F390302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 291 | 181 | 291 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10511447|Ga0105240_105114472 |
| Length | 193 |
| Sequence | LTARRRRPAALGIHAQAVQNGGEFAIPDLEGAPMYKTKIDLSEKIRRNVINILNDRLADAIDLQSQVKQAHWNVKGPNFIALHELFDKISDEVLEHIDDLAERITSLGGTAEGTVAVAAKRSKLKNYPLSITAGKDHLFYLSTQLSVYGKAVRAGIDDADKLGDADTADLFTEISRETDKYLWFLEAHLQEKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 114 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 115 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 120 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 141 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 142 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 143 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 144 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 145 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 146 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 147 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 148 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 149 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 150 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 151 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 154 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 157 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 164 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 165 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 166 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 169 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 172 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 173 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 179 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 180 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 181 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.25 |
| Metatranscriptomes | 2.75 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.03 |
| Nodule | 0 |
| Rhizoplane | 7.22 |
| Rhizosphere | 91.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1007771 | 3300000546 | Archaea | 1155 |
| 2 | Ga0065715_10777895 | 3300005293 | Bacteria | 619 |
| 3 | Ga0070658_11743332 | 3300005327 | Unclassified | 539 |
| 4 | Ga0070683_100018620 | 3300005329 | Bacteria | 6154 |
| 5 | Ga0070690_100001165 | 3300005330 | Bacteria | 13521 |
| 6 | Ga0070690_100690000 | 3300005330 | Bacteria | 783 |
| 7 | Ga0070666_10000467 | 3300005335 | Bacteria | 24463 |
| 8 | Ga0070680_100000310 | 3300005336 | Bacteria | 32525 |
| 9 | Ga0070680_100080417 | 3300005336 | Bacteria | 2687 |
| 10 | Ga0070680_100095448 | 3300005336 | Bacteria | 2465 |
| 11 | Ga0070682_100122291 | 3300005337 | Bacteria | 1750 |
| 12 | Ga0070689_100055761 | 3300005340 | Bacteria | 3063 |
| 13 | Ga0070674_100057889 | 3300005356 | Bacteria | 2692 |
| 14 | Ga0070673_100204463 | 3300005364 | Unclassified | 1702 |
| 15 | Ga0070673_100464467 | 3300005364 | Bacteria | 1140 |
| 16 | Ga0070667_100004454 | 3300005367 | Bacteria | 11810 |
| 17 | Ga0070709_10045491 | 3300005434 | Bacteria | 2724 |
| 18 | Ga0070714_100004693 | 3300005435 | Bacteria | 10330 |
| 19 | Ga0070714_100021592 | 3300005435 | Bacteria | 5268 |
| 20 | Ga0070713_100029008 | 3300005436 | Bacteria | 4375 |
| 21 | Ga0070713_100043459 | 3300005436 | Bacteria | 3674 |
| 22 | Ga0070713_100271283 | 3300005436 | Bacteria | 1554 |
| 23 | Ga0070710_10007211 | 3300005437 | Bacteria | 5373 |
| 24 | Ga0070710_10032185 | 3300005437 | Bacteria | 2839 |
| 25 | Ga0070710_10273056 | 3300005437 | Unclassified | 1094 |
| 26 | Ga0070711_100006856 | 3300005439 | Bacteria | 6897 |
| 27 | Ga0070711_100013615 | 3300005439 | Bacteria | 5110 |
| 28 | Ga0070711_100052159 | 3300005439 | Bacteria | 2814 |
| 29 | Ga0070705_100224824 | 3300005440 | Bacteria | 1302 |
| 30 | Ga0070708_100019698 | 3300005445 | Bacteria | 5675 |
| 31 | Ga0070708_100478735 | 3300005445 | Unclassified | 1175 |
| 32 | Ga0070663_100637460 | 3300005455 | Bacteria | 900 |
| 33 | Ga0070681_10020714 | 3300005458 | Bacteria | 6587 |
| 34 | Ga0070681_10020979 | 3300005458 | Bacteria | 6545 |
| 35 | Ga0068867_100015242 | 3300005459 | Bacteria | 5451 |
| 36 | Ga0070706_100464201 | 3300005467 | Bacteria | 1178 |
| 37 | Ga0070707_100211348 | 3300005468 | Bacteria | 1891 |
| 38 | Ga0070698_100373111 | 3300005471 | Bacteria | 1359 |
| 39 | Ga0070699_100122478 | 3300005518 | Bacteria | 2288 |
| 40 | Ga0070699_100773261 | 3300005518 | Bacteria | 878 |
| 41 | Ga0070679_100001074 | 3300005530 | Bacteria | 23895 |
| 42 | Ga0070679_100084703 | 3300005530 | Bacteria | 3158 |
| 43 | Ga0070679_100197231 | 3300005530 | Bacteria | 1980 |
| 44 | Ga0070684_100018468 | 3300005535 | Bacteria | 5745 |
| 45 | Ga0070697_100096104 | 3300005536 | Bacteria | 2458 |
| 46 | Ga0070672_100001333 | 3300005543 | Bacteria | 15223 |
| 47 | Ga0070695_100313692 | 3300005545 | Bacteria | 1163 |
| 48 | Ga0070696_100000267 | 3300005546 | Bacteria | 31493 |
| 49 | Ga0070696_100265179 | 3300005546 | Bacteria | 1304 |
| 50 | Ga0070696_101016587 | 3300005546 | Bacteria | 693 |
| 51 | Ga0070665_100000552 | 3300005548 | Bacteria | 52249 |
| 52 | Ga0070665_100018711 | 3300005548 | Bacteria | 6945 |
| 53 | Ga0070704_100059840 | 3300005549 | Bacteria | 2719 |
| 54 | Ga0068855_100004496 | 3300005563 | Bacteria | 17043 |
| 55 | Ga0068855_100156160 | 3300005563 | Bacteria | 2592 |
| 56 | Ga0068855_100157845 | 3300005563 | Bacteria | 2576 |
| 57 | Ga0068855_100971319 | 3300005563 | Bacteria | 894 |
| 58 | Ga0068855_101850983 | 3300005563 | Bacteria | 612 |
| 59 | Ga0068854_100721519 | 3300005578 | Bacteria | 862 |
| 60 | Ga0068856_100017320 | 3300005614 | Bacteria | 6986 |
| 61 | Ga0068856_100140670 | 3300005614 | Bacteria | 2420 |
| 62 | Ga0068856_100852298 | 3300005614 | Bacteria | 930 |
| 63 | Ga0070702_100232958 | 3300005615 | Unclassified | 1238 |
| 64 | Ga0068859_100011570 | 3300005617 | Bacteria | 8873 |
| 65 | Ga0068859_100038136 | 3300005617 | Bacteria | 4822 |
| 66 | Ga0068859_100677944 | 3300005617 | Bacteria | 1122 |
| 67 | Ga0068864_100067746 | 3300005618 | Bacteria | 3100 |
| 68 | Ga0068863_100058263 | 3300005841 | Bacteria | 3656 |
| 69 | Ga0068858_100001625 | 3300005842 | Bacteria | 22912 |
| 70 | Ga0068860_100000924 | 3300005843 | Bacteria | 32627 |
| 71 | Ga0068860_101631112 | 3300005843 | Bacteria | 667 |
| 72 | Ga0068862_100536863 | 3300005844 | Bacteria | 1115 |
| 73 | Ga0081455_10439296 | 3300005937 | Bacteria | 895 |
| 74 | Ga0081539_10000007 | 3300005985 | Bacteria | 532790 |
| 75 | Ga0070717_10000590 | 3300006028 | Bacteria | 23217 |
| 76 | Ga0070715_10466365 | 3300006163 | Unclassified | 716 |
| 77 | Ga0070712_100036318 | 3300006175 | Bacteria | 3352 |
| 78 | Ga0070712_100106874 | 3300006175 | Bacteria | 2081 |
| 79 | Ga0070712_100394264 | 3300006175 | Bacteria | 1142 |
| 80 | Ga0070712_100437410 | 3300006175 | Bacteria | 1087 |
| 81 | Ga0097621_100811065 | 3300006237 | Bacteria | 867 |
| 82 | Ga0075428_100371370 | 3300006844 | Unclassified | 1534 |
| 83 | Ga0075430_100031941 | 3300006846 | Bacteria | 4469 |
| 84 | Ga0075433_10006176 | 3300006852 | Bacteria | 9449 |
| 85 | Ga0075433_10125822 | 3300006852 | Bacteria | 2276 |
| 86 | Ga0075434_100015501 | 3300006871 | Bacteria | 7311 |
| 87 | Ga0075434_100185600 | 3300006871 | Bacteria | 2100 |
| 88 | Ga0068865_100593268 | 3300006881 | Unclassified | 935 |
| 89 | Ga0075436_100029918 | 3300006914 | Bacteria | 3746 |
| 90 | Ga0097620_100011570 | 3300006931 | Bacteria | 8873 |
| 91 | Ga0097620_100038135 | 3300006931 | Bacteria | 4822 |
| 92 | Ga0097620_100677846 | 3300006931 | Bacteria | 1122 |
| 93 | Ga0075435_100535956 | 3300007076 | Bacteria | 1013 |
| 94 | Ga0099794_10226068 | 3300007265 | Archaea | 962 |
| 95 | Ga0099794_10403115 | 3300007265 | Unclassified | 714 |
| 96 | Ga0099795_10007383 | 3300007788 | Bacteria | 3064 |
| 97 | Ga0099795_10066008 | 3300007788 | Bacteria | 1354 |
| 98 | Ga0099795_10251211 | 3300007788 | Unclassified | 763 |
| 99 | Ga0105240_10000847 | 3300009093 | Bacteria | 55095 |
| 100 | Ga0105240_10024775 | 3300009093 | Bacteria | 7902 |
| 101 | Ga0105240_10027364 | 3300009093 | Bacteria | 7465 |
| 102 | Ga0105240_10165531 | 3300009093 | Bacteria | 2623 |
| 103 | Ga0105240_10511447 | 3300009093 | Bacteria | 1334 |
| 104 | Ga0105247_10035266 | 3300009101 | Bacteria | 3049 |
| 105 | Ga0105248_10006845 | 3300009177 | Bacteria | 12496 |
| 106 | Ga0105237_10510654 | 3300009545 | Unclassified | 1208 |
| 107 | Ga0105237_11545039 | 3300009545 | Bacteria | 670 |
| 108 | Ga0105238_10001146 | 3300009551 | Bacteria | 26746 |
| 109 | Ga0105238_10102025 | 3300009551 | Bacteria | 2851 |
| 110 | Ga0105238_10671881 | 3300009551 | Bacteria | 1047 |
| 111 | Ga0105238_11363343 | 3300009551 | Bacteria | 736 |
| 112 | Ga0105238_11464468 | 3300009551 | Bacteria | 711 |
| 113 | Ga0099796_10002480 | 3300010159 | Bacteria | 4056 |
| 114 | Ga0099796_10091153 | 3300010159 | Bacteria | 1133 |
| 115 | Ga0105239_10015925 | 3300010375 | Bacteria | 8321 |
| 116 | Ga0105239_10893596 | 3300010375 | Unclassified | 1019 |
| 117 | Ga0157370_10000396 | 3300013104 | Bacteria | 54821 |
| 118 | Ga0157370_10243599 | 3300013104 | Bacteria | 1663 |
| 119 | Ga0157370_10969415 | 3300013104 | Unclassified | 770 |
| 120 | Ga0157369_10010072 | 3300013105 | Bacteria | 10792 |
| 121 | Ga0157369_10041843 | 3300013105 | Bacteria | 5000 |
| 122 | Ga0157369_10565223 | 3300013105 | Unclassified | 1175 |
| 123 | Ga0157374_10218517 | 3300013296 | Unclassified | 1870 |
| 124 | Ga0157378_10004289 | 3300013297 | Bacteria | 12556 |
| 125 | Ga0157372_11202463 | 3300013307 | Unclassified | 876 |
| 126 | Ga0157372_11527132 | 3300013307 | Bacteria | 769 |
| 127 | Ga0157375_10179931 | 3300013308 | Unclassified | 2265 |
| 128 | Ga0163163_12136616 | 3300014325 | Bacteria | 619 |
| 129 | Ga0157380_11273176 | 3300014326 | Bacteria | 782 |
| 130 | Ga0157379_10012170 | 3300014968 | Bacteria | 7515 |
| 131 | Ga0157376_10001559 | 3300014969 | Bacteria | 15146 |
| 132 | Ga0157376_10321960 | 3300014969 | Bacteria | 1470 |
| 133 | Ga0206356_10053723 | 3300020070 | Unclassified | 619 |
| 134 | Ga0206352_10019620 | 3300020078 | Bacteria | 565 |
| 135 | Ga0224712_10275260 | 3300022467 | Bacteria | 782 |
| 136 | Ga0207692_10088930 | 3300025898 | Bacteria | 1670 |
| 137 | Ga0207692_10122373 | 3300025898 | Bacteria | 1459 |
| 138 | Ga0207699_10045710 | 3300025906 | Bacteria | 2557 |
| 139 | Ga0207699_10370651 | 3300025906 | Bacteria | 1014 |
| 140 | Ga0207699_10425348 | 3300025906 | Unclassified | 949 |
| 141 | Ga0207705_10721396 | 3300025909 | Bacteria | 775 |
| 142 | Ga0207684_10863847 | 3300025910 | Bacteria | 762 |
| 143 | Ga0207707_10000104 | 3300025912 | Bacteria | 83446 |
| 144 | Ga0207707_10004033 | 3300025912 | Bacteria | 13023 |
| 145 | Ga0207707_10006165 | 3300025912 | Bacteria | 10475 |
| 146 | Ga0207707_10020734 | 3300025912 | Bacteria | 5741 |
| 147 | Ga0207707_10064092 | 3300025912 | Bacteria | 3199 |
| 148 | Ga0207695_10003434 | 3300025913 | Bacteria | 22352 |
| 149 | Ga0207695_10042395 | 3300025913 | Bacteria | 4861 |
| 150 | Ga0207695_10065744 | 3300025913 | Bacteria | 3727 |
| 151 | Ga0207695_10127759 | 3300025913 | Bacteria | 2502 |
| 152 | Ga0207695_10222793 | 3300025913 | Unclassified | 1793 |
| 153 | Ga0207695_10251397 | 3300025913 | Bacteria | 1667 |
| 154 | Ga0207671_10203583 | 3300025914 | Unclassified | 1546 |
| 155 | Ga0207693_10167986 | 3300025915 | Unclassified | 1727 |
| 156 | Ga0207693_10357515 | 3300025915 | Bacteria | 1142 |
| 157 | Ga0207693_10605279 | 3300025915 | Bacteria | 853 |
| 158 | Ga0207663_10040463 | 3300025916 | Bacteria | 2833 |
| 159 | Ga0207663_10249122 | 3300025916 | Bacteria | 1306 |
| 160 | Ga0207663_10253453 | 3300025916 | Bacteria | 1296 |
| 161 | Ga0207663_10347734 | 3300025916 | Bacteria | 1122 |
| 162 | Ga0207660_10002002 | 3300025917 | Bacteria | 13567 |
| 163 | Ga0207660_10088299 | 3300025917 | Bacteria | 2292 |
| 164 | Ga0207660_10271067 | 3300025917 | Bacteria | 1345 |
| 165 | Ga0207649_10277256 | 3300025920 | Bacteria | 1218 |
| 166 | Ga0207652_10000756 | 3300025921 | Bacteria | 31084 |
| 167 | Ga0207652_10187114 | 3300025921 | Bacteria | 1862 |
| 168 | Ga0207652_10249468 | 3300025921 | Bacteria | 1601 |
| 169 | Ga0207694_10007642 | 3300025924 | Bacteria | 8190 |
| 170 | Ga0207694_10116858 | 3300025924 | Bacteria | 2126 |
| 171 | Ga0207694_10518812 | 3300025924 | Bacteria | 998 |
| 172 | Ga0207694_11033406 | 3300025924 | Bacteria | 695 |
| 173 | Ga0207650_10081400 | 3300025925 | Bacteria | 2456 |
| 174 | Ga0207700_10091362 | 3300025928 | Bacteria | 2404 |
| 175 | Ga0207700_10113452 | 3300025928 | Bacteria | 2185 |
| 176 | Ga0207700_11953422 | 3300025928 | Eukaryota | 513 |
| 177 | Ga0207664_10048054 | 3300025929 | Bacteria | 3354 |
| 178 | Ga0207670_10005761 | 3300025936 | Bacteria | 6835 |
| 179 | Ga0207669_10944808 | 3300025937 | Bacteria | 722 |
| 180 | Ga0207665_10002230 | 3300025939 | Bacteria | 13076 |
| 181 | Ga0207665_10059369 | 3300025939 | Bacteria | 2588 |
| 182 | Ga0207691_10001031 | 3300025940 | Bacteria | 27605 |
| 183 | Ga0207711_10000769 | 3300025941 | Bacteria | 31516 |
| 184 | Ga0207661_10027421 | 3300025944 | Unclassified | 4351 |
| 185 | Ga0207667_10005469 | 3300025949 | Bacteria | 15485 |
| 186 | Ga0207651_10380867 | 3300025960 | Unclassified | 1195 |
| 187 | Ga0207640_10652828 | 3300025981 | Bacteria | 897 |
| 188 | Ga0207658_10002773 | 3300025986 | Bacteria | 12621 |
| 189 | Ga0207703_10004034 | 3300026035 | Bacteria | 12137 |
| 190 | Ga0207703_10193395 | 3300026035 | Bacteria | 1804 |
| 191 | Ga0207678_10032726 | 3300026067 | Bacteria | 4532 |
| 192 | Ga0207678_10512045 | 3300026067 | Bacteria | 1047 |
| 193 | Ga0207678_10585861 | 3300026067 | Bacteria | 977 |
| 194 | Ga0207702_10017544 | 3300026078 | Bacteria | 5922 |
| 195 | Ga0207702_10107423 | 3300026078 | Bacteria | 2475 |
| 196 | Ga0207702_10788950 | 3300026078 | Bacteria | 939 |
| 197 | Ga0207641_10024081 | 3300026088 | Bacteria | 5017 |
| 198 | Ga0207648_10023968 | 3300026089 | Bacteria | 5455 |
| 199 | Ga0207675_101283322 | 3300026118 | Bacteria | 753 |
| 200 | Ga0207428_10000016 | 3300027907 | Bacteria | 327690 |
| 201 | Ga0265354_1000428 | 3300028016 | Bacteria | 7371 |
| 202 | Ga0265355_1001273 | 3300028036 | Archaea | 1601 |
| 203 | Ga0268266_10000610 | 3300028379 | Bacteria | 48690 |
| 204 | Ga0268266_10144645 | 3300028379 | Bacteria | 2136 |
| 205 | Ga0268265_10147248 | 3300028380 | Bacteria | 1981 |
| 206 | Ga0268264_10094954 | 3300028381 | Bacteria | 2579 |
| 207 | Ga0268264_10633448 | 3300028381 | Bacteria | 1057 |
| 208 | Ga0265323_10006982 | 3300028653 | Bacteria | 4720 |
| 209 | Ga0265323_10130499 | 3300028653 | Bacteria | 814 |
| 210 | Ga0265336_10005576 | 3300028666 | Bacteria | 4631 |
| 211 | Ga0265336_10049643 | 3300028666 | Bacteria | 1270 |
| 212 | Ga0265338_10053305 | 3300028800 | Bacteria | 3620 |
| 213 | Ga0265338_10286243 | 3300028800 | Unclassified | 1202 |
| 214 | Ga0265338_10727341 | 3300028800 | Unclassified | 683 |
| 215 | Ga0265770_1002733 | 3300030878 | Unclassified | 2396 |
| 216 | Ga0265765_1014848 | 3300030879 | Unclassified | 901 |
| 217 | Ga0265773_1012934 | 3300031018 | Unclassified | 738 |
| 218 | Ga0265760_10002039 | 3300031090 | Bacteria | 5944 |
| 219 | Ga0265760_10032395 | 3300031090 | Bacteria | 1543 |
| 220 | Ga0265339_10358431 | 3300031249 | Unclassified | 686 |
| 221 | Ga0265327_10016182 | 3300031251 | Bacteria | 4757 |
| 222 | Ga0307516_10000013 | 3300031730 | Bacteria | 217896 |
| 223 | Ga0307406_10038051 | 3300031901 | Bacteria | 2976 |
| 224 | Ga0307406_11275289 | 3300031901 | Bacteria | 640 |
| 225 | Ga0307409_100875324 | 3300031995 | Unclassified | 910 |
| 226 | Ga0307415_101706474 | 3300032126 | Bacteria | 607 |
| 227 | Ga0373927_0105415 | 3300035695 | Bacteria | 1836 |
| 228 | Ga0373933_0365376 | 3300035724 | Bacteria | 939 |
| 229 | Ga0373947_0165577 | 3300035725 | Bacteria | 1432 |
| 230 | Ga0373937_0322214 | 3300036401 | Unclassified | 1462 |
| 231 | Ga0373925_0245838 | 3300037068 | Unclassified | 1434 |
| 232 | Ga0395901_0492438 | 3300038443 | Bacteria | 1249 |
| 233 | Ga0436360_0223028 | 3300039438 | Bacteria | 2747 |
| 234 | Ga0436361_0718806 | 3300039447 | Bacteria | 1915 |
| 235 | Ga0436363_1236949 | 3300039450 | Bacteria | 1059 |
| 236 | Ga0450898_040901 | 3300042134 | Bacteria | 876 |
| 237 | Ga0450918_016383 | 3300042531 | Bacteria | 1287 |
| 238 | Ga0451577_0017923 | 3300042876 | Bacteria | 6533 |
| 239 | Ga0451577_0089599 | 3300042876 | Bacteria | 2745 |
| 240 | Ga0451577_0311422 | 3300042876 | Bacteria | 1427 |
| 241 | Ga0466969_0000292 | 3300044656 | Bacteria | 27335 |
| 242 | Ga0466972_0030681 | 3300044658 | Bacteria | 2646 |
| 243 | Ga0466972_0222226 | 3300044658 | Bacteria | 884 |
| 244 | Ga0466966_0009319 | 3300044684 | Bacteria | 6500 |
| 245 | Ga0466966_0016227 | 3300044684 | Bacteria | 4924 |
| 246 | Ga0466961_0000741 | 3300044693 | Bacteria | 20439 |
| 247 | Ga0466964_0000022 | 3300044706 | Bacteria | 33641 |
| 248 | Ga0466964_0371264 | 3300044706 | Bacteria | 740 |
| 249 | Ga0453684_0109619 | 3300044712 | Bacteria | 3357 |
| 250 | Ga0466971_0008605 | 3300044719 | Bacteria | 4450 |
| 251 | Ga0466970_0002411 | 3300044765 | Bacteria | 9032 |
| 252 | Ga0466957_0008395 | 3300044842 | Bacteria | 5873 |
| 253 | Ga0466960_0069044 | 3300044901 | Bacteria | 1755 |
| 254 | Ga0466959_0003199 | 3300045049 | Bacteria | 10640 |
| 255 | Ga0466959_0114990 | 3300045049 | Bacteria | 1917 |
| 256 | Ga0451576_0110954 | 3300045051 | Bacteria | 2854 |
| 257 | Ga0451576_0666514 | 3300045051 | Bacteria | 1093 |
| 258 | Ga0466958_0058517 | 3300045836 | Bacteria | 2343 |
| 259 | Ga0495604_0495749 | 3300047317 | Bacteria | 793 |
| 260 | Ga0496100_0049193 | 3300048903 | Bacteria | 2725 |
| 261 | Ga0496100_0324535 | 3300048903 | Bacteria | 1157 |
| 262 | Ga0496101_0090768 | 3300048904 | Bacteria | 2273 |
| 263 | Ga0496102_0106945 | 3300048905 | Bacteria | 2604 |
| 264 | Ga0496102_1104164 | 3300048905 | Bacteria | 713 |
| 265 | Ga0496103_0725969 | 3300048906 | Unclassified | 629 |
| 266 | Ga0496104_0000936 | 3300048907 | Bacteria | 25051 |
| 267 | Ga0496104_0109629 | 3300048907 | Bacteria | 2646 |
| 268 | Ga0496104_0282453 | 3300048907 | Unclassified | 1573 |
| 269 | Ga0496105_0008937 | 3300048908 | Bacteria | 7812 |
| 270 | Ga0496105_0277587 | 3300048908 | Bacteria | 1352 |
| 271 | Ga0496106_0001274 | 3300048909 | Bacteria | 18882 |
| 272 | Ga0496107_0001617 | 3300048910 | Bacteria | 14027 |
| 273 | Ga0496107_0068857 | 3300048910 | Bacteria | 2568 |
| 274 | Ga0496108_0273574 | 3300048911 | Unclassified | 1470 |
| 275 | Ga0496109_0097855 | 3300048912 | Bacteria | 2720 |
| 276 | Ga0496110_0007435 | 3300048913 | Bacteria | 8751 |
| 277 | Ga0496113_0429465 | 3300048916 | Unclassified | 1061 |
| 278 | Ga0496114_0006022 | 3300048917 | Bacteria | 9542 |
| 279 | Ga0496114_0921072 | 3300048917 | Unclassified | 756 |
| 280 | Ga0496115_0080892 | 3300048918 | Bacteria | 2645 |
| 281 | Ga0501242_007984 | 3300049674 | Bacteria | 1231 |
| 282 | nmdc:mga08y16_436_c1 | 3300050511 | Bacteria | 38489 |
| 283 | nmdc:mga08x19_139607_c1 | 3300050514 | Unclassified | 1636 |
| 284 | nmdc:mga0a205_6645_c1 | 3300050515 | Bacteria | 10468 |
| 285 | nmdc:mga0a205_87629_c1 | 3300050515 | Bacteria | 3007 |
| 286 | Ga0495601_0369051 | 3300053077 | Bacteria | 932 |
| 287 | Ga0495612_0089198 | 3300053078 | Bacteria | 1303 |
| 288 | Ga0500583_0152180 | 3300053092 | Bacteria | 1151 |
| 289 | Ga0500652_020181 | 3300053131 | Bacteria | 2490 |
| 290 | Ga0500588_0172716 | 3300053146 | Unclassified | 791 |
| 291 | Ga0466962_0000076 | 3300061719 | Bacteria | 39679 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_11273176 | Ga0157380_112731762 | 157 |
| 2 | 3300005327 | Ga0070658_11743332 | Ga0070658_117433321 | 158 |
| 3 | 3300005434 | Ga0070709_10045491 | Ga0070709_100454912 | 158 |
| 4 | 3300005435 | Ga0070714_100021592 | Ga0070714_1000215925 | 158 |
| 5 | 3300005436 | Ga0070713_100029008 | Ga0070713_1000290083 | 158 |
| 6 | 3300005437 | Ga0070710_10007211 | Ga0070710_100072115 | 158 |
| 7 | 3300005439 | Ga0070711_100013615 | Ga0070711_1000136152 | 158 |
| 8 | 3300005445 | Ga0070708_100019698 | Ga0070708_1000196985 | 158 |
| 9 | 3300005445 | Ga0070708_100478735 | Ga0070708_1004787352 | 158 |
| 10 | 3300005467 | Ga0070706_100464201 | Ga0070706_1004642012 | 158 |
| 11 | 3300005536 | Ga0070697_100096104 | Ga0070697_1000961044 | 158 |
| 12 | 3300006175 | Ga0070712_100036318 | Ga0070712_1000363182 | 158 |
| 13 | 3300006914 | Ga0075436_100029918 | Ga0075436_1000299185 | 158 |
| 14 | 3300007788 | Ga0099795_10066008 | Ga0099795_100660082 | 158 |
| 15 | 3300010159 | Ga0099796_10091153 | Ga0099796_100911532 | 158 |
| 16 | 3300025898 | Ga0207692_10088930 | Ga0207692_100889302 | 158 |
| 17 | 3300025906 | Ga0207699_10045710 | Ga0207699_100457102 | 158 |
| 18 | 3300025916 | Ga0207663_10040463 | Ga0207663_100404633 | 158 |
| 19 | 3300025925 | Ga0207650_10081400 | Ga0207650_100814003 | 158 |
| 20 | 3300025928 | Ga0207700_10113452 | Ga0207700_101134522 | 158 |
| 21 | 3300025939 | Ga0207665_10059369 | Ga0207665_100593692 | 158 |
| 22 | 3300031901 | Ga0307406_10038051 | Ga0307406_100380512 | 158 |
| 23 | 3300031901 | Ga0307406_11275289 | Ga0307406_112752891 | 158 |
| 24 | 3300031995 | Ga0307409_100875324 | Ga0307409_1008753241 | 158 |
| 25 | 3300032126 | Ga0307415_101706474 | Ga0307415_1017064742 | 158 |
| 26 | 3300045051 | Ga0451576_0666514 | Ga0451576_0666514_122_604 | 158 |
| 27 | 3300049674 | Ga0501242_007984 | Ga0501242_007984_77_559 | 158 |
| 28 | 3300050514 | nmdc:mga08x19_139607_c1 | nmdc:mga08x19_139607_c1_1009_1485 | 158 |
| 29 | 3300005330 | Ga0070690_100690000 | Ga0070690_1006900002 | 159 |
| 30 | 3300005471 | Ga0070698_100373111 | Ga0070698_1003731112 | 159 |
| 31 | 3300005617 | Ga0068859_100038136 | Ga0068859_1000381362 | 159 |
| 32 | 3300005618 | Ga0068864_100067746 | Ga0068864_1000677462 | 159 |
| 33 | 3300005844 | Ga0068862_100536863 | Ga0068862_1005368632 | 159 |
| 34 | 3300005937 | Ga0081455_10439296 | Ga0081455_104392962 | 159 |
| 35 | 3300006931 | Ga0097620_100038135 | Ga0097620_1000381352 | 159 |
| 36 | 3300009093 | Ga0105240_10027364 | Ga0105240_100273647 | 159 |
| 37 | 3300010375 | Ga0105239_10015925 | Ga0105239_100159256 | 159 |
| 38 | 3300025913 | Ga0207695_10065744 | Ga0207695_100657443 | 159 |
| 39 | 3300026118 | Ga0207675_101283322 | Ga0207675_1012833221 | 159 |
| 40 | 3300028380 | Ga0268265_10147248 | Ga0268265_101472482 | 159 |
| 41 | 3300000546 | LJNas_1007771 | LJNas_10077712 | 160 |
| 42 | 3300005293 | Ga0065715_10777895 | Ga0065715_107778951 | 160 |
| 43 | 3300005329 | Ga0070683_100018620 | Ga0070683_1000186203 | 160 |
| 44 | 3300005330 | Ga0070690_100001165 | Ga0070690_1000011657 | 160 |
| 45 | 3300005335 | Ga0070666_10000467 | Ga0070666_100004678 | 160 |
| 46 | 3300005336 | Ga0070680_100000310 | Ga0070680_10000031012 | 160 |
| 47 | 3300005336 | Ga0070680_100080417 | Ga0070680_1000804174 | 160 |
| 48 | 3300005336 | Ga0070680_100095448 | Ga0070680_1000954482 | 160 |
| 49 | 3300005337 | Ga0070682_100122291 | Ga0070682_1001222912 | 160 |
| 50 | 3300005340 | Ga0070689_100055761 | Ga0070689_1000557614 | 160 |
| 51 | 3300005356 | Ga0070674_100057889 | Ga0070674_1000578891 | 160 |
| 52 | 3300005364 | Ga0070673_100204463 | Ga0070673_1002044632 | 160 |
| 53 | 3300005364 | Ga0070673_100464467 | Ga0070673_1004644671 | 160 |
| 54 | 3300005367 | Ga0070667_100004454 | Ga0070667_10000445411 | 160 |
| 55 | 3300005435 | Ga0070714_100004693 | Ga0070714_1000046934 | 160 |
| 56 | 3300005436 | Ga0070713_100043459 | Ga0070713_1000434595 | 160 |
| 57 | 3300005436 | Ga0070713_100271283 | Ga0070713_1002712832 | 160 |
| 58 | 3300005437 | Ga0070710_10032185 | Ga0070710_100321853 | 160 |
| 59 | 3300005437 | Ga0070710_10273056 | Ga0070710_102730562 | 160 |
| 60 | 3300005439 | Ga0070711_100006856 | Ga0070711_1000068564 | 160 |
| 61 | 3300005439 | Ga0070711_100052159 | Ga0070711_1000521592 | 160 |
| 62 | 3300005440 | Ga0070705_100224824 | Ga0070705_1002248241 | 160 |
| 63 | 3300005455 | Ga0070663_100637460 | Ga0070663_1006374602 | 160 |
| 64 | 3300005458 | Ga0070681_10020714 | Ga0070681_100207141 | 160 |
| 65 | 3300005458 | Ga0070681_10020979 | Ga0070681_100209792 | 160 |
| 66 | 3300005459 | Ga0068867_100015242 | Ga0068867_1000152426 | 160 |
| 67 | 3300005468 | Ga0070707_100211348 | Ga0070707_1002113482 | 160 |
| 68 | 3300005518 | Ga0070699_100122478 | Ga0070699_1001224783 | 160 |
| 69 | 3300005518 | Ga0070699_100773261 | Ga0070699_1007732612 | 160 |
| 70 | 3300005530 | Ga0070679_100001074 | Ga0070679_10000107417 | 160 |
| 71 | 3300005530 | Ga0070679_100084703 | Ga0070679_1000847032 | 160 |
| 72 | 3300005530 | Ga0070679_100197231 | Ga0070679_1001972312 | 160 |
| 73 | 3300005535 | Ga0070684_100018468 | Ga0070684_1000184683 | 160 |
| 74 | 3300005543 | Ga0070672_100001333 | Ga0070672_1000013337 | 160 |
| 75 | 3300005545 | Ga0070695_100313692 | Ga0070695_1003136922 | 160 |
| 76 | 3300005546 | Ga0070696_100000267 | Ga0070696_10000026727 | 160 |
| 77 | 3300005546 | Ga0070696_100265179 | Ga0070696_1002651792 | 160 |
| 78 | 3300005546 | Ga0070696_101016587 | Ga0070696_1010165871 | 160 |
| 79 | 3300005548 | Ga0070665_100000552 | Ga0070665_10000055238 | 160 |
| 80 | 3300005548 | Ga0070665_100018711 | Ga0070665_1000187117 | 160 |
| 81 | 3300005549 | Ga0070704_100059840 | Ga0070704_1000598402 | 160 |
| 82 | 3300005563 | Ga0068855_100004496 | Ga0068855_10000449612 | 160 |
| 83 | 3300005563 | Ga0068855_100156160 | Ga0068855_1001561603 | 160 |
| 84 | 3300005563 | Ga0068855_100157845 | Ga0068855_1001578453 | 160 |
| 85 | 3300005563 | Ga0068855_100971319 | Ga0068855_1009713192 | 160 |
| 86 | 3300005563 | Ga0068855_101850983 | Ga0068855_1018509831 | 160 |
| 87 | 3300005578 | Ga0068854_100721519 | Ga0068854_1007215192 | 160 |
| 88 | 3300005614 | Ga0068856_100017320 | Ga0068856_1000173203 | 160 |
| 89 | 3300005614 | Ga0068856_100140670 | Ga0068856_1001406702 | 160 |
| 90 | 3300005614 | Ga0068856_100852298 | Ga0068856_1008522981 | 160 |
| 91 | 3300005615 | Ga0070702_100232958 | Ga0070702_1002329581 | 160 |
| 92 | 3300005617 | Ga0068859_100011570 | Ga0068859_1000115702 | 160 |
| 93 | 3300005617 | Ga0068859_100677944 | Ga0068859_1006779442 | 160 |
| 94 | 3300005841 | Ga0068863_100058263 | Ga0068863_1000582633 | 160 |
| 95 | 3300005842 | Ga0068858_100001625 | Ga0068858_1000016257 | 160 |
| 96 | 3300005843 | Ga0068860_100000924 | Ga0068860_1000009248 | 160 |
| 97 | 3300005843 | Ga0068860_101631112 | Ga0068860_1016311122 | 160 |
| 98 | 3300005985 | Ga0081539_10000007 | Ga0081539_10000007236 | 160 |
| 99 | 3300006028 | Ga0070717_10000590 | Ga0070717_1000059015 | 160 |
| 100 | 3300006163 | Ga0070715_10466365 | Ga0070715_104663651 | 160 |
| 101 | 3300006175 | Ga0070712_100106874 | Ga0070712_1001068742 | 160 |
| 102 | 3300006175 | Ga0070712_100394264 | Ga0070712_1003942642 | 160 |
| 103 | 3300006175 | Ga0070712_100437410 | Ga0070712_1004374102 | 160 |
| 104 | 3300006237 | Ga0097621_100811065 | Ga0097621_1008110652 | 160 |
| 105 | 3300006844 | Ga0075428_100371370 | Ga0075428_1003713702 | 160 |
| 106 | 3300006846 | Ga0075430_100031941 | Ga0075430_1000319415 | 160 |
| 107 | 3300006852 | Ga0075433_10006176 | Ga0075433_1000617610 | 160 |
| 108 | 3300006852 | Ga0075433_10125822 | Ga0075433_101258222 | 160 |
| 109 | 3300006871 | Ga0075434_100015501 | Ga0075434_1000155013 | 160 |
| 110 | 3300006871 | Ga0075434_100185600 | Ga0075434_1001856002 | 160 |
| 111 | 3300006881 | Ga0068865_100593268 | Ga0068865_1005932681 | 160 |
| 112 | 3300006931 | Ga0097620_100011570 | Ga0097620_1000115702 | 160 |
| 113 | 3300006931 | Ga0097620_100677846 | Ga0097620_1006778462 | 160 |
| 114 | 3300007076 | Ga0075435_100535956 | Ga0075435_1005359562 | 160 |
| 115 | 3300007265 | Ga0099794_10226068 | Ga0099794_102260681 | 160 |
| 116 | 3300007265 | Ga0099794_10403115 | Ga0099794_104031152 | 160 |
| 117 | 3300007788 | Ga0099795_10007383 | Ga0099795_100073833 | 160 |
| 118 | 3300007788 | Ga0099795_10251211 | Ga0099795_102512111 | 160 |
| 119 | 3300009093 | Ga0105240_10000847 | Ga0105240_100008476 | 160 |
| 120 | 3300009093 | Ga0105240_10024775 | Ga0105240_100247752 | 160 |
| 121 | 3300009093 | Ga0105240_10165531 | Ga0105240_101655312 | 160 |
| 122 | 3300009093 | Ga0105240_10511447 | Ga0105240_105114472 | 160 |
| 123 | 3300009101 | Ga0105247_10035266 | Ga0105247_100352664 | 160 |
| 124 | 3300009177 | Ga0105248_10006845 | Ga0105248_100068457 | 160 |
| 125 | 3300009545 | Ga0105237_10510654 | Ga0105237_105106542 | 160 |
| 126 | 3300009545 | Ga0105237_11545039 | Ga0105237_115450392 | 160 |
| 127 | 3300009551 | Ga0105238_10001146 | Ga0105238_100011468 | 160 |
| 128 | 3300009551 | Ga0105238_10102025 | Ga0105238_101020253 | 160 |
| 129 | 3300009551 | Ga0105238_10671881 | Ga0105238_106718812 | 160 |
| 130 | 3300009551 | Ga0105238_11363343 | Ga0105238_113633431 | 160 |
| 131 | 3300009551 | Ga0105238_11464468 | Ga0105238_114644681 | 160 |
| 132 | 3300010159 | Ga0099796_10002480 | Ga0099796_100024805 | 160 |
| 133 | 3300010375 | Ga0105239_10893596 | Ga0105239_108935962 | 160 |
| 134 | 3300013104 | Ga0157370_10000396 | Ga0157370_1000039637 | 160 |
| 135 | 3300013104 | Ga0157370_10243599 | Ga0157370_102435992 | 160 |
| 136 | 3300013104 | Ga0157370_10969415 | Ga0157370_109694151 | 160 |
| 137 | 3300013105 | Ga0157369_10010072 | Ga0157369_100100727 | 160 |
| 138 | 3300013105 | Ga0157369_10041843 | Ga0157369_100418434 | 160 |
| 139 | 3300013105 | Ga0157369_10565223 | Ga0157369_105652231 | 160 |
| 140 | 3300013296 | Ga0157374_10218517 | Ga0157374_102185172 | 160 |
| 141 | 3300013297 | Ga0157378_10004289 | Ga0157378_100042898 | 160 |
| 142 | 3300013307 | Ga0157372_11202463 | Ga0157372_112024631 | 160 |
| 143 | 3300013307 | Ga0157372_11527132 | Ga0157372_115271322 | 160 |
| 144 | 3300013308 | Ga0157375_10179931 | Ga0157375_101799312 | 160 |
| 145 | 3300014325 | Ga0163163_12136616 | Ga0163163_121366161 | 160 |
| 146 | 3300014968 | Ga0157379_10012170 | Ga0157379_100121705 | 160 |
| 147 | 3300014969 | Ga0157376_10001559 | Ga0157376_100015594 | 160 |
| 148 | 3300014969 | Ga0157376_10321960 | Ga0157376_103219603 | 160 |
| 149 | 3300020070 | Ga0206356_10053723 | Ga0206356_100537231 | 160 |
| 150 | 3300020078 | Ga0206352_10019620 | Ga0206352_100196201 | 160 |
| 151 | 3300022467 | Ga0224712_10275260 | Ga0224712_102752601 | 160 |
| 152 | 3300025898 | Ga0207692_10122373 | Ga0207692_101223732 | 160 |
| 153 | 3300025906 | Ga0207699_10370651 | Ga0207699_103706511 | 160 |
| 154 | 3300025906 | Ga0207699_10425348 | Ga0207699_104253482 | 160 |
| 155 | 3300025909 | Ga0207705_10721396 | Ga0207705_107213961 | 160 |
| 156 | 3300025910 | Ga0207684_10863847 | Ga0207684_108638472 | 160 |
| 157 | 3300025912 | Ga0207707_10000104 | Ga0207707_1000010424 | 160 |
| 158 | 3300025912 | Ga0207707_10004033 | Ga0207707_1000403310 | 160 |
| 159 | 3300025912 | Ga0207707_10006165 | Ga0207707_100061652 | 160 |
| 160 | 3300025912 | Ga0207707_10020734 | Ga0207707_100207342 | 160 |
| 161 | 3300025912 | Ga0207707_10064092 | Ga0207707_100640922 | 160 |
| 162 | 3300025913 | Ga0207695_10003434 | Ga0207695_1000343415 | 160 |
| 163 | 3300025913 | Ga0207695_10042395 | Ga0207695_100423953 | 160 |
| 164 | 3300025913 | Ga0207695_10127759 | Ga0207695_101277592 | 160 |
| 165 | 3300025913 | Ga0207695_10222793 | Ga0207695_102227931 | 160 |
| 166 | 3300025913 | Ga0207695_10251397 | Ga0207695_102513972 | 160 |
| 167 | 3300025914 | Ga0207671_10203583 | Ga0207671_102035832 | 160 |
| 168 | 3300025915 | Ga0207693_10167986 | Ga0207693_101679862 | 160 |
| 169 | 3300025915 | Ga0207693_10357515 | Ga0207693_103575152 | 160 |
| 170 | 3300025915 | Ga0207693_10605279 | Ga0207693_106052792 | 160 |
| 171 | 3300025916 | Ga0207663_10249122 | Ga0207663_102491222 | 160 |
| 172 | 3300025916 | Ga0207663_10253453 | Ga0207663_102534532 | 160 |
| 173 | 3300025916 | Ga0207663_10347734 | Ga0207663_103477342 | 160 |
| 174 | 3300025917 | Ga0207660_10002002 | Ga0207660_100020027 | 160 |
| 175 | 3300025917 | Ga0207660_10088299 | Ga0207660_100882992 | 160 |
| 176 | 3300025917 | Ga0207660_10271067 | Ga0207660_102710671 | 160 |
| 177 | 3300025920 | Ga0207649_10277256 | Ga0207649_102772562 | 160 |
| 178 | 3300025921 | Ga0207652_10000756 | Ga0207652_1000075615 | 160 |
| 179 | 3300025921 | Ga0207652_10187114 | Ga0207652_101871142 | 160 |
| 180 | 3300025921 | Ga0207652_10249468 | Ga0207652_102494682 | 160 |
| 181 | 3300025924 | Ga0207694_10007642 | Ga0207694_100076427 | 160 |
| 182 | 3300025924 | Ga0207694_10116858 | Ga0207694_101168581 | 160 |
| 183 | 3300025924 | Ga0207694_10518812 | Ga0207694_105188121 | 160 |
| 184 | 3300025924 | Ga0207694_11033406 | Ga0207694_110334062 | 160 |
| 185 | 3300025928 | Ga0207700_10091362 | Ga0207700_100913623 | 160 |
| 186 | 3300025928 | Ga0207700_11953422 | Ga0207700_119534221 | 160 |
| 187 | 3300025929 | Ga0207664_10048054 | Ga0207664_100480546 | 160 |
| 188 | 3300025936 | Ga0207670_10005761 | Ga0207670_100057617 | 160 |
| 189 | 3300025937 | Ga0207669_10944808 | Ga0207669_109448082 | 160 |
| 190 | 3300025939 | Ga0207665_10002230 | Ga0207665_1000223014 | 160 |
| 191 | 3300025940 | Ga0207691_10001031 | Ga0207691_100010318 | 160 |
| 192 | 3300025941 | Ga0207711_10000769 | Ga0207711_100007696 | 160 |
| 193 | 3300025944 | Ga0207661_10027421 | Ga0207661_100274212 | 160 |
| 194 | 3300025949 | Ga0207667_10005469 | Ga0207667_100054696 | 160 |
| 195 | 3300025960 | Ga0207651_10380867 | Ga0207651_103808672 | 160 |
| 196 | 3300025981 | Ga0207640_10652828 | Ga0207640_106528282 | 160 |
| 197 | 3300025986 | Ga0207658_10002773 | Ga0207658_100027736 | 160 |
| 198 | 3300026035 | Ga0207703_10004034 | Ga0207703_1000403411 | 160 |
| 199 | 3300026035 | Ga0207703_10193395 | Ga0207703_101933952 | 160 |
| 200 | 3300026067 | Ga0207678_10032726 | Ga0207678_100327262 | 160 |
| 201 | 3300026067 | Ga0207678_10512045 | Ga0207678_105120452 | 160 |
| 202 | 3300026067 | Ga0207678_10585861 | Ga0207678_105858612 | 160 |
| 203 | 3300026078 | Ga0207702_10017544 | Ga0207702_100175446 | 160 |
| 204 | 3300026078 | Ga0207702_10107423 | Ga0207702_101074232 | 160 |
| 205 | 3300026078 | Ga0207702_10788950 | Ga0207702_107889501 | 160 |
| 206 | 3300026088 | Ga0207641_10024081 | Ga0207641_100240814 | 160 |
| 207 | 3300026089 | Ga0207648_10023968 | Ga0207648_100239682 | 160 |
| 208 | 3300027907 | Ga0207428_10000016 | Ga0207428_10000016230 | 160 |
| 209 | 3300028016 | Ga0265354_1000428 | Ga0265354_10004285 | 160 |
| 210 | 3300028036 | Ga0265355_1001273 | Ga0265355_10012732 | 160 |
| 211 | 3300028379 | Ga0268266_10000610 | Ga0268266_1000061038 | 160 |
| 212 | 3300028379 | Ga0268266_10144645 | Ga0268266_101446452 | 160 |
| 213 | 3300028381 | Ga0268264_10094954 | Ga0268264_100949542 | 160 |
| 214 | 3300028381 | Ga0268264_10633448 | Ga0268264_106334482 | 160 |
| 215 | 3300028653 | Ga0265323_10006982 | Ga0265323_100069822 | 160 |
| 216 | 3300028653 | Ga0265323_10130499 | Ga0265323_101304991 | 160 |
| 217 | 3300028666 | Ga0265336_10005576 | Ga0265336_100055764 | 160 |
| 218 | 3300028666 | Ga0265336_10049643 | Ga0265336_100496432 | 160 |
| 219 | 3300028800 | Ga0265338_10053305 | Ga0265338_100533052 | 160 |
| 220 | 3300028800 | Ga0265338_10286243 | Ga0265338_102862432 | 160 |
| 221 | 3300028800 | Ga0265338_10727341 | Ga0265338_107273412 | 160 |
| 222 | 3300030878 | Ga0265770_1002733 | Ga0265770_10027332 | 160 |
| 223 | 3300030879 | Ga0265765_1014848 | Ga0265765_10148481 | 160 |
| 224 | 3300031018 | Ga0265773_1012934 | Ga0265773_10129341 | 160 |
| 225 | 3300031090 | Ga0265760_10002039 | Ga0265760_100020398 | 160 |
| 226 | 3300031090 | Ga0265760_10032395 | Ga0265760_100323952 | 160 |
| 227 | 3300031249 | Ga0265339_10358431 | Ga0265339_103584311 | 160 |
| 228 | 3300031251 | Ga0265327_10016182 | Ga0265327_100161824 | 160 |
| 229 | 3300031730 | Ga0307516_10000013 | Ga0307516_10000013191 | 160 |
| 230 | 3300035695 | Ga0373927_0105415 | Ga0373927_0105415_1157_1639 | 160 |
| 231 | 3300035724 | Ga0373933_0365376 | Ga0373933_0365376_354_836 | 160 |
| 232 | 3300035725 | Ga0373947_0165577 | Ga0373947_0165577_680_1162 | 160 |
| 233 | 3300036401 | Ga0373937_0322214 | Ga0373937_0322214_206_688 | 160 |
| 234 | 3300037068 | Ga0373925_0245838 | Ga0373925_0245838_930_1412 | 160 |
| 235 | 3300038443 | Ga0395901_0492438 | Ga0395901_0492438_78_560 | 160 |
| 236 | 3300039438 | Ga0436360_0223028 | Ga0436360_0223028_1546_2028 | 160 |
| 237 | 3300039447 | Ga0436361_0718806 | Ga0436361_0718806_959_1441 | 160 |
| 238 | 3300039450 | Ga0436363_1236949 | Ga0436363_1236949_228_710 | 160 |
| 239 | 3300042134 | Ga0450898_040901 | Ga0450898_040901_61_585 | 160 |
| 240 | 3300042531 | Ga0450918_016383 | Ga0450918_016383_91_615 | 160 |
| 241 | 3300042876 | Ga0451577_0017923 | Ga0451577_0017923_4908_5390 | 160 |
| 242 | 3300042876 | Ga0451577_0089599 | Ga0451577_0089599_1018_1506 | 160 |
| 243 | 3300042876 | Ga0451577_0311422 | Ga0451577_0311422_574_1056 | 160 |
| 244 | 3300044656 | Ga0466969_0000292 | Ga0466969_0000292_11943_12425 | 160 |
| 245 | 3300044658 | Ga0466972_0030681 | Ga0466972_0030681_1236_1718 | 160 |
| 246 | 3300044658 | Ga0466972_0222226 | Ga0466972_0222226_161_643 | 160 |
| 247 | 3300044684 | Ga0466966_0009319 | Ga0466966_0009319_3837_4319 | 160 |
| 248 | 3300044684 | Ga0466966_0016227 | Ga0466966_0016227_1081_1563 | 160 |
| 249 | 3300044693 | Ga0466961_0000741 | Ga0466961_0000741_10774_11256 | 160 |
| 250 | 3300044706 | Ga0466964_0000022 | Ga0466964_0000022_20433_20915 | 160 |
| 251 | 3300044706 | Ga0466964_0371264 | Ga0466964_0371264_170_652 | 160 |
| 252 | 3300044712 | Ga0453684_0109619 | Ga0453684_0109619_1763_2245 | 160 |
| 253 | 3300044719 | Ga0466971_0008605 | Ga0466971_0008605_1692_2174 | 160 |
| 254 | 3300044765 | Ga0466970_0002411 | Ga0466970_0002411_4158_4640 | 160 |
| 255 | 3300044842 | Ga0466957_0008395 | Ga0466957_0008395_4411_4893 | 160 |
| 256 | 3300044901 | Ga0466960_0069044 | Ga0466960_0069044_417_899 | 160 |
| 257 | 3300045049 | Ga0466959_0003199 | Ga0466959_0003199_8795_9277 | 160 |
| 258 | 3300045049 | Ga0466959_0114990 | Ga0466959_0114990_572_1054 | 160 |
| 259 | 3300045051 | Ga0451576_0110954 | Ga0451576_0110954_869_1351 | 160 |
| 260 | 3300045836 | Ga0466958_0058517 | Ga0466958_0058517_734_1216 | 160 |
| 261 | 3300047317 | Ga0495604_0495749 | Ga0495604_0495749_141_623 | 160 |
| 262 | 3300048903 | Ga0496100_0049193 | Ga0496100_0049193_940_1422 | 160 |
| 263 | 3300048903 | Ga0496100_0324535 | Ga0496100_0324535_226_708 | 160 |
| 264 | 3300048904 | Ga0496101_0090768 | Ga0496101_0090768_770_1252 | 160 |
| 265 | 3300048905 | Ga0496102_0106945 | Ga0496102_0106945_773_1255 | 160 |
| 266 | 3300048905 | Ga0496102_1104164 | Ga0496102_1104164_221_703 | 160 |
| 267 | 3300048906 | Ga0496103_0725969 | Ga0496103_0725969_103_585 | 160 |
| 268 | 3300048907 | Ga0496104_0000936 | Ga0496104_0000936_17671_18153 | 160 |
| 269 | 3300048907 | Ga0496104_0109629 | Ga0496104_0109629_787_1269 | 160 |
| 270 | 3300048907 | Ga0496104_0282453 | Ga0496104_0282453_994_1476 | 160 |
| 271 | 3300048908 | Ga0496105_0008937 | Ga0496105_0008937_2486_2968 | 160 |
| 272 | 3300048908 | Ga0496105_0277587 | Ga0496105_0277587_754_1236 | 160 |
| 273 | 3300048909 | Ga0496106_0001274 | Ga0496106_0001274_4808_5290 | 160 |
| 274 | 3300048910 | Ga0496107_0001617 | Ga0496107_0001617_4241_4723 | 160 |
| 275 | 3300048910 | Ga0496107_0068857 | Ga0496107_0068857_775_1257 | 160 |
| 276 | 3300048911 | Ga0496108_0273574 | Ga0496108_0273574_72_554 | 160 |
| 277 | 3300048912 | Ga0496109_0097855 | Ga0496109_0097855_882_1364 | 160 |
| 278 | 3300048913 | Ga0496110_0007435 | Ga0496110_0007435_7641_8123 | 160 |
| 279 | 3300048916 | Ga0496113_0429465 | Ga0496113_0429465_34_516 | 160 |
| 280 | 3300048917 | Ga0496114_0006022 | Ga0496114_0006022_6741_7223 | 160 |
| 281 | 3300048917 | Ga0496114_0921072 | Ga0496114_0921072_31_513 | 160 |
| 282 | 3300048918 | Ga0496115_0080892 | Ga0496115_0080892_1885_2367 | 160 |
| 283 | 3300050511 | nmdc:mga08y16_436_c1 | nmdc:mga08y16_436_c1_35410_35892 | 160 |
| 284 | 3300050515 | nmdc:mga0a205_6645_c1 | nmdc:mga0a205_6645_c1_3705_4187 | 160 |
| 285 | 3300050515 | nmdc:mga0a205_87629_c1 | nmdc:mga0a205_87629_c1_2123_2605 | 160 |
| 286 | 3300053077 | Ga0495601_0369051 | Ga0495601_0369051_354_863 | 160 |
| 287 | 3300053078 | Ga0495612_0089198 | Ga0495612_0089198_340_822 | 160 |
| 288 | 3300053092 | Ga0500583_0152180 | Ga0500583_0152180_225_707 | 160 |
| 289 | 3300053131 | Ga0500652_020181 | Ga0500652_020181_1602_2084 | 160 |
| 290 | 3300053146 | Ga0500588_0172716 | Ga0500588_0172716_24_506 | 160 |
| 291 | 3300061719 | Ga0466962_0000076 | Ga0466962_0000076_2149_2631 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ge4-assembly1.cif.gz_E | crystal structure of ferritin:dna-binding protein dps from brucella melitensis | 0.9776 | 1 | 160 |
| 1o9r-assembly1.cif.gz_A | the x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect dna without binding | 0.9771 | 2 | 160 |
| 3ge4-assembly1.cif.gz_E | crystal structure of ferritin:dna-binding protein dps from brucella melitensis | 0.9717 | 1 | 160 |
| 5ww9-assembly1.cif.gz_B | crystal structure of r73e mutant of the second dna-binding protein under starvation from mycobacterium smegmatis | 0.9696 | 15 | 158 |
| 8pv9-assembly1.cif.gz_A | structure of dps determined by cryoem at 100 kev | 0.9695 | 1 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o9rA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9771 | 2 | 160 | 1.20.1260.10 |
| 2yw7A00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9675 | 11 | 155 | 1.20.1260.10 |
| 4dyuA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9666 | 1 | 154 | 1.20.1260.10 |
| 1o9rA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9652 | 2 | 160 | 1.20.1260.10 |
| 2yw6A00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9651 | 11 | 158 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7RXL1-F1-model_v4 | DNA starvation/stationary phase protection protein Dps | 0.9952 | 1 | 157 |
GO:0008199
GO:0016722 |
| AF-A0A1V1PNB9-F1-model_v4 | Non-specific DNA-binding protein Dps (EC 1.16.3.1) | 0.9952 | 1 | 157 |
GO:0003677
GO:0004322 GO:0008199 |
| AF-E6PI45-F1-model_v4 | DNA protection during starvation protein (EC 1.16.-.-) | 0.9939 | 1 | 157 |
GO:0008199
GO:0016722 |
| AF-A0A2V9P229-F1-model_v4 | DNA starvation/stationary phase protection protein Dps | 0.9936 | 1 | 160 |
GO:0008199
GO:0016722 |
| AF-A0A2W4X8B7-F1-model_v4 | DNA starvation/stationary phase protection protein Dps | 0.9935 | 1 | 156 |
GO:0008199
GO:0016722 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar