |
| 24 | Ga0070700_100721853 | 3300005441 | Bacteria | 794 |
| 25 | Ga0070663_100416212 | 3300005455 | Bacteria | 1102 |
| 26 | Ga0070678_100035694 | 3300005456 | Bacteria | 3474 |
| 27 | Ga0070678_100053800 | 3300005456 | Bacteria | 2930 |
| 28 | Ga0070678_100230919 | 3300005456 | Bacteria | 1542 |
| 29 | Ga0070662_100277825 | 3300005457 | Bacteria | 1355 |
| 30 | Ga0070662_100386341 | 3300005457 | Bacteria | 1153 |
| 31 | Ga0070681_10376199 | 3300005458 | Bacteria | 1331 |
| 32 | Ga0070698_100028937 | 3300005471 | Bacteria | 5752 |
| 33 | Ga0070684_100146921 | 3300005535 | Bacteria | 2134 |
| 34 | Ga0070697_100403419 | 3300005536 | Bacteria | 1186 |
| 35 | Ga0070697_100537318 | 3300005536 | Bacteria | 1024 |
| 36 | Ga0070672_100001616 | 3300005543 | Bacteria | 14012 |
| 37 | Ga0070672_100050369 | 3300005543 | Bacteria | 3242 |
| 38 | Ga0070686_101787020 | 3300005544 | Bacteria | 523 |
| 39 | Ga0070665_100028176 | 3300005548 | Bacteria | 5657 |
| 40 | Ga0070704_100672905 | 3300005549 | Bacteria | 915 |
| 41 | Ga0070704_101215907 | 3300005549 | Bacteria | 687 |
| 42 | Ga0070664_100001608 | 3300005564 | Bacteria | 18074 |
| 43 | Ga0070664_100282294 | 3300005564 | Bacteria | 1497 |
| 44 | Ga0068857_100002047 | 3300005577 | Bacteria | 16365 |
| 45 | Ga0068854_101355729 | 3300005578 | Bacteria | 642 |
| 46 | Ga0070702_100252333 | 3300005615 | Bacteria | 1196 |
| 47 | Ga0068852_100384425 | 3300005616 | Bacteria | 1377 |
| 48 | Ga0068864_100000091 | 3300005618 | Bacteria | 96169 |
| 49 | Ga0068864_101097551 | 3300005618 | Bacteria | 792 |
| 50 | Ga0068861_100371434 | 3300005719 | Bacteria | 1261 |
| 51 | Ga0068863_100019604 | 3300005841 | Bacteria | 6470 |
| 52 | Ga0068863_100352496 | 3300005841 | Bacteria | 1433 |
| 53 | Ga0068860_100102391 | 3300005843 | Bacteria | 2732 |
| 54 | Ga0068860_101093351 | 3300005843 | Bacteria | 817 |
| 55 | Ga0068862_100773799 | 3300005844 | Bacteria | 935 |
| 56 | Ga0068862_101166522 | 3300005844 | Bacteria | 768 |
| 57 | Ga0075366_10304867 | 3300006195 | Bacteria | 974 |
| 58 | Ga0097621_100299226 | 3300006237 | Bacteria | 1420 |
| 59 | Ga0097621_100350403 | 3300006237 | Bacteria | 1313 |
| 60 | Ga0068871_100151843 | 3300006358 | Bacteria | 1976 |
| 61 | Ga0075428_100000605 | 3300006844 | Bacteria | 36581 |
| 62 | Ga0075428_100004318 | 3300006844 | Bacteria | 15660 |
| 63 | Ga0075431_100265128 | 3300006847 | Bacteria | 1742 |
| 64 | Ga0075431_100408337 | 3300006847 | Bacteria | 1358 |
| 65 | Ga0075431_100752683 | 3300006847 | Bacteria | 950 |
| 66 | Ga0075434_101269997 | 3300006871 | Bacteria | 747 |
| 67 | Ga0075429_100607856 | 3300006880 | Bacteria | 958 |
| 68 | Ga0068865_100623939 | 3300006881 | Bacteria | 913 |
| 69 | Ga0068865_100747641 | 3300006881 | Bacteria | 839 |
| 70 | Ga0075436_100036106 | 3300006914 | Bacteria | 3410 |
| 71 | Ga0075435_100869789 | 3300007076 | Bacteria | 786 |
| 72 | Ga0105240_11535479 | 3300009093 | Bacteria | 698 |
| 73 | Ga0111539_10049546 | 3300009094 | Bacteria | 5007 |
| 74 | Ga0111539_10495223 | 3300009094 | Bacteria | 1423 |
| 75 | Ga0105245_10427589 | 3300009098 | Bacteria | 1328 |
| 76 | Ga0114129_10000929 | 3300009147 | Bacteria | 38252 |
| 77 | Ga0105243_11456440 | 3300009148 | Bacteria | 707 |
| 78 | Ga0105241_10312598 | 3300009174 | Bacteria | 1352 |
| 79 | Ga0105241_11465954 | 3300009174 | Bacteria | 656 |
| 80 | Ga0105242_10520722 | 3300009176 | Bacteria | 1134 |
| 81 | Ga0105248_10104803 | 3300009177 | Bacteria | 3188 |
| 82 | Ga0105248_13236600 | 3300009177 | Bacteria | 518 |
| 83 | Ga0105237_11490578 | 3300009545 | Bacteria | 683 |
| 84 | Ga0105238_10260209 | 3300009551 | Bacteria | 1714 |
| 85 | Ga0105238_10702313 | 3300009551 | Bacteria | 1023 |
| 86 | Ga0105249_10047246 | 3300009553 | Bacteria | 3922 |
| 87 | Ga0105249_10615444 | 3300009553 | Bacteria | 1142 |
| 88 | Ga0105249_11071464 | 3300009553 | Bacteria | 876 |
| 89 | Ga0105239_10237687 | 3300010375 | Bacteria | 2045 |
| 90 | Ga0105246_11490419 | 3300011119 | Bacteria | 635 |
| 91 | Ga0157342_1064435 | 3300012507 | Bacteria | 545 |
| 92 | Ga0157374_10158256 | 3300013296 | Bacteria | 2206 |
| 93 | Ga0157374_10842269 | 3300013296 | Bacteria | 934 |
| 94 | Ga0157378_10072122 | 3300013297 | Bacteria | 3103 |
| 95 | Ga0157378_10941120 | 3300013297 | Bacteria | 896 |
| 96 | Ga0163162_11404263 | 3300013306 | Bacteria | 794 |
| 97 | Ga0163162_11497223 | 3300013306 | Bacteria | 769 |
| 98 | Ga0157375_10118106 | 3300013308 | Bacteria | 2758 |
| 99 | Ga0157375_10181613 | 3300013308 | Bacteria | 2255 |
| 100 | Ga0163163_10025346 | 3300014325 | Bacteria | 5654 |
| 101 | Ga0163163_10518169 | 3300014325 | Bacteria | 1255 |
| 102 | Ga0163163_11477822 | 3300014325 | Bacteria | 741 |
| 103 | Ga0157379_10001284 | 3300014968 | Bacteria | 20438 |
| 104 | Ga0157379_10123496 | 3300014968 | Bacteria | 2330 |
| 105 | Ga0157376_11306566 | 3300014969 | Bacteria | 755 |
| 106 | Ga0157376_12431613 | 3300014969 | Bacteria | 563 |
| 107 | Ga0163161_10108788 | 3300017792 | Bacteria | 2070 |
| 108 | Ga0163161_10548503 | 3300017792 | Bacteria | 947 |
| 109 | Ga0213876_10379512 | 3300021384 | Bacteria | 752 |
| 110 | Ga0207697_10030776 | 3300025315 | Bacteria | 2196 |
| 111 | Ga0207680_10190812 | 3300025903 | Bacteria | 1391 |
| 112 | Ga0207680_10283436 | 3300025903 | Bacteria | 1152 |
| 113 | Ga0207680_10370720 | 3300025903 | Bacteria | 1008 |
| 114 | Ga0207643_11064083 | 3300025908 | Bacteria | 522 |
| 115 | Ga0207705_10772590 | 3300025909 | Bacteria | 746 |
| 116 | Ga0207705_11157482 | 3300025909 | Bacteria | 594 |
| 117 | Ga0207654_10085229 | 3300025911 | Bacteria | 1912 |
| 118 | Ga0207707_10302440 | 3300025912 | Bacteria | 1383 |
| 119 | Ga0207695_10138699 | 3300025913 | Bacteria | 2383 |
| 120 | Ga0207695_10713070 | 3300025913 | Bacteria | 884 |
| 121 | Ga0207663_10005083 | 3300025916 | Bacteria | 6605 |
| 122 | Ga0207657_10299773 | 3300025919 | Bacteria | 1273 |
| 123 | Ga0207681_10146383 | 3300025923 | Bacteria | 1765 |
| 124 | Ga0207694_11534435 | 3300025924 | Bacteria | 562 |
| 125 | Ga0207650_10242032 | 3300025925 | Bacteria | 1458 |
| 126 | Ga0207659_11094913 | 3300025926 | Bacteria | 685 |
| 127 | Ga0207687_10743355 | 3300025927 | Bacteria | 834 |
| 128 | Ga0207690_10402375 | 3300025932 | Bacteria | 1092 |
| 129 | Ga0207690_10675452 | 3300025932 | Bacteria | 848 |
| 130 | Ga0207706_10195647 | 3300025933 | Bacteria | 1774 |
| 131 | Ga0207686_10478253 | 3300025934 | Bacteria | 963 |
| 132 | Ga0207670_10587781 | 3300025936 | Bacteria | 913 |
| 133 | Ga0207704_10268495 | 3300025938 | Bacteria | 1290 |
| 134 | Ga0207704_10302356 | 3300025938 | Bacteria | 1226 |
| 135 | Ga0207704_10579207 | 3300025938 | Bacteria | 916 |
| 136 | Ga0207691_10827583 | 3300025940 | Bacteria | 777 |
| 137 | Ga0207689_10134445 | 3300025942 | Bacteria | 2036 |
| 138 | Ga0207679_10293044 | 3300025945 | Bacteria | 1399 |
| 139 | Ga0207679_11951366 | 3300025945 | Bacteria | 535 |
| 140 | Ga0207712_10284514 | 3300025961 | Bacteria | 1351 |
| 141 | Ga0207712_10699328 | 3300025961 | Bacteria | 885 |
| 142 | Ga0207712_11436348 | 3300025961 | Bacteria | 617 |
| 143 | Ga0207640_11693996 | 3300025981 | Bacteria | 571 |
| 144 | Ga0207703_11197656 | 3300026035 | Unclassified | 730 |
| 145 | Ga0207639_10542301 | 3300026041 | Bacteria | 1067 |
| 146 | Ga0207678_10151375 | 3300026067 | Bacteria | 1981 |
| 147 | Ga0207678_10488129 | 3300026067 | Bacteria | 1073 |
| 148 | Ga0207641_10111216 | 3300026088 | Bacteria | 2429 |
| 149 | Ga0207676_10000013 | 3300026095 | Bacteria | 343067 |
| 150 | Ga0207676_10202424 | 3300026095 | Bacteria | 1755 |
| 151 | Ga0207676_11202122 | 3300026095 | Bacteria | 751 |
| 152 | Ga0207674_10003324 | 3300026116 | Bacteria | 19774 |
| 153 | Ga0207674_10557854 | 3300026116 | Bacteria | 1106 |
| 154 | Ga0207683_10036358 | 3300026121 | Bacteria | 4288 |
| 155 | Ga0207683_10043721 | 3300026121 | Bacteria | 3915 |
| 156 | Ga0207683_10139241 | 3300026121 | Bacteria | 2186 |
| 157 | Ga0207698_10145125 | 3300026142 | Bacteria | 2051 |
| 158 | Ga0207698_12356613 | 3300026142 | Bacteria | 544 |
| 159 | Ga0207428_10177407 | 3300027907 | Bacteria | 1611 |
| 160 | Ga0268266_10067638 | 3300028379 | Bacteria | 3092 |
| 161 | Ga0268266_10146215 | 3300028379 | Bacteria | 2125 |
| 162 | Ga0268265_11606556 | 3300028380 | Bacteria | 655 |
| 163 | Ga0268264_10477484 | 3300028381 | Bacteria | 1212 |
| 164 | Ga0265338_10000006 | 3300028800 | Bacteria | 570804 |
| 165 | Ga0307511_10311796 | 3300030521 | Bacteria | 702 |
| 166 | Ga0316182_1407811 | 3300030745 | Bacteria | 871 |
| 167 | Ga0265762_1147552 | 3300030760 | Bacteria | 558 |
| 168 | Ga0265332_10007317 | 3300031238 | Bacteria | 4992 |
| 169 | Ga0265325_10000007 | 3300031241 | Bacteria | 208874 |
| 170 | Ga0265339_10000199 | 3300031249 | Bacteria | 49797 |
| 171 | Ga0265331_10024936 | 3300031250 | Bacteria | 3020 |
| 172 | Ga0307509_10151183 | 3300031507 | Bacteria | 2236 |
| 173 | Ga0307408_100260513 | 3300031548 | Bacteria | 1435 |
| 174 | Ga0265313_10000741 | 3300031595 | Bacteria | 33487 |
| 175 | Ga0265342_10022915 | 3300031712 | Bacteria | 3962 |
| 176 | Ga0307409_101683552 | 3300031995 | Bacteria | 663 |
| 177 | Ga0307416_100349055 | 3300032002 | Bacteria | 1496 |
| 178 | Ga0307416_101001183 | 3300032002 | Bacteria | 939 |
| 179 | Ga0307415_100096891 | 3300032126 | Bacteria | 2151 |
| 180 | Ga0373928_0204568 | 3300035084 | Bacteria | 571 |
| 181 | Ga0373937_0015435 | 3300036401 | Bacteria | 6752 |
| 182 | Ga0395900_0759280 | 3300037418 | Bacteria | 900 |
| 183 | Ga0436364_0234011 | 3300037853 | Bacteria | 3833 |
| 184 | Ga0436365_1466577 | 3300039437 | Bacteria | 1104 |
| 185 | Ga0451793_1204802 | 3300041452 | Bacteria | 592 |
| 186 | Ga0451855_1774085 | 3300041511 | Bacteria | 564 |
| 187 | Ga0439437_025100 | 3300042000 | Bacteria | 733 |
| 188 | Ga0439450_184445 | 3300042008 | Bacteria | 555 |
| 189 | Ga0450896_086811 | 3300042133 | Bacteria | 531 |
