F390982

General Info

Members Datasets Scaffolds Average Seq Length
292 213 246 137

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_11002633|Ga0207712_110026331
Length 161
Sequence MFLLDTPVVLELRKAKAGRTDPGRWLMADATCQSVTIEADADVVRVRQATRELVVAASLSLVDQTKMVTATSELARNTLIYGGGGVANLEIVDNGQRTGVRATFIDTGPGIPDVDLALQDGYTSGNGLGLGLSGARRLVDEFELDTKVGEGTRVTVTKWRR

Samples

Sample ID Description Type Environment
1 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
2 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
3 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
4 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
5 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
6 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
7 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
8 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
9 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
10 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
11 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
12 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
13 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
14 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
15 2858882152 Micromonospora noduli MED15 Isolate Nodule
16 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
17 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
18 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
19 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
20 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
21 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
22 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
23 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
24 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
25 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
26 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
27 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
28 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
29 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
30 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
31 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
156 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
157 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
208 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
209 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
210 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
211 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
212 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
213 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.27
Metatranscriptomes 2.05
Isolates 12.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 2.4
Rhizoplane 3.77
Rhizosphere 76.37
Stem 0
Stem Tuber 0
Unclassified 12.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10024545 3300003203 Bacteria 2360
2 JGI25406J46586_10082864 3300003203 Bacteria 980
3 Ga0006562J51391_1109706 3300003578 Bacteria 1280
4 Ga0055526_1000694 3300003771 Bacteria 25675
5 Ga0065165_1006181 3300005262 Bacteria 6389
6 Ga0065714_10181427 3300005288 Bacteria 912
7 Ga0070658_10265695 3300005327 Bacteria 1458
8 Ga0070658_10619786 3300005327 Bacteria 938
9 Ga0070683_100439134 3300005329 Bacteria 1245
10 Ga0070668_100030190 3300005347 Bacteria 4121
11 Ga0070675_100325045 3300005354 Bacteria 1359
12 Ga0070671_101566652 3300005355 Bacteria 584
13 Ga0070667_101103528 3300005367 Bacteria 742
14 Ga0070714_100000013 3300005435 Bacteria 211756
15 Ga0070714_100820724 3300005435 Bacteria 901
16 Ga0070713_101059803 3300005436 Bacteria 783
17 Ga0070713_102307240 3300005436 Bacteria 521
18 Ga0070663_100020032 3300005455 Bacteria 4421
19 Ga0070663_100584149 3300005455 Bacteria 938
20 Ga0070678_101192051 3300005456 Bacteria 706
21 Ga0070685_11289057 3300005466 Bacteria 558
22 Ga0070679_100795417 3300005530 Bacteria 889
23 Ga0068853_100068595 3300005539 Bacteria 3083
24 Ga0070686_101217989 3300005544 Bacteria 626
25 Ga0070665_100053559 3300005548 Bacteria 4047
26 Ga0070665_100422293 3300005548 Bacteria 1342
27 Ga0070665_101372209 3300005548 Bacteria 716
28 Ga0068855_100010603 3300005563 Bacteria 11109
29 Ga0068854_100034257 3300005578 Bacteria 3546
30 Ga0068854_100039043 3300005578 Bacteria 3342
31 Ga0068852_100002599 3300005616 Bacteria 12471
32 Ga0068851_10129262 3300005834 Bacteria 1364
33 Ga0068863_100295930 3300005841 Bacteria 1569
34 Ga0068858_100015114 3300005842 Bacteria 7260
35 Ga0068860_100236856 3300005843 Bacteria 1775
36 Ga0081455_10809647 3300005937 Bacteria 587
37 Ga0081540_1025620 3300005983 Bacteria 3388
38 Ga0081539_10001271 3300005985 Bacteria 44503
39 Ga0081539_10002480 3300005985 Bacteria 25953
40 Ga0081539_10003880 3300005985 Bacteria 17462
41 Ga0081539_10025052 3300005985 Bacteria 3854
42 Ga0075365_10553994 3300006038 Bacteria 813
43 Ga0075364_10719409 3300006051 Bacteria 681
44 Ga0075432_10008627 3300006058 Bacteria 3479
45 Ga0070715_10151037 3300006163 Bacteria 1138
46 Ga0075366_10299880 3300006195 Bacteria 983
47 Ga0075430_101092843 3300006846 Bacteria 657
48 Ga0105244_10003626 3300009036 Bacteria 10941
49 Ga0105244_10033039 3300009036 Bacteria 2732
50 Ga0105250_10008071 3300009092 Bacteria 4489
51 Ga0105240_10011935 3300009093 Bacteria 12045
52 Ga0105240_10025821 3300009093 Bacteria 7714
53 Ga0111539_10338899 3300009094 Bacteria 1750
54 Ga0105245_10224871 3300009098 Bacteria 1813
55 Ga0114129_10270011 3300009147 Bacteria 2276
56 Ga0114129_12588400 3300009147 Bacteria 606
57 Ga0105243_10663633 3300009148 Bacteria 1012
58 Ga0105241_10002124 3300009174 Bacteria 14987
59 Ga0105242_10148280 3300009176 Bacteria 2043
60 Ga0105248_10566574 3300009177 Bacteria 1281
61 Ga0105237_10017230 3300009545 Bacteria 7493
62 Ga0105237_10041641 3300009545 Bacteria 4632
63 Ga0105238_10018236 3300009551 Bacteria 7139
64 Ga0105249_13328818 3300009553 Bacteria 517
65 Ga0105239_10128529 3300010375 Bacteria 2817
66 Ga0105239_10253462 3300010375 Bacteria 1977
67 Ga0105239_10358403 3300010375 Bacteria 1647
68 Ga0105246_10321668 3300011119 Bacteria 1257
69 Ga0157373_10016704 3300013100 Bacteria 5349
70 Ga0157374_10704356 3300013296 Bacteria 1023
71 Ga0157374_11225491 3300013296 Bacteria 772
72 Ga0157378_10229632 3300013297 Bacteria 1768
73 Ga0163162_10035644 3300013306 Bacteria 4957
74 Ga0157375_10047707 3300013308 Bacteria 4185
75 Ga0157375_11461639 3300013308 Bacteria 806
76 Ga0163163_10858580 3300014325 Bacteria 971
77 Ga0157380_12123051 3300014326 Bacteria 625
78 Ga0157379_10084156 3300014968 Bacteria 2851
79 Ga0157379_11172911 3300014968 Bacteria 738
80 Ga0157376_11209760 3300014969 Bacteria 784
81 Ga0163161_10010315 3300017792 Bacteria 6470
82 Ga0197907_11228130 3300020069 Bacteria 1357
83 Ga0206355_1281206 3300020076 Bacteria 658
84 Ga0206350_11061538 3300020080 Bacteria 645
85 Ga0206353_10837477 3300020082 Bacteria 1018
86 Ga0224712_10068589 3300022467 Bacteria 1433
87 Ga0209564_1000776 3300025295 Bacteria 44348
88 Ga0207656_10071250 3300025321 Bacteria 1545
89 Ga0207696_1014833 3300025711 Bacteria 2659
90 Ga0207655_1005619 3300025728 Bacteria 8489
91 Ga0207655_1007806 3300025728 Bacteria 6891
92 Ga0207647_10003964 3300025904 Bacteria 11048
93 Ga0207647_10081760 3300025904 Bacteria 1935
94 Ga0207685_10454901 3300025905 Bacteria 666
95 Ga0207654_10013421 3300025911 Bacteria 4215
96 Ga0207654_10026393 3300025911 Bacteria 3145
97 Ga0207695_10007586 3300025913 Bacteria 13756
98 Ga0207695_10319094 3300025913 Bacteria 1443
99 Ga0207671_10001734 3300025914 Bacteria 24557
100 Ga0207694_10005933 3300025924 Bacteria 9368
101 Ga0207650_10507785 3300025925 Bacteria 1008
102 Ga0207650_10557075 3300025925 Bacteria 961
103 Ga0207687_10555976 3300025927 Bacteria 963
104 Ga0207664_10000001 3300025929 Bacteria 724213
105 Ga0207664_10347648 3300025929 Bacteria 1312
106 Ga0207664_10706786 3300025929 Bacteria 906
107 Ga0207644_10340113 3300025931 Bacteria 1217
108 Ga0207709_10735057 3300025935 Bacteria 792
109 Ga0207691_11211097 3300025940 Bacteria 626
110 Ga0207661_10366475 3300025944 Bacteria 1302
111 Ga0207667_10036015 3300025949 Bacteria 5307
112 Ga0207667_10185215 3300025949 Bacteria 2137
113 Ga0207712_11002633 3300025961 Bacteria 741
114 Ga0207668_10031750 3300025972 Bacteria 3483
115 Ga0207668_10788057 3300025972 Bacteria 841
116 Ga0207640_10079834 3300025981 Bacteria 2231
117 Ga0207658_10055328 3300025986 Bacteria 2940
118 Ga0207658_11287457 3300025986 Bacteria 668
119 Ga0207677_10727853 3300026023 Bacteria 882
120 Ga0207639_10041449 3300026041 Bacteria 3444
121 Ga0207639_10048166 3300026041 Bacteria 3224
122 Ga0207678_10040881 3300026067 Bacteria 4020
123 Ga0207702_10575620 3300026078 Bacteria 1103
124 Ga0207641_11013012 3300026088 Bacteria 827
125 Ga0207683_10325950 3300026121 Bacteria 1407
126 Ga0207698_10020775 3300026142 Bacteria 4526
127 Ga0207428_11128457 3300027907 Bacteria 547
128 Ga0268266_10127315 3300028379 Bacteria 2274
129 Ga0268264_10065455 3300028381 Bacteria 3062
130 Ga0307515_10000038 3300028794 Bacteria 331376
131 Ga0307515_10500449 3300028794 Bacteria 826
132 Ga0307511_10242496 3300030521 Bacteria 877
133 Ga0307512_10020532 3300030522 Bacteria 5973
134 Ga0265325_10214141 3300031241 Bacteria 884
135 Ga0307513_10823670 3300031456 Bacteria 634
136 Ga0307509_10025678 3300031507 Bacteria 6577
137 Ga0307509_10087979 3300031507 Bacteria 3190
138 Ga0307408_100057555 3300031548 Bacteria 2823
139 Ga0307408_100619505 3300031548 Bacteria 964
140 Ga0307408_100833865 3300031548 Bacteria 839
141 Ga0307405_10018429 3300031731 Bacteria 3851
142 Ga0307405_10183663 3300031731 Bacteria 1504
143 Ga0307413_10092538 3300031824 Bacteria 1974
144 Ga0307413_10339869 3300031824 Bacteria 1154
145 Ga0307413_10396034 3300031824 Bacteria 1080
146 Ga0307410_10339944 3300031852 Bacteria 1196
147 Ga0307410_11266354 3300031852 Bacteria 644
148 Ga0326468_10000241 3300031889 Bacteria 5712
149 Ga0307406_10004001 3300031901 Bacteria 8014
150 Ga0307406_10064281 3300031901 Bacteria 2381
151 Ga0307406_10401910 3300031901 Bacteria 1086
152 Ga0307406_10869620 3300031901 Bacteria 765
153 Ga0307407_10025737 3300031903 Bacteria 3106
154 Ga0307407_10651348 3300031903 Bacteria 789
155 Ga0307407_10776496 3300031903 Bacteria 727
156 Ga0307412_10072427 3300031911 Bacteria 2355
157 Ga0307412_10376683 3300031911 Bacteria 1148
158 Ga0307412_10446627 3300031911 Bacteria 1064
159 Ga0307409_100116626 3300031995 Bacteria 2251
160 Ga0307409_100395373 3300031995 Bacteria 1318
161 Ga0307409_102796855 3300031995 Bacteria 516
162 Ga0307416_102549551 3300032002 Bacteria 609
163 Ga0307416_103380759 3300032002 Unclassified 534
164 Ga0307414_11436724 3300032004 Bacteria 641
165 Ga0307411_10150677 3300032005 Bacteria 1728
166 Ga0307411_11272295 3300032005 Bacteria 669
167 Ga0307415_100009296 3300032126 Bacteria 5499
168 Ga0307415_100131391 3300032126 Bacteria 1896
169 Ga0307415_100278244 3300032126 Bacteria 1375
170 Ga0307415_100422933 3300032126 Bacteria 1144
171 Ga0307415_100739850 3300032126 Bacteria 892
172 Ga0373951_0000125 3300035091 Bacteria 28828
173 Ga0373961_0071536 3300035241 Bacteria 1073
174 Ga0373931_1074912 3300035691 Bacteria 547
175 Ga0436364_1157251 3300037853 Bacteria 2032
176 Ga0436365_0649287 3300039437 Bacteria 578
177 Ga0436363_1249388 3300039450 Bacteria 1222
178 Ga0451791_0861333 3300041451 Bacteria 1598
179 Ga0451804_0040196 3300041463 Bacteria 509
180 Ga0439455_0114553 3300042012 Bacteria 752
181 Ga0450902_019007 3300042137 Bacteria 1129
182 Ga0466970_0002306 3300044765 Bacteria 9229
183 Ga0466967_0053585 3300045976 Bacteria 3546
184 Ga0495638_0006928 3300046460 Bacteria 8177
185 Ga0495638_0032832 3300046460 Bacteria 3323
186 Ga0495638_0089138 3300046460 Bacteria 1861
187 Ga0495638_0170045 3300046460 Bacteria 1251
188 Ga0495653_0783265 3300046463 Bacteria 574
189 Ga0495650_0002207 3300046471 Bacteria 16405
190 Ga0495650_0235512 3300046471 Bacteria 627
191 Ga0495607_0000311 3300046501 Bacteria 50626
192 Ga0495607_0000329 3300046501 Bacteria 49139
193 Ga0495607_0005746 3300046501 Bacteria 8827
194 Ga0495583_0000339 3300046506 Bacteria 73715
195 Ga0495606_0001394 3300046507 Bacteria 32668
196 Ga0495610_0006924 3300046512 Bacteria 7678
197 Ga0495632_0000287 3300046519 Bacteria 49069
198 Ga0495632_0003592 3300046519 Bacteria 10917
199 Ga0495632_0201412 3300046519 Bacteria 906
200 Ga0495637_0000434 3300046520 Bacteria 30472
201 Ga0495637_0000807 3300046520 Bacteria 20740
202 Ga0495637_0006910 3300046520 Bacteria 5664
203 Ga0495637_0024050 3300046520 Bacteria 2758
204 Ga0495643_0149183 3300046522 Bacteria 1159
205 Ga0495654_0000990 3300046530 Bacteria 20909
206 Ga0495668_0001004 3300046616 Bacteria 30347
207 Ga0495625_0000363 3300046660 Bacteria 69433
208 Ga0495661_0000298 3300046665 Bacteria 56265
209 Ga0495588_0071567 3300046674 Bacteria 1803
210 Ga0495657_0650356 3300046675 Bacteria 608
211 Ga0495658_0718526 3300046683 Bacteria 640
212 Ga0495649_0004544 3300046694 Bacteria 9051
213 Ga0495649_0007088 3300046694 Bacteria 6890
214 Ga0495589_0004097 3300046794 Bacteria 7804
215 Ga0495581_0244688 3300047315 Bacteria 1049
216 Ga0495683_0127149 3300047323 Bacteria 1205
217 Ga0495685_103138 3300047447 Bacteria 941
218 Ga0495626_0000052 3300048091 Bacteria 156421
219 Ga0496101_0583806 3300048904 Bacteria 884
220 Ga0496102_0069534 3300048905 Bacteria 3232
221 Ga0496105_0427603 3300048908 Bacteria 1048
222 Ga0496108_0000035 3300048911 Bacteria 154937
223 Ga0496109_0125436 3300048912 Bacteria 2394
224 Ga0496110_0187544 3300048913 Bacteria 1878
225 Ga0496111_0207595 3300048914 Bacteria 1455
226 Ga0496114_0374740 3300048917 Bacteria 1260
227 Ga0496121_0002431 3300048924 Bacteria 28477
228 Ga0496122_0000175 3300048925 Bacteria 153295
229 Ga0496123_0000079 3300048926 Bacteria 191201
230 Ga0496124_0231515 3300048927 Bacteria 1381
231 Ga0496126_0014212 3300048929 Bacteria 8055
232 Ga0496126_0633041 3300048929 Bacteria 839
233 Ga0496126_1252639 3300048929 Bacteria 543
234 Ga0501034_1067633 3300049571 Bacteria 689
235 Ga0501047_0313846 3300049581 Bacteria 1408
236 nmdc:mga0yw44_484098_c1 3300050492 Bacteria 839
237 nmdc:mga0yw44_5971_c1 3300050492 Bacteria 5828
238 nmdc:mga05p37_1451643_c1 3300050507 Bacteria 687
239 nmdc:mga08y16_632304_c1 3300050511 Bacteria 1076
240 Ga0495595_0326254 3300053084 Bacteria 773
241 Ga0500562_043835 3300053108 Bacteria 1191
242 Ga0500568_0028667 3300053139 Bacteria 2320
243 Ga0500577_0009143 3300053142 Bacteria 2863
244 Ga0500577_0032401 3300053142 Bacteria 1837
245 Ga0500589_125243 3300053147 Bacteria 1081
246 Ga0500616_0000491 3300053153 Bacteria 51066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005262 Ga0065165_1006181 Ga0065165_10061812 126
2 3300005436 Ga0070713_101059803 Ga0070713_1010598032 126
3 3300009098 Ga0105245_10224871 Ga0105245_102248711 126
4 3300010375 Ga0105239_10253462 Ga0105239_102534622 126
5 3300025927 Ga0207687_10555976 Ga0207687_105559762 126
6 3300048905 Ga0496102_0069534 Ga0496102_0069534_303_725 126
7 3300048908 Ga0496105_0427603 Ga0496105_0427603_581_1006 126
8 3300048912 Ga0496109_0125436 Ga0496109_0125436_1805_2227 126
9 3300048913 Ga0496110_0187544 Ga0496110_0187544_528_950 126
10 3300050492 nmdc:mga0yw44_5971_c1 nmdc:mga0yw44_5971_c1_5347_5769 126
11 3300031824 Ga0307413_10339869 Ga0307413_103398692 127
12 3300048929 Ga0496126_0014212 Ga0496126_0014212_5078_5500 127
13 3300049571 Ga0501034_1067633 Ga0501034_1067633_88_510 127
14 3300005435 Ga0070714_100820724 Ga0070714_1008207242 128
15 3300014326 Ga0157380_12123051 Ga0157380_121230512 128
16 3300025925 Ga0207650_10557075 Ga0207650_105570752 128
17 3300025929 Ga0207664_10706786 Ga0207664_107067862 128
18 3300048904 Ga0496101_0583806 Ga0496101_0583806_150_563 128
19 3300048917 Ga0496114_0374740 Ga0496114_0374740_682_1095 128
20 3300053139 Ga0500568_0028667 Ga0500568_0028667_1865_2299 128
21 3300053153 Ga0500616_0000491 Ga0500616_0000491_13400_13834 128
22 iso_pu_bacteria 2600255283 2601624018 128
23 3300009094 Ga0111539_10338899 Ga0111539_103388991 129
24 3300009147 Ga0114129_12588400 Ga0114129_125884002 129
25 3300009553 Ga0105249_13328818 Ga0105249_133288182 129
26 3300027907 Ga0207428_11128457 Ga0207428_111284572 129
27 3300037853 Ga0436364_1157251 Ga0436364_1157251_815_1228 129
28 3300046501 Ga0495607_0000329 Ga0495607_0000329_32122_32532 129
29 3300050511 nmdc:mga08y16_632304_c1 nmdc:mga08y16_632304_c1_318_719 129
30 iso_pu_bacteria 2751185782 2753270302 129
31 iso_pu_bacteria 8054913762 8054920434 129
32 3300005288 Ga0065714_10181427 Ga0065714_101814272 130
33 3300005354 Ga0070675_100325045 Ga0070675_1003250452 130
34 3300006058 Ga0075432_10008627 Ga0075432_100086274 130
35 3300006163 Ga0070715_10151037 Ga0070715_101510372 130
36 3300006195 Ga0075366_10299880 Ga0075366_102998803 130
37 3300009036 Ga0105244_10003626 Ga0105244_100036267 130
38 3300009036 Ga0105244_10033039 Ga0105244_100330395 130
39 3300009092 Ga0105250_10008071 Ga0105250_100080713 130
40 3300009093 Ga0105240_10011935 Ga0105240_100119353 130
41 3300009148 Ga0105243_10663633 Ga0105243_106636332 130
42 3300009176 Ga0105242_10148280 Ga0105242_101482802 130
43 3300011119 Ga0105246_10321668 Ga0105246_103216682 130
44 3300013100 Ga0157373_10016704 Ga0157373_100167044 130
45 3300013306 Ga0163162_10035644 Ga0163162_100356444 130
46 3300013308 Ga0157375_10047707 Ga0157375_100477074 130
47 3300017792 Ga0163161_10010315 Ga0163161_100103155 130
48 3300025711 Ga0207696_1014833 Ga0207696_10148333 130
49 3300025728 Ga0207655_1005619 Ga0207655_10056195 130
50 3300025728 Ga0207655_1007806 Ga0207655_10078062 130
51 3300025905 Ga0207685_10454901 Ga0207685_104549012 130
52 3300025913 Ga0207695_10319094 Ga0207695_103190942 130
53 3300025925 Ga0207650_10507785 Ga0207650_105077853 130
54 3300025935 Ga0207709_10735057 Ga0207709_107350572 130
55 3300039437 Ga0436365_0649287 Ga0436365_0649287_25_429 130
56 3300041451 Ga0451791_0861333 Ga0451791_0861333_450_842 130
57 3300046460 Ga0495638_0006928 Ga0495638_0006928_6351_6755 130
58 3300046460 Ga0495638_0032832 Ga0495638_0032832_2468_2872 130
59 3300046460 Ga0495638_0089138 Ga0495638_0089138_562_966 130
60 3300046460 Ga0495638_0170045 Ga0495638_0170045_150_554 130
61 3300046471 Ga0495650_0002207 Ga0495650_0002207_14931_15335 130
62 3300046471 Ga0495650_0235512 Ga0495650_0235512_140_544 130
63 3300046501 Ga0495607_0000311 Ga0495607_0000311_33030_33434 130
64 3300046501 Ga0495607_0005746 Ga0495607_0005746_460_864 130
65 3300046506 Ga0495583_0000339 Ga0495583_0000339_14433_14837 130
66 3300046512 Ga0495610_0006924 Ga0495610_0006924_3659_4063 130
67 3300046519 Ga0495632_0000287 Ga0495632_0000287_23019_23423 130
68 3300046519 Ga0495632_0003592 Ga0495632_0003592_2473_2877 130
69 3300046519 Ga0495632_0201412 Ga0495632_0201412_201_605 130
70 3300046520 Ga0495637_0000434 Ga0495637_0000434_10975_11379 130
71 3300046520 Ga0495637_0000807 Ga0495637_0000807_16504_16908 130
72 3300046520 Ga0495637_0006910 Ga0495637_0006910_648_1052 130
73 3300046520 Ga0495637_0024050 Ga0495637_0024050_2155_2559 130
74 3300046522 Ga0495643_0149183 Ga0495643_0149183_423_827 130
75 3300046530 Ga0495654_0000990 Ga0495654_0000990_14055_14459 130
76 3300046665 Ga0495661_0000298 Ga0495661_0000298_31864_32268 130
77 3300046694 Ga0495649_0004544 Ga0495649_0004544_5554_5958 130
78 3300046694 Ga0495649_0007088 Ga0495649_0007088_4381_4785 130
79 3300046794 Ga0495589_0004097 Ga0495589_0004097_4785_5189 130
80 3300048924 Ga0496121_0002431 Ga0496121_0002431_27226_27630 130
81 3300048925 Ga0496122_0000175 Ga0496122_0000175_4076_4480 130
82 3300048926 Ga0496123_0000079 Ga0496123_0000079_148830_149234 130
83 iso_pu_bacteria 2643221678 2644441735 130
84 iso_pu_bacteria 2808606359 2808846759 130
85 iso_pu_bacteria 2884994152 2884995865 130
86 3300003203 JGI25406J46586_10082864 JGI25406J46586_100828642 131
87 3300005985 Ga0081539_10001271 Ga0081539_1000127129 131
88 3300031548 Ga0307408_100833865 Ga0307408_1008338652 131
89 3300031824 Ga0307413_10396034 Ga0307413_103960342 131
90 3300031889 Ga0326468_10000241 Ga0326468_100002413 131
91 3300031901 Ga0307406_10401910 Ga0307406_104019102 131
92 3300031903 Ga0307407_10025737 Ga0307407_100257372 131
93 3300031911 Ga0307412_10376683 Ga0307412_103766832 131
94 3300031995 Ga0307409_100395373 Ga0307409_1003953732 131
95 3300032002 Ga0307416_103380759 Ga0307416_1033807591 131
96 3300032005 Ga0307411_10150677 Ga0307411_101506772 131
97 3300032126 Ga0307415_100131391 Ga0307415_1001313912 131
98 3300039450 Ga0436363_1249388 Ga0436363_1249388_570_977 131
99 3300041463 Ga0451804_0040196 Ga0451804_0040196_82_477 131
100 3300042012 Ga0439455_0114553 Ga0439455_0114553_273_668 131
101 3300042137 Ga0450902_019007 Ga0450902_019007_228_623 131
102 3300045976 Ga0466967_0053585 Ga0466967_0053585_2650_3045 131
103 iso_pu_bacteria 2839986021 2839986701 131
104 iso_pu_bacteria 2932431166 2932432547 131
105 iso_pu_bacteria 2966598605 2966604864 131
106 3300003771 Ga0055526_1000694 Ga0055526_100069415 132
107 3300025295 Ga0209564_1000776 Ga0209564_100077619 132
108 3300046683 Ga0495658_0718526 Ga0495658_0718526_156_572 132
109 3300005329 Ga0070683_100439134 Ga0070683_1004391342 133
110 3300005435 Ga0070714_100000013 Ga0070714_100000013128 133
111 3300025904 Ga0207647_10081760 Ga0207647_100817602 133
112 3300025929 Ga0207664_10000001 Ga0207664_10000001635 133
113 3300025929 Ga0207664_10347648 Ga0207664_103476482 133
114 3300025944 Ga0207661_10366475 Ga0207661_103664752 133
115 3300031241 Ga0265325_10214141 Ga0265325_102141412 133
116 3300035241 Ga0373961_0071536 Ga0373961_0071536_276_704 133
117 3300046463 Ga0495653_0783265 Ga0495653_0783265_28_444 133
118 3300046674 Ga0495588_0071567 Ga0495588_0071567_92_505 133
119 3300046675 Ga0495657_0650356 Ga0495657_0650356_32_448 133
120 3300047447 Ga0495685_103138 Ga0495685_103138_319_732 133
121 3300048929 Ga0496126_1252639 Ga0496126_1252639_32_448 133
122 3300053084 Ga0495595_0326254 Ga0495595_0326254_175_591 133
123 iso_pu_bacteria 2929219909 2929220190 133
124 3300003203 JGI25406J46586_10024545 JGI25406J46586_100245451 134
125 3300003578 Ga0006562J51391_1109706 Ga0006562J51391_11097063 134
126 3300005327 Ga0070658_10265695 Ga0070658_102656951 134
127 3300005327 Ga0070658_10619786 Ga0070658_106197862 134
128 3300005347 Ga0070668_100030190 Ga0070668_1000301902 134
129 3300005355 Ga0070671_101566652 Ga0070671_1015666521 134
130 3300005367 Ga0070667_101103528 Ga0070667_1011035282 134
131 3300005436 Ga0070713_102307240 Ga0070713_1023072401 134
132 3300005455 Ga0070663_100020032 Ga0070663_1000200324 134
133 3300005455 Ga0070663_100584149 Ga0070663_1005841492 134
134 3300005456 Ga0070678_101192051 Ga0070678_1011920511 134
135 3300005466 Ga0070685_11289057 Ga0070685_112890571 134
136 3300005530 Ga0070679_100795417 Ga0070679_1007954172 134
137 3300005539 Ga0068853_100068595 Ga0068853_1000685953 134
138 3300005544 Ga0070686_101217989 Ga0070686_1012179891 134
139 3300005548 Ga0070665_100053559 Ga0070665_1000535596 134
140 3300005548 Ga0070665_100422293 Ga0070665_1004222932 134
141 3300005548 Ga0070665_101372209 Ga0070665_1013722092 134
142 3300005563 Ga0068855_100010603 Ga0068855_10001060311 134
143 3300005563 Ga0068855_100010603 Ga0068855_1000106037 134
144 3300005578 Ga0068854_100034257 Ga0068854_1000342573 134
145 3300005578 Ga0068854_100039043 Ga0068854_1000390433 134
146 3300005616 Ga0068852_100002599 Ga0068852_10000259911 134
147 3300005616 Ga0068852_100002599 Ga0068852_1000025997 134
148 3300005834 Ga0068851_10129262 Ga0068851_101292622 134
149 3300005841 Ga0068863_100295930 Ga0068863_1002959303 134
150 3300005842 Ga0068858_100015114 Ga0068858_1000151146 134
151 3300005843 Ga0068860_100236856 Ga0068860_1002368562 134
152 3300005937 Ga0081455_10809647 Ga0081455_108096472 134
153 3300005983 Ga0081540_1025620 Ga0081540_10256202 134
154 3300005985 Ga0081539_10002480 Ga0081539_1000248020 134
155 3300005985 Ga0081539_10003880 Ga0081539_100038809 134
156 3300005985 Ga0081539_10025052 Ga0081539_100250524 134
157 3300006038 Ga0075365_10553994 Ga0075365_105539942 134
158 3300006051 Ga0075364_10719409 Ga0075364_107194092 134
159 3300006846 Ga0075430_101092843 Ga0075430_1010928431 134
160 3300009093 Ga0105240_10025821 Ga0105240_1002582111 134
161 3300009093 Ga0105240_10025821 Ga0105240_100258217 134
162 3300009147 Ga0114129_10270011 Ga0114129_102700112 134
163 3300009174 Ga0105241_10002124 Ga0105241_1000212413 134
164 3300009174 Ga0105241_10002124 Ga0105241_100021249 134
165 3300009177 Ga0105248_10566574 Ga0105248_105665742 134
166 3300009545 Ga0105237_10017230 Ga0105237_100172307 134
167 3300009545 Ga0105237_10041641 Ga0105237_100416413 134
168 3300009551 Ga0105238_10018236 Ga0105238_100182362 134
169 3300009551 Ga0105238_10018236 Ga0105238_100182366 134
170 3300010375 Ga0105239_10128529 Ga0105239_101285292 134
171 3300010375 Ga0105239_10358403 Ga0105239_103584033 134
172 3300013296 Ga0157374_10704356 Ga0157374_107043561 134
173 3300013296 Ga0157374_11225491 Ga0157374_112254911 134
174 3300013297 Ga0157378_10229632 Ga0157378_102296323 134
175 3300013308 Ga0157375_11461639 Ga0157375_114616392 134
176 3300014325 Ga0163163_10858580 Ga0163163_108585801 134
177 3300014968 Ga0157379_10084156 Ga0157379_100841565 134
178 3300014968 Ga0157379_11172911 Ga0157379_111729112 134
179 3300014969 Ga0157376_11209760 Ga0157376_112097601 134
180 3300020069 Ga0197907_11228130 Ga0197907_112281303 134
181 3300020076 Ga0206355_1281206 Ga0206355_12812061 134
182 3300020080 Ga0206350_11061538 Ga0206350_110615381 134
183 3300020082 Ga0206353_10837477 Ga0206353_108374773 134
184 3300022467 Ga0224712_10068589 Ga0224712_100685893 134
185 3300025321 Ga0207656_10071250 Ga0207656_100712503 134
186 3300025904 Ga0207647_10003964 Ga0207647_100039644 134
187 3300025904 Ga0207647_10003964 Ga0207647_100039648 134
188 3300025911 Ga0207654_10013421 Ga0207654_100134214 134
189 3300025911 Ga0207654_10026393 Ga0207654_100263933 134
190 3300025913 Ga0207695_10007586 Ga0207695_100075863 134
191 3300025913 Ga0207695_10007586 Ga0207695_100075867 134
192 3300025914 Ga0207671_10001734 Ga0207671_100017343 134
193 3300025914 Ga0207671_10001734 Ga0207671_100017347 134
194 3300025924 Ga0207694_10005933 Ga0207694_1000593311 134
195 3300025924 Ga0207694_10005933 Ga0207694_100059337 134
196 3300025931 Ga0207644_10340113 Ga0207644_103401132 134
197 3300025940 Ga0207691_11211097 Ga0207691_112110971 134
198 3300025949 Ga0207667_10036015 Ga0207667_100360157 134
199 3300025949 Ga0207667_10185215 Ga0207667_101852153 134
200 3300025961 Ga0207712_11002633 Ga0207712_110026331 134
201 3300025972 Ga0207668_10031750 Ga0207668_100317506 134
202 3300025972 Ga0207668_10788057 Ga0207668_107880572 134
203 3300025981 Ga0207640_10079834 Ga0207640_100798342 134
204 3300025986 Ga0207658_10055328 Ga0207658_100553283 134
205 3300025986 Ga0207658_11287457 Ga0207658_112874572 134
206 3300026023 Ga0207677_10727853 Ga0207677_107278532 134
207 3300026041 Ga0207639_10041449 Ga0207639_100414494 134
208 3300026041 Ga0207639_10048166 Ga0207639_100481663 134
209 3300026067 Ga0207678_10040881 Ga0207678_100408813 134
210 3300026078 Ga0207702_10575620 Ga0207702_105756202 134
211 3300026088 Ga0207641_11013012 Ga0207641_110130122 134
212 3300026121 Ga0207683_10325950 Ga0207683_103259502 134
213 3300026142 Ga0207698_10020775 Ga0207698_100207755 134
214 3300028379 Ga0268266_10127315 Ga0268266_101273151 134
215 3300028381 Ga0268264_10065455 Ga0268264_100654555 134
216 3300028794 Ga0307515_10000038 Ga0307515_10000038223 134
217 3300028794 Ga0307515_10500449 Ga0307515_105004492 134
218 3300030521 Ga0307511_10242496 Ga0307511_102424962 134
219 3300030522 Ga0307512_10020532 Ga0307512_100205325 134
220 3300031456 Ga0307513_10823670 Ga0307513_108236702 134
221 3300031507 Ga0307509_10025678 Ga0307509_100256782 134
222 3300031507 Ga0307509_10087979 Ga0307509_100879793 134
223 3300031548 Ga0307408_100057555 Ga0307408_1000575554 134
224 3300031548 Ga0307408_100619505 Ga0307408_1006195052 134
225 3300031731 Ga0307405_10018429 Ga0307405_100184297 134
226 3300031731 Ga0307405_10183663 Ga0307405_101836633 134
227 3300031824 Ga0307413_10092538 Ga0307413_100925383 134
228 3300031852 Ga0307410_10339944 Ga0307410_103399442 134
229 3300031852 Ga0307410_11266354 Ga0307410_112663542 134
230 3300031901 Ga0307406_10004001 Ga0307406_1000400110 134
231 3300031901 Ga0307406_10064281 Ga0307406_100642813 134
232 3300031901 Ga0307406_10869620 Ga0307406_108696201 134
233 3300031903 Ga0307407_10651348 Ga0307407_106513482 134
234 3300031903 Ga0307407_10776496 Ga0307407_107764962 134
235 3300031911 Ga0307412_10072427 Ga0307412_100724272 134
236 3300031911 Ga0307412_10446627 Ga0307412_104466273 134
237 3300031995 Ga0307409_100116626 Ga0307409_1001166262 134
238 3300031995 Ga0307409_102796855 Ga0307409_1027968551 134
239 3300032002 Ga0307416_102549551 Ga0307416_1025495512 134
240 3300032004 Ga0307414_11436724 Ga0307414_114367242 134
241 3300032005 Ga0307411_11272295 Ga0307411_112722952 134
242 3300032126 Ga0307415_100009296 Ga0307415_1000092966 134
243 3300032126 Ga0307415_100278244 Ga0307415_1002782442 134
244 3300032126 Ga0307415_100422933 Ga0307415_1004229332 134
245 3300032126 Ga0307415_100739850 Ga0307415_1007398502 134
246 3300035091 Ga0373951_0000125 Ga0373951_0000125_16905_17312 134
247 3300035691 Ga0373931_1074912 Ga0373931_1074912_106_513 134
248 3300044765 Ga0466970_0002306 Ga0466970_0002306_6608_7054 134
249 3300046507 Ga0495606_0001394 Ga0495606_0001394_22685_23101 134
250 3300046616 Ga0495668_0001004 Ga0495668_0001004_23501_23917 134
251 3300046660 Ga0495625_0000363 Ga0495625_0000363_12986_13402 134
252 3300047315 Ga0495581_0244688 Ga0495581_0244688_113_541 134
253 3300047323 Ga0495683_0127149 Ga0495683_0127149_47_463 134
254 3300048091 Ga0495626_0000052 Ga0495626_0000052_78923_79339 134
255 3300048911 Ga0496108_0000035 Ga0496108_0000035_17260_17664 134
256 3300048914 Ga0496111_0207595 Ga0496111_0207595_636_1052 134
257 3300048927 Ga0496124_0231515 Ga0496124_0231515_693_1109 134
258 3300048929 Ga0496126_0633041 Ga0496126_0633041_24_440 134
259 3300049581 Ga0501047_0313846 Ga0501047_0313846_682_1107 134
260 3300050492 nmdc:mga0yw44_484098_c1 nmdc:mga0yw44_484098_c1_243_668 134
261 3300050507 nmdc:mga05p37_1451643_c1 nmdc:mga05p37_1451643_c1_226_645 134
262 3300053108 Ga0500562_043835 Ga0500562_043835_702_1115 134
263 3300053142 Ga0500577_0009143 Ga0500577_0009143_113_526 134
264 3300053142 Ga0500577_0032401 Ga0500577_0032401_123_536 134
265 3300053147 Ga0500589_125243 Ga0500589_125243_308_721 134
266 iso_pu_bacteria 2622736626 2623586079 134
267 iso_pu_bacteria 2675903059 2676480537 134
268 iso_pu_bacteria 2773857921 2774849583 134
269 iso_pu_bacteria 2831935698 2831940756 134
270 iso_pu_bacteria 2832004796 2832009619 134
271 iso_pu_bacteria 2855670206 2855671713 134
272 iso_pu_bacteria 2855676851 2855683188 134
273 iso_pu_bacteria 2857288857 2857294287 134
274 iso_pu_bacteria 2858848962 2858852359 134
275 iso_pu_bacteria 2858882152 2858887892 134
276 iso_pu_bacteria 2858888857 2858895135 134
277 iso_pu_bacteria 2858895516 2858898876 134
278 iso_pu_bacteria 2858902515 2858904639 134
279 iso_pu_bacteria 2866065130 2866065519 134
280 iso_pu_bacteria 2867507094 2867508705 134
281 iso_pu_bacteria 2869048445 2869054478 134
282 iso_pu_bacteria 2869061728 2869068021 134
283 iso_pu_bacteria 2869068681 2869071093 134
284 iso_pu_bacteria 2880495981 2880498147 134
285 iso_pu_bacteria 2887478801 2887485149 134
286 iso_pu_bacteria 2929226422 2929226724 134
287 iso_pu_bacteria 8003830390 8003832562 134
288 iso_pu_bacteria 8003856774 8003858141 134
289 iso_pu_bacteria 8003870546 8003875399 134
290 iso_pu_bacteria 8054704163 8054705460 134
291 iso_pu_bacteria 8054734606 8054740829 134
292 iso_pu_bacteria 8055412473 8055413289 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

62

161

0.88

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

37

158

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e4g-assembly1.cif.gz_C crystal structure of schizorhodopsin 4 0.8908 16 55
7e4g-assembly1.cif.gz_A crystal structure of schizorhodopsin 4 0.8907 16 55
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8162 1 131
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8149 2 134
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8098 6 132
ID Description Score Start End Superfamily
af_P37366_98_210_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.8864 12 47 1.10.472.10
5n9gF01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.843 12 52 1.10.472.10
4c5sA03 Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Phenylalanine ammonia-lyase 1; domain 3 0.823 13 45 1.10.274.20
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7928 5 131 3.30.565.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7765 5 131 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A2V7L193-F1-model_v4 ATP-binding protein 0.9807 6 134 GO:0004674
GO:0005524
AF-A0A6J4NXT3-F1-model_v4 Anti-sigma B factor RsbT 0.9731 4 96
AF-A0A2V9K0T1-F1-model_v4 ATP-binding protein 0.9675 5 89 GO:0005524
AF-A0A1Q7RXW0-F1-model_v4 ATP-binding protein 0.9671 5 134 GO:0004674
GO:0005524
AF-A0A537D733-F1-model_v4 Anti-sigma regulatory factor 0.9668 4 133 GO:0004674

Feature Viewer

pLDDT pTM Quality
92.55 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map