| 190 | Ga0450905_016502 | 3300042142 | Bacteria | 1066 |
| 191 | Ga0439458_0098886 | 3300042157 | Bacteria | 756 |
| 192 | Ga0439459_0214953 | 3300042438 | Bacteria | 530 |
| 193 | Ga0439464_0065800 | 3300042439 | Bacteria | 1066 |
| 194 | Ga0439460_0025354 | 3300042461 | Bacteria | 1650 |
| 195 | Ga0453684_0204211 | 3300044712 | Bacteria | 2301 |
| 196 | Ga0451576_1022642 | 3300045051 | Bacteria | 866 |
| 197 | Ga0495621_0105579 | 3300046539 | Bacteria | 1076 |
| 198 | Ga0496102_0303792 | 3300048905 | Bacteria | 1504 |
| 199 | Ga0496103_0915537 | 3300048906 | Bacteria | 549 |
| 200 | Ga0496104_0138117 | 3300048907 | Bacteria | 2342 |
| 201 | Ga0496104_0784370 | 3300048907 | Bacteria | 859 |
| 202 | Ga0496105_0548532 | 3300048908 | Bacteria | 902 |
| 203 | Ga0496106_0238741 | 3300048909 | Bacteria | 1452 |
| 204 | Ga0496107_0974417 | 3300048910 | Bacteria | 616 |
| 205 | Ga0496108_0066758 | 3300048911 | Bacteria | 3034 |
| 206 | Ga0496108_1082489 | 3300048911 | Bacteria | 682 |
| 207 | Ga0496109_0220304 | 3300048912 | Bacteria | 1784 |
| 208 | Ga0496110_0260212 | 3300048913 | Bacteria | 1579 |
| 209 | Ga0496111_0229272 | 3300048914 | Bacteria | 1380 |
| 210 | Ga0496112_0116086 | 3300048915 | Bacteria | 2647 |
| 211 | Ga0496114_1371088 | 3300048917 | Bacteria | 594 |
| 212 | Ga0496117_0264533 | 3300048920 | Bacteria | 930 |
| 213 | Ga0496118_0174336 | 3300048921 | Bacteria | 1309 |
| 214 | Ga0501292_057211 | 3300049515 | Bacteria | 701 |
| 215 | Ga0501032_0004174 | 3300049569 | Bacteria | 10946 |
| 216 | Ga0501033_0034507 | 3300049570 | Bacteria | 3794 |
| 217 | Ga0501033_0961556 | 3300049570 | Bacteria | 572 |
| 218 | Ga0501034_0002379 | 3300049571 | Bacteria | 22851 |
| 219 | Ga0501036_0092205 | 3300049572 | Bacteria | 2559 |
| 220 | Ga0501036_0187915 | 3300049572 | Bacteria | 1739 |
| 221 | Ga0501036_0221222 | 3300049572 | Bacteria | 1590 |
| 222 | Ga0501036_0264768 | 3300049572 | Bacteria | 1440 |
| 223 | Ga0501037_0010726 | 3300049573 | Bacteria | 6734 |
| 224 | Ga0501037_0133240 | 3300049573 | Bacteria | 1781 |
| 225 | Ga0501037_1033654 | 3300049573 | Bacteria | 534 |
| 226 | Ga0501038_0059148 | 3300049574 | Bacteria | 3283 |
| 227 | Ga0501038_0123152 | 3300049574 | Bacteria | 2136 |
| 228 | Ga0501042_0762260 | 3300049578 | Bacteria | 704 |
| 229 | Ga0501043_0072392 | 3300049579 | Bacteria | 2707 |
| 230 | Ga0501043_0243036 | 3300049579 | Bacteria | 1388 |
| 231 | Ga0501043_0368594 | 3300049579 | Bacteria | 1089 |
| 232 | Ga0501046_0013161 | 3300049580 | Bacteria | 7020 |
| 233 | Ga0501046_0378417 | 3300049580 | Bacteria | 1025 |
| 234 | Ga0501047_0000315 | 3300049581 | Bacteria | 55857 |
| 235 | Ga0501047_0002340 | 3300049581 | Bacteria | 18119 |
| 236 | Ga0501047_0016398 | 3300049581 | Bacteria | 7072 |
| 237 | Ga0501048_0329834 | 3300049582 | Bacteria | 1087 |
| 238 | Ga0501067_0000119 | 3300049583 | Bacteria | 43944 |
| 239 | Ga0501068_0046569 | 3300049584 | Bacteria | 2615 |
| 240 | Ga0501070_0004828 | 3300049586 | Bacteria | 11520 |
| 241 | Ga0501071_0213986 | 3300049587 | Unclassified | 1450 |
| 242 | Ga0501071_0662999 | 3300049587 | Bacteria | 803 |
| 243 | Ga0501072_0002403 | 3300049588 | Bacteria | 14040 |
| 244 | Ga0501073_0002435 | 3300049589 | Bacteria | 13916 |
| 245 | Ga0501074_0014434 | 3300049590 | Bacteria | 5748 |
| 246 | Ga0501075_0035742 | 3300049591 | Bacteria | 3707 |
| 247 | Ga0501075_0510863 | 3300049591 | Bacteria | 917 |
| 248 | Ga0501076_0176521 | 3300049592 | Bacteria | 1741 |
| 249 | Ga0501076_0242195 | 3300049592 | Bacteria | 1476 |
| 250 | Ga0501076_0949504 | 3300049592 | Bacteria | 709 |
| 251 | Ga0501219_010996 | 3300049703 | Bacteria | 686 |
| 252 | Ga0501079_0002546 | 3300049741 | Bacteria | 13238 |
| 253 | Ga0501080_0002008 | 3300049742 | Bacteria | 17577 |
| 254 | Ga0501080_0157462 | 3300049742 | Bacteria | 2098 |
| 255 | Ga0501080_0447173 | 3300049742 | Bacteria | 1159 |
| 256 | Ga0501080_0730613 | 3300049742 | Bacteria | 872 |
| 257 | Ga0501080_1038191 | 3300049742 | Bacteria | 710 |
| 258 | Ga0501081_0246309 | 3300049743 | Bacteria | 1304 |
| 259 | Ga0501081_0755711 | 3300049743 | Bacteria | 731 |
| 260 | Ga0501083_0000646 | 3300049744 | Bacteria | 22541 |
| 261 | Ga0501083_0397054 | 3300049744 | Bacteria | 897 |
| 262 | Ga0501035_0028207 | 3300049822 | Bacteria | 5124 |
| 263 | Ga0501035_0080117 | 3300049822 | Bacteria | 2884 |
| 264 | Ga0501035_0402601 | 3300049822 | Bacteria | 1138 |
| 265 | Ga0501044_0000956 | 3300049823 | Bacteria | 34699 |
| 266 | Ga0501044_0004556 | 3300049823 | Bacteria | 15500 |
| 267 | Ga0501044_0172355 | 3300049823 | Bacteria | 2134 |
| 268 | nmdc:mga05p37_13_c1 | 3300050507 | Bacteria | 139062 |
| 269 | nmdc:mga05p37_22605_c1 | 3300050507 | Bacteria | 7626 |
| 270 | nmdc:mga09592_269151_c1 | 3300050508 | Bacteria | 1478 |
| 271 | nmdc:mga09592_545387_c1 | 3300050508 | Bacteria | 996 |
| 272 | nmdc:mga09592_6180_c1 | 3300050508 | Bacteria | 9748 |
| 273 | nmdc:mga0qj67_33657_c1 | 3300050509 | Bacteria | 3999 |
| 274 | nmdc:mga06r32_4901_c1 | 3300050510 | Bacteria | 12057 |
| 275 | nmdc:mga06r32_73640_c1 | 3300050510 | Bacteria | 3309 |
| 276 | nmdc:mga08y16_67235_c1 | 3300050511 | Bacteria | 3739 |
| 277 | nmdc:mga08y16_9713_c1 | 3300050511 | Bacteria | 10101 |
| 278 | nmdc:mga0n895_64627_c1 | 3300050512 | Bacteria | 3620 |
| 279 | nmdc:mga08x19_10374_c1 | 3300050514 | Bacteria | 5592 |
| 280 | nmdc:mga08x19_52245_c1 | 3300050514 | Bacteria | 2628 |
| 281 | nmdc:mga0a205_498632_c1 | 3300050515 | Bacteria | 1075 |
| 282 | Ga0500651_0293120 | 3300053093 | Bacteria | 935 |
| 283 | Ga0500555_039926 | 3300053103 | Bacteria | 1309 |
| 284 | Ga0500592_020418 | 3300053116 | Bacteria | 1066 |
| 285 | Ga0500595_008648 | 3300053119 | Bacteria | 4153 |
| 286 | Ga0500619_001037 | 3300053154 | Bacteria | 4808 |
| 287 | Ga0500645_000154 | 3300053730 | Bacteria | 53453 |
| 288 | Ga0501084_0445310 | 3300054114 | Unclassified | 1095 |
| 289 | Ga0501084_0530348 | 3300054114 | Bacteria | 995 |
| 290 | Ga0501084_0582812 | 3300054114 | Bacteria | 945 |
| 291 | Ga0590071_000843 | 3300059421 | Bacteria | 8545 |
| 292 | Ga0590074_007441 | 3300059423 | Bacteria | 1821 |
| 293 | Ga0590075_000790 | 3300059424 | Bacteria | 8354 |
| 294 | Ga0501082_0005653 | 3300060353 | Bacteria | 10848 |
| 295 | Ga0501082_0293512 | 3300060353 | Bacteria | 1416 |
| 296 | Ga0530510_0341320 | 3300061734 | Bacteria | 1124 |
| 297 | Ga0530510_0711833 | 3300061734 | Bacteria | 765 |
| 298 | Ga0530510_1267383 | 3300061734 | Bacteria | 565 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049572 | Ga0501036_0221222 | Ga0501036_0221222_47_409 | 113 |
| 2 | 3300005327 | Ga0070658_10496559 | Ga0070658_104965591 | 118 |
| 3 | 3300005354 | Ga0070675_100093564 | Ga0070675_1000935643 | 118 |
| 4 | 3300005364 | Ga0070673_100598320 | Ga0070673_1005983202 | 118 |
| 5 | 3300005367 | Ga0070667_100292344 | Ga0070667_1002923443 | 118 |
| 6 | 3300005543 | Ga0070672_100001616 | Ga0070672_10000161613 | 118 |
| 7 | 3300005549 | Ga0070704_101215907 | Ga0070704_1012159071 | 118 |
| 8 | 3300005564 | Ga0070664_100282294 | Ga0070664_1002822942 | 118 |
| 9 | 3300005616 | Ga0068852_100384425 | Ga0068852_1003844251 | 118 |
| 10 | 3300005841 | Ga0068863_100352496 | Ga0068863_1003524963 | 118 |
| 11 | 3300006237 | Ga0097621_100299226 | Ga0097621_1002992262 | 118 |
| 12 | 3300013296 | Ga0157374_10158256 | Ga0157374_101582563 | 118 |
| 13 | 3300013308 | Ga0157375_10181613 | Ga0157375_101816132 | 118 |
| 14 | 3300003320 | rootH2_10110883 | rootH2_101108832 | 119 |
| 15 | 3300005293 | Ga0065715_10029033 | Ga0065715_100290332 | 119 |
| 16 | 3300005293 | Ga0065715_10051117 | Ga0065715_100511172 | 119 |
| 17 | 3300005329 | Ga0070683_100209283 | Ga0070683_1002092833 | 119 |
| 18 | 3300005331 | Ga0070670_100249454 | Ga0070670_1002494543 | 119 |
| 19 | 3300005334 | Ga0068869_100677404 | Ga0068869_1006774042 | 119 |
| 20 | 3300005335 | Ga0070666_10086323 | Ga0070666_100863232 | 119 |
| 21 | 3300005335 | Ga0070666_10199374 | Ga0070666_101993743 | 119 |
| 22 | 3300005337 | Ga0070682_100280784 | Ga0070682_1002807841 | 119 |
| 23 | 3300005339 | Ga0070660_100651698 | Ga0070660_1006516982 | 119 |
| 24 | 3300005339 | Ga0070660_101448568 | Ga0070660_1014485682 | 119 |
| 25 | 3300005347 | Ga0070668_100638489 | Ga0070668_1006384892 | 119 |
| 26 | 3300005347 | Ga0070668_101100588 | Ga0070668_1011005881 | 119 |
| 27 | 3300005366 | Ga0070659_100278584 | Ga0070659_1002785842 | 119 |
| 28 | 3300005366 | Ga0070659_100803199 | Ga0070659_1008031991 | 119 |
| 29 | 3300005366 | Ga0070659_101622400 | Ga0070659_1016224001 | 119 |
| 30 | 3300005437 | Ga0070710_10232302 | Ga0070710_102323022 | 119 |
| 31 | 3300005439 | Ga0070711_100053525 | Ga0070711_1000535253 | 119 |
| 32 | 3300005440 | Ga0070705_100530877 | Ga0070705_1005308772 | 119 |
| 33 | 3300005441 | Ga0070700_100721853 | Ga0070700_1007218532 | 119 |
| 34 | 3300005455 | Ga0070663_100416212 | Ga0070663_1004162123 | 119 |
| 35 | 3300005456 | Ga0070678_100035694 | Ga0070678_1000356943 | 119 |
| 36 | 3300005456 | Ga0070678_100053800 | Ga0070678_1000538003 | 119 |
| 37 | 3300005456 | Ga0070678_100230919 | Ga0070678_1002309191 | 119 |
| 38 | 3300005457 | Ga0070662_100277825 | Ga0070662_1002778252 | 119 |
| 39 | 3300005457 | Ga0070662_100386341 | Ga0070662_1003863412 | 119 |
| 40 | 3300005458 | Ga0070681_10376199 | Ga0070681_103761993 | 119 |
| 41 | 3300005471 | Ga0070698_100028937 | Ga0070698_1000289377 | 119 |
| 42 | 3300005535 | Ga0070684_100146921 | Ga0070684_1001469212 | 119 |
| 43 | 3300005536 | Ga0070697_100403419 | Ga0070697_1004034192 | 119 |
| 44 | 3300005536 | Ga0070697_100537318 | Ga0070697_1005373181 | 119 |
| 45 | 3300005543 | Ga0070672_100050369 | Ga0070672_1000503691 | 119 |
| 46 | 3300005544 | Ga0070686_101787020 | Ga0070686_1017870202 | 119 |
| 47 | 3300005548 | Ga0070665_100028176 | Ga0070665_1000281765 | 119 |
| 48 | 3300005549 | Ga0070704_100672905 | Ga0070704_1006729051 | 119 |
| 49 | 3300005564 | Ga0070664_100001608 | Ga0070664_10000160817 | 119 |
| 50 | 3300005577 | Ga0068857_100002047 | Ga0068857_10000204717 | 119 |
| 51 | 3300005578 | Ga0068854_101355729 | Ga0068854_1013557292 | 119 |
| 52 | 3300005615 | Ga0070702_100252333 | Ga0070702_1002523332 | 119 |
| 53 | 3300005618 | Ga0068864_100000091 | Ga0068864_10000009171 | 119 |
| 54 | 3300005618 | Ga0068864_101097551 | Ga0068864_1010975512 | 119 |
| 55 | 3300005719 | Ga0068861_100371434 | Ga0068861_1003714342 | 119 |
| 56 | 3300005841 | Ga0068863_100019604 | Ga0068863_1000196044 | 119 |
| 57 | 3300005843 | Ga0068860_100102391 | Ga0068860_1001023915 | 119 |
| 58 | 3300005843 | Ga0068860_101093351 | Ga0068860_1010933512 | 119 |
| 59 | 3300005844 | Ga0068862_100773799 | Ga0068862_1007737992 | 119 |
| 60 | 3300005844 | Ga0068862_101166522 | Ga0068862_1011665222 | 119 |
| 61 | 3300006195 | Ga0075366_10304867 | Ga0075366_103048672 | 119 |
| 62 | 3300006237 | Ga0097621_100350403 | Ga0097621_1003504033 | 119 |
| 63 | 3300006358 | Ga0068871_100151843 | Ga0068871_1001518432 | 119 |
| 64 | 3300006844 | Ga0075428_100000605 | Ga0075428_10000060511 | 119 |
| 65 | 3300006844 | Ga0075428_100004318 | Ga0075428_10000431810 | 119 |
| 66 | 3300006847 | Ga0075431_100265128 | Ga0075431_1002651285 | 119 |
| 67 | 3300006847 | Ga0075431_100408337 | Ga0075431_1004083372 | 119 |
| 68 | 3300006847 | Ga0075431_100752683 | Ga0075431_1007526832 | 119 |
| 69 | 3300006871 | Ga0075434_101269997 | Ga0075434_1012699972 | 119 |
| 70 | 3300006880 | Ga0075429_100607856 | Ga0075429_1006078562 | 119 |
| 71 | 3300006881 | Ga0068865_100623939 | Ga0068865_1006239392 | 119 |
| 72 | 3300006881 | Ga0068865_100747641 | Ga0068865_1007476412 | 119 |
| 73 | 3300006914 | Ga0075436_100036106 | Ga0075436_1000361063 | 119 |
| 74 | 3300007076 | Ga0075435_100869789 | Ga0075435_1008697892 | 119 |
| 75 | 3300009093 | Ga0105240_11535479 | Ga0105240_115354792 | 119 |
| 76 | 3300009094 | Ga0111539_10049546 | Ga0111539_100495464 | 119 |
| 77 | 3300009094 | Ga0111539_10495223 | Ga0111539_104952232 | 119 |
| 78 | 3300009098 | Ga0105245_10427589 | Ga0105245_104275891 | 119 |
| 79 | 3300009147 | Ga0114129_10000929 | Ga0114129_1000092931 | 119 |
| 80 | 3300009148 | Ga0105243_11456440 | Ga0105243_114564401 | 119 |
| 81 | 3300009174 | Ga0105241_10312598 | Ga0105241_103125983 | 119 |
| 82 | 3300009174 | Ga0105241_11465954 | Ga0105241_114659542 | 119 |
| 83 | 3300009176 | Ga0105242_10520722 | Ga0105242_105207222 | 119 |
| 84 | 3300009177 | Ga0105248_10104803 | Ga0105248_101048036 | 119 |
| 85 | 3300009177 | Ga0105248_13236600 | Ga0105248_132366001 | 119 |
| 86 | 3300009545 | Ga0105237_11490578 | Ga0105237_114905781 | 119 |
| 87 | 3300009551 | Ga0105238_10260209 | Ga0105238_102602093 | 119 |
| 88 | 3300009551 | Ga0105238_10702313 | Ga0105238_107023132 | 119 |
| 89 | 3300009553 | Ga0105249_10047246 | Ga0105249_100472462 | 119 |
| 90 | 3300009553 | Ga0105249_10615444 | Ga0105249_106154441 | 119 |
| 91 | 3300009553 | Ga0105249_11071464 | Ga0105249_110714642 | 119 |
| 92 | 3300010375 | Ga0105239_10237687 | Ga0105239_102376873 | 119 |
| 93 | 3300011119 | Ga0105246_11490419 | Ga0105246_114904191 | 119 |
| 94 | 3300012507 | Ga0157342_1064435 | Ga0157342_10644351 | 119 |
| 95 | 3300013296 | Ga0157374_10842269 | Ga0157374_108422692 | 119 |
| 96 | 3300013297 | Ga0157378_10072122 | Ga0157378_100721221 | 119 |
| 97 | 3300013297 | Ga0157378_10941120 | Ga0157378_109411202 | 119 |
| 98 | 3300013306 | Ga0163162_11404263 | Ga0163162_114042632 | 119 |
| 99 | 3300013306 | Ga0163162_11497223 | Ga0163162_114972232 | 119 |
| 100 | 3300013308 | Ga0157375_10118106 | Ga0157375_101181062 | 119 |
| 101 | 3300014325 | Ga0163163_10025346 | Ga0163163_100253465 | 119 |
| 102 | 3300014325 | Ga0163163_10518169 | Ga0163163_105181692 | 119 |
| 103 | 3300014325 | Ga0163163_11477822 | Ga0163163_114778222 | 119 |
| 104 | 3300014968 | Ga0157379_10001284 | Ga0157379_100012845 | 119 |
| 105 | 3300014968 | Ga0157379_10123496 | Ga0157379_101234963 | 119 |
| 106 | 3300014969 | Ga0157376_11306566 | Ga0157376_113065662 | 119 |
| 107 | 3300014969 | Ga0157376_12431613 | Ga0157376_124316132 | 119 |
| 108 | 3300017792 | Ga0163161_10108788 | Ga0163161_101087883 | 119 |
| 109 | 3300017792 | Ga0163161_10548503 | Ga0163161_105485031 | 119 |
| 110 | 3300021384 | Ga0213876_10379512 | Ga0213876_103795122 | 119 |
| 111 | 3300025315 | Ga0207697_10030776 | Ga0207697_100307764 | 119 |
| 112 | 3300025903 | Ga0207680_10190812 | Ga0207680_101908123 | 119 |
| 113 | 3300025903 | Ga0207680_10283436 | Ga0207680_102834362 | 119 |
| 114 | 3300025903 | Ga0207680_10370720 | Ga0207680_103707201 | 119 |
| 115 | 3300025908 | Ga0207643_11064083 | Ga0207643_110640831 | 119 |
| 116 | 3300025909 | Ga0207705_10772590 | Ga0207705_107725902 | 119 |
| 117 | 3300025909 | Ga0207705_11157482 | Ga0207705_111574822 | 119 |
| 118 | 3300025911 | Ga0207654_10085229 | Ga0207654_100852291 | 119 |
| 119 | 3300025912 | Ga0207707_10302440 | Ga0207707_103024402 | 119 |
| 120 | 3300025913 | Ga0207695_10138699 | Ga0207695_101386993 | 119 |
| 121 | 3300025913 | Ga0207695_10713070 | Ga0207695_107130701 | 119 |
| 122 | 3300025916 | Ga0207663_10005083 | Ga0207663_100050835 | 119 |
| 123 | 3300025919 | Ga0207657_10299773 | Ga0207657_102997733 | 119 |
| 124 | 3300025923 | Ga0207681_10146383 | Ga0207681_101463832 | 119 |
| 125 | 3300025924 | Ga0207694_11534435 | Ga0207694_115344351 | 119 |
| 126 | 3300025925 | Ga0207650_10242032 | Ga0207650_102420322 | 119 |
| 127 | 3300025926 | Ga0207659_11094913 | Ga0207659_110949132 | 119 |
| 128 | 3300025927 | Ga0207687_10743355 | Ga0207687_107433552 | 119 |
| 129 | 3300025932 | Ga0207690_10402375 | Ga0207690_104023753 | 119 |
| 130 | 3300025932 | Ga0207690_10675452 | Ga0207690_106754522 | 119 |
| 131 | 3300025933 | Ga0207706_10195647 | Ga0207706_101956472 | 119 |
| 132 | 3300025934 | Ga0207686_10478253 | Ga0207686_104782532 | 119 |
| 133 | 3300025936 | Ga0207670_10587781 | Ga0207670_105877812 | 119 |
| 134 | 3300025938 | Ga0207704_10268495 | Ga0207704_102684952 | 119 |
| 135 | 3300025938 | Ga0207704_10302356 | Ga0207704_103023562 | 119 |
| 136 | 3300025938 | Ga0207704_10579207 | Ga0207704_105792072 | 119 |
| 137 | 3300025940 | Ga0207691_10827583 | Ga0207691_108275832 | 119 |
| 138 | 3300025942 | Ga0207689_10134445 | Ga0207689_101344452 | 119 |
| 139 | 3300025945 | Ga0207679_10293044 | Ga0207679_102930442 | 119 |
| 140 | 3300025945 | Ga0207679_11951366 | Ga0207679_119513662 | 119 |
| 141 | 3300025961 | Ga0207712_10284514 | Ga0207712_102845142 | 119 |
| 142 | 3300025961 | Ga0207712_10699328 | Ga0207712_106993282 | 119 |
| 143 | 3300025961 | Ga0207712_11436348 | Ga0207712_114363482 | 119 |
| 144 | 3300025981 | Ga0207640_11693996 | Ga0207640_116939961 | 119 |
| 145 | 3300026035 | Ga0207703_11197656 | Ga0207703_111976562 | 119 |
| 146 | 3300026041 | Ga0207639_10542301 | Ga0207639_105423013 | 119 |
| 147 | 3300026067 | Ga0207678_10151375 | Ga0207678_101513753 | 119 |
| 148 | 3300026067 | Ga0207678_10488129 | Ga0207678_104881292 | 119 |
| 149 | 3300026088 | Ga0207641_10111216 | Ga0207641_101112163 | 119 |
| 150 | 3300026095 | Ga0207676_10000013 | Ga0207676_10000013130 | 119 |
| 151 | 3300026095 | Ga0207676_10202424 | Ga0207676_102024242 | 119 |
| 152 | 3300026095 | Ga0207676_11202122 | Ga0207676_112021222 | 119 |
| 153 | 3300026116 | Ga0207674_10003324 | Ga0207674_1000332422 | 119 |
| 154 | 3300026116 | Ga0207674_10557854 | Ga0207674_105578542 | 119 |
| 155 | 3300026121 | Ga0207683_10036358 | Ga0207683_100363584 | 119 |
| 156 | 3300026121 | Ga0207683_10043721 | Ga0207683_100437213 | 119 |
| 157 | 3300026121 | Ga0207683_10139241 | Ga0207683_101392414 | 119 |
| 158 | 3300026142 | Ga0207698_10145125 | Ga0207698_101451253 | 119 |
| 159 | 3300026142 | Ga0207698_12356613 | Ga0207698_123566131 | 119 |
| 160 | 3300027907 | Ga0207428_10177407 | Ga0207428_101774072 | 119 |
| 161 | 3300028379 | Ga0268266_10067638 | Ga0268266_100676385 | 119 |
| 162 | 3300028379 | Ga0268266_10146215 | Ga0268266_101462153 | 119 |
| 163 | 3300028380 | Ga0268265_11606556 | Ga0268265_116065561 | 119 |
| 164 | 3300028381 | Ga0268264_10477484 | Ga0268264_104774842 | 119 |
| 165 | 3300028800 | Ga0265338_10000006 | Ga0265338_10000006109 | 119 |
| 166 | 3300030521 | Ga0307511_10311796 | Ga0307511_103117962 | 119 |
| 167 | 3300030745 | Ga0316182_1407811 | Ga0316182_14078111 | 119 |
| 168 | 3300030760 | Ga0265762_1147552 | Ga0265762_11475521 | 119 |
| 169 | 3300031238 | Ga0265332_10007317 | Ga0265332_100073176 | 119 |
| 170 | 3300031241 | Ga0265325_10000007 | Ga0265325_10000007109 | 119 |
| 171 | 3300031249 | Ga0265339_10000199 | Ga0265339_1000019913 | 119 |
| 172 | 3300031250 | Ga0265331_10024936 | Ga0265331_100249362 | 119 |
| 173 | 3300031507 | Ga0307509_10151183 | Ga0307509_101511833 | 119 |
| 174 | 3300031548 | Ga0307408_100260513 | Ga0307408_1002605132 | 119 |
| 175 | 3300031595 | Ga0265313_10000741 | Ga0265313_1000074126 | 119 |
| 176 | 3300031712 | Ga0265342_10022915 | Ga0265342_100229154 | 119 |
| 177 | 3300031995 | Ga0307409_101683552 | Ga0307409_1016835521 | 119 |
| 178 | 3300032002 | Ga0307416_100349055 | Ga0307416_1003490552 | 119 |
| 179 | 3300032002 | Ga0307416_101001183 | Ga0307416_1010011832 | 119 |
| 180 | 3300032126 | Ga0307415_100096891 | Ga0307415_1000968912 | 119 |
| 181 | 3300035084 | Ga0373928_0204568 | Ga0373928_0204568_104_469 | 119 |
| 182 | 3300036401 | Ga0373937_0015435 | Ga0373937_0015435_5340_5705 | 119 |
| 183 | 3300037418 | Ga0395900_0759280 | Ga0395900_0759280_337_702 | 119 |
| 184 | 3300037853 | Ga0436364_0234011 | Ga0436364_0234011_2249_2614 | 119 |
| 185 | 3300039437 | Ga0436365_1466577 | Ga0436365_1466577_162_524 | 119 |
| 186 | 3300041452 | Ga0451793_1204802 | Ga0451793_1204802_28_393 | 119 |
| 187 | 3300041511 | Ga0451855_1774085 | Ga0451855_1774085_37_402 | 119 |
| 188 | 3300042000 | Ga0439437_025100 | Ga0439437_025100_343_708 | 119 |
| 189 | 3300042008 | Ga0439450_184445 | Ga0439450_184445_29_394 | 119 |
| 190 | 3300042133 | Ga0450896_086811 | Ga0450896_086811_85_450 | 119 |
| 191 | 3300042142 | Ga0450905_016502 | Ga0450905_016502_20_385 | 119 |
| 192 | 3300042157 | Ga0439458_0098886 | Ga0439458_0098886_263_628 | 119 |
| 193 | 3300042438 | Ga0439459_0214953 | Ga0439459_0214953_145_510 | 119 |
| 194 | 3300042439 | Ga0439464_0065800 | Ga0439464_0065800_353_718 | 119 |
| 195 | 3300042461 | Ga0439460_0025354 | Ga0439460_0025354_1000_1365 | 119 |
| 196 | 3300044712 | Ga0453684_0204211 | Ga0453684_0204211_297_662 | 119 |
| 197 | 3300045051 | Ga0451576_1022642 | Ga0451576_1022642_338_703 | 119 |
| 198 | 3300046539 | Ga0495621_0105579 | Ga0495621_0105579_63_437 | 119 |
| 199 | 3300048905 | Ga0496102_0303792 | Ga0496102_0303792_281_646 | 119 |
| 200 | 3300048906 | Ga0496103_0915537 | Ga0496103_0915537_24_389 | 119 |
| 201 | 3300048907 | Ga0496104_0138117 | Ga0496104_0138117_374_739 | 119 |
| 202 | 3300048907 | Ga0496104_0784370 | Ga0496104_0784370_305_670 | 119 |
| 203 | 3300048908 | Ga0496105_0548532 | Ga0496105_0548532_494_889 | 119 |
| 204 | 3300048909 | Ga0496106_0238741 | Ga0496106_0238741_248_613 | 119 |
| 205 | 3300048910 | Ga0496107_0974417 | Ga0496107_0974417_192_557 | 119 |
| 206 | 3300048911 | Ga0496108_0066758 | Ga0496108_0066758_343_708 | 119 |
| 207 | 3300048911 | Ga0496108_1082489 | Ga0496108_1082489_273_638 | 119 |
| 208 | 3300048912 | Ga0496109_0220304 | Ga0496109_0220304_449_814 | 119 |
| 209 | 3300048913 | Ga0496110_0260212 | Ga0496110_0260212_862_1227 | 119 |
| 210 | 3300048914 | Ga0496111_0229272 | Ga0496111_0229272_162_527 | 119 |
| 211 | 3300048915 | Ga0496112_0116086 | Ga0496112_0116086_1303_1668 | 119 |
| 212 | 3300048917 | Ga0496114_1371088 | Ga0496114_1371088_181_546 | 119 |
| 213 | 3300048920 | Ga0496117_0264533 | Ga0496117_0264533_331_696 | 119 |
| 214 | 3300048921 | Ga0496118_0174336 | Ga0496118_0174336_368_733 | 119 |
| 215 | 3300049515 | Ga0501292_057211 | Ga0501292_057211_66_431 | 119 |
| 216 | 3300049569 | Ga0501032_0004174 | Ga0501032_0004174_4218_4583 | 119 |
| 217 | 3300049570 | Ga0501033_0034507 | Ga0501033_0034507_270_635 | 119 |
| 218 | 3300049570 | Ga0501033_0961556 | Ga0501033_0961556_172_537 | 119 |
| 219 | 3300049571 | Ga0501034_0002379 | Ga0501034_0002379_12264_12629 | 119 |
| 220 | 3300049572 | Ga0501036_0092205 | Ga0501036_0092205_1935_2300 | 119 |
| 221 | 3300049572 | Ga0501036_0187915 | Ga0501036_0187915_1030_1395 | 119 |
| 222 | 3300049572 | Ga0501036_0264768 | Ga0501036_0264768_836_1201 | 119 |
| 223 | 3300049573 | Ga0501037_0010726 | Ga0501037_0010726_935_1300 | 119 |
| 224 | 3300049573 | Ga0501037_0133240 | Ga0501037_0133240_985_1350 | 119 |
| 225 | 3300049573 | Ga0501037_1033654 | Ga0501037_1033654_71_436 | 119 |
| 226 | 3300049574 | Ga0501038_0059148 | Ga0501038_0059148_567_932 | 119 |
| 227 | 3300049574 | Ga0501038_0123152 | Ga0501038_0123152_325_690 | 119 |
| 228 | 3300049578 | Ga0501042_0762260 | Ga0501042_0762260_36_401 | 119 |
| 229 | 3300049579 | Ga0501043_0072392 | Ga0501043_0072392_1225_1590 | 119 |
| 230 | 3300049579 | Ga0501043_0243036 | Ga0501043_0243036_711_1076 | 119 |
| 231 | 3300049579 | Ga0501043_0368594 | Ga0501043_0368594_682_1047 | 119 |
| 232 | 3300049580 | Ga0501046_0013161 | Ga0501046_0013161_5253_5618 | 119 |
| 233 | 3300049580 | Ga0501046_0378417 | Ga0501046_0378417_547_912 | 119 |
| 234 | 3300049581 | Ga0501047_0000315 | Ga0501047_0000315_42984_43349 | 119 |
| 235 | 3300049581 | Ga0501047_0002340 | Ga0501047_0002340_15574_15939 | 119 |
| 236 | 3300049581 | Ga0501047_0016398 | Ga0501047_0016398_1477_1842 | 119 |
| 237 | 3300049582 | Ga0501048_0329834 | Ga0501048_0329834_470_835 | 119 |
| 238 | 3300049583 | Ga0501067_0000119 | Ga0501067_0000119_11837_12202 | 119 |
| 239 | 3300049584 | Ga0501068_0046569 | Ga0501068_0046569_1903_2268 | 119 |
| 240 | 3300049586 | Ga0501070_0004828 | Ga0501070_0004828_4095_4460 | 119 |
| 241 | 3300049587 | Ga0501071_0213986 | Ga0501071_0213986_279_644 | 119 |
| 242 | 3300049587 | Ga0501071_0662999 | Ga0501071_0662999_413_778 | 119 |
| 243 | 3300049588 | Ga0501072_0002403 | Ga0501072_0002403_13477_13842 | 119 |
| 244 | 3300049589 | Ga0501073_0002435 | Ga0501073_0002435_534_899 | 119 |
| 245 | 3300049590 | Ga0501074_0014434 | Ga0501074_0014434_5074_5439 | 119 |
| 246 | 3300049591 | Ga0501075_0035742 | Ga0501075_0035742_3322_3687 | 119 |
| 247 | 3300049591 | Ga0501075_0510863 | Ga0501075_0510863_105_470 | 119 |
| 248 | 3300049592 | Ga0501076_0176521 | Ga0501076_0176521_156_521 | 119 |
| 249 | 3300049592 | Ga0501076_0242195 | Ga0501076_0242195_1014_1379 | 119 |
| 250 | 3300049592 | Ga0501076_0949504 | Ga0501076_0949504_59_433 | 119 |
| 251 | 3300049703 | Ga0501219_010996 | Ga0501219_010996_279_644 | 119 |
| 252 | 3300049741 | Ga0501079_0002546 | Ga0501079_0002546_643_1008 | 119 |
| 253 | 3300049742 | Ga0501080_0002008 | Ga0501080_0002008_4996_5361 | 119 |
| 254 | 3300049742 | Ga0501080_0157462 | Ga0501080_0157462_366_731 | 119 |
| 255 | 3300049742 | Ga0501080_0447173 | Ga0501080_0447173_386_751 | 119 |
| 256 | 3300049742 | Ga0501080_0730613 | Ga0501080_0730613_16_381 | 119 |
| 257 | 3300049742 | Ga0501080_1038191 | Ga0501080_1038191_44_409 | 119 |
| 258 | 3300049743 | Ga0501081_0246309 | Ga0501081_0246309_136_501 | 119 |
| 259 | 3300049743 | Ga0501081_0755711 | Ga0501081_0755711_248_613 | 119 |
| 260 | 3300049744 | Ga0501083_0000646 | Ga0501083_0000646_12069_12434 | 119 |
| 261 | 3300049744 | Ga0501083_0397054 | Ga0501083_0397054_13_378 | 119 |
| 262 | 3300049822 | Ga0501035_0028207 | Ga0501035_0028207_1669_2034 | 119 |
| 263 | 3300049822 | Ga0501035_0080117 | Ga0501035_0080117_936_1301 | 119 |
| 264 | 3300049822 | Ga0501035_0402601 | Ga0501035_0402601_48_413 | 119 |
| 265 | 3300049823 | Ga0501044_0000956 | Ga0501044_0000956_4365_4730 | 119 |
| 266 | 3300049823 | Ga0501044_0004556 | Ga0501044_0004556_8603_8968 | 119 |
| 267 | 3300049823 | Ga0501044_0172355 | Ga0501044_0172355_1629_1994 | 119 |
| 268 | 3300050507 | nmdc:mga05p37_13_c1 | nmdc:mga05p37_13_c1_86270_86635 | 119 |
| 269 | 3300050507 | nmdc:mga05p37_22605_c1 | nmdc:mga05p37_22605_c1_7124_7558 | 119 |
| 270 | 3300050508 | nmdc:mga09592_269151_c1 | nmdc:mga09592_269151_c1_274_639 | 119 |
| 271 | 3300050508 | nmdc:mga09592_545387_c1 | nmdc:mga09592_545387_c1_207_572 | 119 |
| 272 | 3300050508 | nmdc:mga09592_6180_c1 | nmdc:mga09592_6180_c1_9333_9698 | 119 |
| 273 | 3300050509 | nmdc:mga0qj67_33657_c1 | nmdc:mga0qj67_33657_c1_1572_1937 | 119 |
| 274 | 3300050510 | nmdc:mga06r32_4901_c1 | nmdc:mga06r32_4901_c1_641_1006 | 119 |
| 275 | 3300050510 | nmdc:mga06r32_73640_c1 | nmdc:mga06r32_73640_c1_2791_3156 | 119 |
| 276 | 3300050511 | nmdc:mga08y16_67235_c1 | nmdc:mga08y16_67235_c1_1042_1491 | 119 |
| 277 | 3300050511 | nmdc:mga08y16_9713_c1 | nmdc:mga08y16_9713_c1_8707_9141 | 119 |
| 278 | 3300050512 | nmdc:mga0n895_64627_c1 | nmdc:mga0n895_64627_c1_3120_3485 | 119 |
| 279 | 3300050514 | nmdc:mga08x19_10374_c1 | nmdc:mga08x19_10374_c1_4420_4785 | 119 |
| 280 | 3300050514 | nmdc:mga08x19_52245_c1 | nmdc:mga08x19_52245_c1_768_1133 | 119 |
| 281 | 3300050515 | nmdc:mga0a205_498632_c1 | nmdc:mga0a205_498632_c1_40_405 | 119 |
| 282 | 3300053093 | Ga0500651_0293120 | Ga0500651_0293120_213_578 | 119 |
| 283 | 3300053103 | Ga0500555_039926 | Ga0500555_039926_694_1059 | 119 |
| 284 | 3300053116 | Ga0500592_020418 | Ga0500592_020418_546_911 | 119 |
| 285 | 3300053119 | Ga0500595_008648 | Ga0500595_008648_645_1010 | 119 |
| 286 | 3300053154 | Ga0500619_001037 | Ga0500619_001037_3873_4238 | 119 |
| 287 | 3300053730 | Ga0500645_000154 | Ga0500645_000154_34671_35036 | 119 |
| 288 | 3300054114 | Ga0501084_0445310 | Ga0501084_0445310_26_409 | 119 |
| 289 | 3300054114 | Ga0501084_0530348 | Ga0501084_0530348_620_985 | 119 |
| 290 | 3300054114 | Ga0501084_0582812 | Ga0501084_0582812_28_393 | 119 |
| 291 | 3300059421 | Ga0590071_000843 | Ga0590071_000843_7945_8310 | 119 |
| 292 | 3300059423 | Ga0590074_007441 | Ga0590074_007441_247_612 | 119 |
| 293 | 3300059424 | Ga0590075_000790 | Ga0590075_000790_7649_8014 | 119 |
| 294 | 3300060353 | Ga0501082_0005653 | Ga0501082_0005653_5865_6230 | 119 |
| 295 | 3300060353 | Ga0501082_0293512 | Ga0501082_0293512_219_584 | 119 |
| 296 | 3300061734 | Ga0530510_0341320 | Ga0530510_0341320_522_887 | 119 |
| 297 | 3300061734 | Ga0530510_0711833 | Ga0530510_0711833_166_531 | 119 |
| 298 | 3300061734 | Ga0530510_1267383 | Ga0530510_1267383_92_457 | 119 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j05-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9479 | 7 | 87 |
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9471 | 7 | 80 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9441 | 6 | 80 |
| 1u2w-assembly2.cif.gz_C | crystal structure of the staphylococcus aureus pi258 cadc | 0.9363 | 7 | 76 |
| 6ghb-assembly1.cif.gz_B | crystal structure of spx in complex with yjbh (oxidized) | 0.936 | 25 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9745 | 20 | 75 | 1.10.10.10 |
| af_P0ACL0_1_57_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9624 | 20 | 65 | 1.10.10.10 |
| 3bddD00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9593 | 18 | 63 | 1.10.10.10 |
| af_Q54FU1_288_364_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9553 | 18 | 77 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9455 | 18 | 74 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I0D8A9-F1-model_v4 | Transcriptional regulator, ArsR family | 0.981 | 7 | 89 |
GO:0003700
GO:0046685 |
| AF-A0A1N6DJH9-F1-model_v4 | Transcriptional regulator, ArsR family | 0.9806 | 7 | 78 |
GO:0003700
|
| AF-A0A0G3W9J0-F1-model_v4 | Transcriptional regulator ArsR family | 0.9779 | 7 | 89 |
GO:0003700
GO:0046685 |
| AF-G8QYJ0-F1-model_v4 | Putative transcriptional regulator | 0.9767 | 7 | 89 |
GO:0003700
|
| AF-A0A6G1SU58-F1-model_v4 | Metalloregulator ArsR/SmtB family transcription factor | 0.975 | 10 | 92 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar