F390302

General Info

Members Datasets Scaffolds Average Seq Length
291 181 291 161

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10511447|Ga0105240_105114472
Length 193
Sequence LTARRRRPAALGIHAQAVQNGGEFAIPDLEGAPMYKTKIDLSEKIRRNVINILNDRLADAIDLQSQVKQAHWNVKGPNFIALHELFDKISDEVLEHIDDLAERITSLGGTAEGTVAVAAKRSKLKNYPLSITAGKDHLFYLSTQLSVYGKAVRAGIDDADKLGDADTADLFTEISRETDKYLWFLEAHLQEKA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
115 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
142 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
179 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
180 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 2.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 7.22
Rhizosphere 91.07
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1007771 3300000546 Archaea 1155
2 Ga0065715_10777895 3300005293 Bacteria 619
3 Ga0070658_11743332 3300005327 Unclassified 539
4 Ga0070683_100018620 3300005329 Bacteria 6154
5 Ga0070690_100001165 3300005330 Bacteria 13521
6 Ga0070690_100690000 3300005330 Bacteria 783
7 Ga0070666_10000467 3300005335 Bacteria 24463
8 Ga0070680_100000310 3300005336 Bacteria 32525
9 Ga0070680_100080417 3300005336 Bacteria 2687
10 Ga0070680_100095448 3300005336 Bacteria 2465
11 Ga0070682_100122291 3300005337 Bacteria 1750
12 Ga0070689_100055761 3300005340 Bacteria 3063
13 Ga0070674_100057889 3300005356 Bacteria 2692
14 Ga0070673_100204463 3300005364 Unclassified 1702
15 Ga0070673_100464467 3300005364 Bacteria 1140
16 Ga0070667_100004454 3300005367 Bacteria 11810
17 Ga0070709_10045491 3300005434 Bacteria 2724
18 Ga0070714_100004693 3300005435 Bacteria 10330
19 Ga0070714_100021592 3300005435 Bacteria 5268
20 Ga0070713_100029008 3300005436 Bacteria 4375
21 Ga0070713_100043459 3300005436 Bacteria 3674
22 Ga0070713_100271283 3300005436 Bacteria 1554
23 Ga0070710_10007211 3300005437 Bacteria 5373
24 Ga0070710_10032185 3300005437 Bacteria 2839
25 Ga0070710_10273056 3300005437 Unclassified 1094
26 Ga0070711_100006856 3300005439 Bacteria 6897
27 Ga0070711_100013615 3300005439 Bacteria 5110
28 Ga0070711_100052159 3300005439 Bacteria 2814
29 Ga0070705_100224824 3300005440 Bacteria 1302
30 Ga0070708_100019698 3300005445 Bacteria 5675
31 Ga0070708_100478735 3300005445 Unclassified 1175
32 Ga0070663_100637460 3300005455 Bacteria 900
33 Ga0070681_10020714 3300005458 Bacteria 6587
34 Ga0070681_10020979 3300005458 Bacteria 6545
35 Ga0068867_100015242 3300005459 Bacteria 5451
36 Ga0070706_100464201 3300005467 Bacteria 1178
37 Ga0070707_100211348 3300005468 Bacteria 1891
38 Ga0070698_100373111 3300005471 Bacteria 1359
39 Ga0070699_100122478 3300005518 Bacteria 2288
40 Ga0070699_100773261 3300005518 Bacteria 878
41 Ga0070679_100001074 3300005530 Bacteria 23895
42 Ga0070679_100084703 3300005530 Bacteria 3158
43 Ga0070679_100197231 3300005530 Bacteria 1980
44 Ga0070684_100018468 3300005535 Bacteria 5745
45 Ga0070697_100096104 3300005536 Bacteria 2458
46 Ga0070672_100001333 3300005543 Bacteria 15223
47 Ga0070695_100313692 3300005545 Bacteria 1163
48 Ga0070696_100000267 3300005546 Bacteria 31493
49 Ga0070696_100265179 3300005546 Bacteria 1304
50 Ga0070696_101016587 3300005546 Bacteria 693
51 Ga0070665_100000552 3300005548 Bacteria 52249
52 Ga0070665_100018711 3300005548 Bacteria 6945
53 Ga0070704_100059840 3300005549 Bacteria 2719
54 Ga0068855_100004496 3300005563 Bacteria 17043
55 Ga0068855_100156160 3300005563 Bacteria 2592
56 Ga0068855_100157845 3300005563 Bacteria 2576
57 Ga0068855_100971319 3300005563 Bacteria 894
58 Ga0068855_101850983 3300005563 Bacteria 612
59 Ga0068854_100721519 3300005578 Bacteria 862
60 Ga0068856_100017320 3300005614 Bacteria 6986
61 Ga0068856_100140670 3300005614 Bacteria 2420
62 Ga0068856_100852298 3300005614 Bacteria 930
63 Ga0070702_100232958 3300005615 Unclassified 1238
64 Ga0068859_100011570 3300005617 Bacteria 8873
65 Ga0068859_100038136 3300005617 Bacteria 4822
66 Ga0068859_100677944 3300005617 Bacteria 1122
67 Ga0068864_100067746 3300005618 Bacteria 3100
68 Ga0068863_100058263 3300005841 Bacteria 3656
69 Ga0068858_100001625 3300005842 Bacteria 22912
70 Ga0068860_100000924 3300005843 Bacteria 32627
71 Ga0068860_101631112 3300005843 Bacteria 667
72 Ga0068862_100536863 3300005844 Bacteria 1115
73 Ga0081455_10439296 3300005937 Bacteria 895
74 Ga0081539_10000007 3300005985 Bacteria 532790
75 Ga0070717_10000590 3300006028 Bacteria 23217
76 Ga0070715_10466365 3300006163 Unclassified 716
77 Ga0070712_100036318 3300006175 Bacteria 3352
78 Ga0070712_100106874 3300006175 Bacteria 2081
79 Ga0070712_100394264 3300006175 Bacteria 1142
80 Ga0070712_100437410 3300006175 Bacteria 1087
81 Ga0097621_100811065 3300006237 Bacteria 867
82 Ga0075428_100371370 3300006844 Unclassified 1534
83 Ga0075430_100031941 3300006846 Bacteria 4469
84 Ga0075433_10006176 3300006852 Bacteria 9449
85 Ga0075433_10125822 3300006852 Bacteria 2276
86 Ga0075434_100015501 3300006871 Bacteria 7311
87 Ga0075434_100185600 3300006871 Bacteria 2100
88 Ga0068865_100593268 3300006881 Unclassified 935
89 Ga0075436_100029918 3300006914 Bacteria 3746
90 Ga0097620_100011570 3300006931 Bacteria 8873
91 Ga0097620_100038135 3300006931 Bacteria 4822
92 Ga0097620_100677846 3300006931 Bacteria 1122
93 Ga0075435_100535956 3300007076 Bacteria 1013
94 Ga0099794_10226068 3300007265 Archaea 962
95 Ga0099794_10403115 3300007265 Unclassified 714
96 Ga0099795_10007383 3300007788 Bacteria 3064
97 Ga0099795_10066008 3300007788 Bacteria 1354
98 Ga0099795_10251211 3300007788 Unclassified 763
99 Ga0105240_10000847 3300009093 Bacteria 55095
100 Ga0105240_10024775 3300009093 Bacteria 7902
101 Ga0105240_10027364 3300009093 Bacteria 7465
102 Ga0105240_10165531 3300009093 Bacteria 2623
103 Ga0105240_10511447 3300009093 Bacteria 1334
104 Ga0105247_10035266 3300009101 Bacteria 3049
105 Ga0105248_10006845 3300009177 Bacteria 12496
106 Ga0105237_10510654 3300009545 Unclassified 1208
107 Ga0105237_11545039 3300009545 Bacteria 670
108 Ga0105238_10001146 3300009551 Bacteria 26746
109 Ga0105238_10102025 3300009551 Bacteria 2851
110 Ga0105238_10671881 3300009551 Bacteria 1047
111 Ga0105238_11363343 3300009551 Bacteria 736
112 Ga0105238_11464468 3300009551 Bacteria 711
113 Ga0099796_10002480 3300010159 Bacteria 4056
114 Ga0099796_10091153 3300010159 Bacteria 1133
115 Ga0105239_10015925 3300010375 Bacteria 8321
116 Ga0105239_10893596 3300010375 Unclassified 1019
117 Ga0157370_10000396 3300013104 Bacteria 54821
118 Ga0157370_10243599 3300013104 Bacteria 1663
119 Ga0157370_10969415 3300013104 Unclassified 770
120 Ga0157369_10010072 3300013105 Bacteria 10792
121 Ga0157369_10041843 3300013105 Bacteria 5000
122 Ga0157369_10565223 3300013105 Unclassified 1175
123 Ga0157374_10218517 3300013296 Unclassified 1870
124 Ga0157378_10004289 3300013297 Bacteria 12556
125 Ga0157372_11202463 3300013307 Unclassified 876
126 Ga0157372_11527132 3300013307 Bacteria 769
127 Ga0157375_10179931 3300013308 Unclassified 2265
128 Ga0163163_12136616 3300014325 Bacteria 619
129 Ga0157380_11273176 3300014326 Bacteria 782
130 Ga0157379_10012170 3300014968 Bacteria 7515
131 Ga0157376_10001559 3300014969 Bacteria 15146
132 Ga0157376_10321960 3300014969 Bacteria 1470
133 Ga0206356_10053723 3300020070 Unclassified 619
134 Ga0206352_10019620 3300020078 Bacteria 565
135 Ga0224712_10275260 3300022467 Bacteria 782
136 Ga0207692_10088930 3300025898 Bacteria 1670
137 Ga0207692_10122373 3300025898 Bacteria 1459
138 Ga0207699_10045710 3300025906 Bacteria 2557
139 Ga0207699_10370651 3300025906 Bacteria 1014
140 Ga0207699_10425348 3300025906 Unclassified 949
141 Ga0207705_10721396 3300025909 Bacteria 775
142 Ga0207684_10863847 3300025910 Bacteria 762
143 Ga0207707_10000104 3300025912 Bacteria 83446
144 Ga0207707_10004033 3300025912 Bacteria 13023
145 Ga0207707_10006165 3300025912 Bacteria 10475
146 Ga0207707_10020734 3300025912 Bacteria 5741
147 Ga0207707_10064092 3300025912 Bacteria 3199
148 Ga0207695_10003434 3300025913 Bacteria 22352
149 Ga0207695_10042395 3300025913 Bacteria 4861
150 Ga0207695_10065744 3300025913 Bacteria 3727
151 Ga0207695_10127759 3300025913 Bacteria 2502
152 Ga0207695_10222793 3300025913 Unclassified 1793
153 Ga0207695_10251397 3300025913 Bacteria 1667
154 Ga0207671_10203583 3300025914 Unclassified 1546
155 Ga0207693_10167986 3300025915 Unclassified 1727
156 Ga0207693_10357515 3300025915 Bacteria 1142
157 Ga0207693_10605279 3300025915 Bacteria 853
158 Ga0207663_10040463 3300025916 Bacteria 2833
159 Ga0207663_10249122 3300025916 Bacteria 1306
160 Ga0207663_10253453 3300025916 Bacteria 1296
161 Ga0207663_10347734 3300025916 Bacteria 1122
162 Ga0207660_10002002 3300025917 Bacteria 13567
163 Ga0207660_10088299 3300025917 Bacteria 2292
164 Ga0207660_10271067 3300025917 Bacteria 1345
165 Ga0207649_10277256 3300025920 Bacteria 1218
166 Ga0207652_10000756 3300025921 Bacteria 31084
167 Ga0207652_10187114 3300025921 Bacteria 1862
168 Ga0207652_10249468 3300025921 Bacteria 1601
169 Ga0207694_10007642 3300025924 Bacteria 8190
170 Ga0207694_10116858 3300025924 Bacteria 2126
171 Ga0207694_10518812 3300025924 Bacteria 998
172 Ga0207694_11033406 3300025924 Bacteria 695
173 Ga0207650_10081400 3300025925 Bacteria 2456
174 Ga0207700_10091362 3300025928 Bacteria 2404
175 Ga0207700_10113452 3300025928 Bacteria 2185
176 Ga0207700_11953422 3300025928 Eukaryota 513
177 Ga0207664_10048054 3300025929 Bacteria 3354
178 Ga0207670_10005761 3300025936 Bacteria 6835
179 Ga0207669_10944808 3300025937 Bacteria 722
180 Ga0207665_10002230 3300025939 Bacteria 13076
181 Ga0207665_10059369 3300025939 Bacteria 2588
182 Ga0207691_10001031 3300025940 Bacteria 27605
183 Ga0207711_10000769 3300025941 Bacteria 31516
184 Ga0207661_10027421 3300025944 Unclassified 4351
185 Ga0207667_10005469 3300025949 Bacteria 15485
186 Ga0207651_10380867 3300025960 Unclassified 1195
187 Ga0207640_10652828 3300025981 Bacteria 897
188 Ga0207658_10002773 3300025986 Bacteria 12621
189 Ga0207703_10004034 3300026035 Bacteria 12137
190 Ga0207703_10193395 3300026035 Bacteria 1804
191 Ga0207678_10032726 3300026067 Bacteria 4532
192 Ga0207678_10512045 3300026067 Bacteria 1047
193 Ga0207678_10585861 3300026067 Bacteria 977
194 Ga0207702_10017544 3300026078 Bacteria 5922
195 Ga0207702_10107423 3300026078 Bacteria 2475
196 Ga0207702_10788950 3300026078 Bacteria 939
197 Ga0207641_10024081 3300026088 Bacteria 5017
198 Ga0207648_10023968 3300026089 Bacteria 5455
199 Ga0207675_101283322 3300026118 Bacteria 753
200 Ga0207428_10000016 3300027907 Bacteria 327690
201 Ga0265354_1000428 3300028016 Bacteria 7371
202 Ga0265355_1001273 3300028036 Archaea 1601
203 Ga0268266_10000610 3300028379 Bacteria 48690
204 Ga0268266_10144645 3300028379 Bacteria 2136
205 Ga0268265_10147248 3300028380 Bacteria 1981
206 Ga0268264_10094954 3300028381 Bacteria 2579
207 Ga0268264_10633448 3300028381 Bacteria 1057
208 Ga0265323_10006982 3300028653 Bacteria 4720
209 Ga0265323_10130499 3300028653 Bacteria 814
210 Ga0265336_10005576 3300028666 Bacteria 4631
211 Ga0265336_10049643 3300028666 Bacteria 1270
212 Ga0265338_10053305 3300028800 Bacteria 3620
213 Ga0265338_10286243 3300028800 Unclassified 1202
214 Ga0265338_10727341 3300028800 Unclassified 683
215 Ga0265770_1002733 3300030878 Unclassified 2396
216 Ga0265765_1014848 3300030879 Unclassified 901
217 Ga0265773_1012934 3300031018 Unclassified 738
218 Ga0265760_10002039 3300031090 Bacteria 5944
219 Ga0265760_10032395 3300031090 Bacteria 1543
220 Ga0265339_10358431 3300031249 Unclassified 686
221 Ga0265327_10016182 3300031251 Bacteria 4757
222 Ga0307516_10000013 3300031730 Bacteria 217896
223 Ga0307406_10038051 3300031901 Bacteria 2976
224 Ga0307406_11275289 3300031901 Bacteria 640
225 Ga0307409_100875324 3300031995 Unclassified 910
226 Ga0307415_101706474 3300032126 Bacteria 607
227 Ga0373927_0105415 3300035695 Bacteria 1836
228 Ga0373933_0365376 3300035724 Bacteria 939
229 Ga0373947_0165577 3300035725 Bacteria 1432
230 Ga0373937_0322214 3300036401 Unclassified 1462
231 Ga0373925_0245838 3300037068 Unclassified 1434
232 Ga0395901_0492438 3300038443 Bacteria 1249
233 Ga0436360_0223028 3300039438 Bacteria 2747
234 Ga0436361_0718806 3300039447 Bacteria 1915
235 Ga0436363_1236949 3300039450 Bacteria 1059
236 Ga0450898_040901 3300042134 Bacteria 876
237 Ga0450918_016383 3300042531 Bacteria 1287
238 Ga0451577_0017923 3300042876 Bacteria 6533
239 Ga0451577_0089599 3300042876 Bacteria 2745
240 Ga0451577_0311422 3300042876 Bacteria 1427
241 Ga0466969_0000292 3300044656 Bacteria 27335
242 Ga0466972_0030681 3300044658 Bacteria 2646
243 Ga0466972_0222226 3300044658 Bacteria 884
244 Ga0466966_0009319 3300044684 Bacteria 6500
245 Ga0466966_0016227 3300044684 Bacteria 4924
246 Ga0466961_0000741 3300044693 Bacteria 20439
247 Ga0466964_0000022 3300044706 Bacteria 33641
248 Ga0466964_0371264 3300044706 Bacteria 740
249 Ga0453684_0109619 3300044712 Bacteria 3357
250 Ga0466971_0008605 3300044719 Bacteria 4450
251 Ga0466970_0002411 3300044765 Bacteria 9032
252 Ga0466957_0008395 3300044842 Bacteria 5873
253 Ga0466960_0069044 3300044901 Bacteria 1755
254 Ga0466959_0003199 3300045049 Bacteria 10640
255 Ga0466959_0114990 3300045049 Bacteria 1917
256 Ga0451576_0110954 3300045051 Bacteria 2854
257 Ga0451576_0666514 3300045051 Bacteria 1093
258 Ga0466958_0058517 3300045836 Bacteria 2343
259 Ga0495604_0495749 3300047317 Bacteria 793
260 Ga0496100_0049193 3300048903 Bacteria 2725
261 Ga0496100_0324535 3300048903 Bacteria 1157
262 Ga0496101_0090768 3300048904 Bacteria 2273
263 Ga0496102_0106945 3300048905 Bacteria 2604
264 Ga0496102_1104164 3300048905 Bacteria 713
265 Ga0496103_0725969 3300048906 Unclassified 629
266 Ga0496104_0000936 3300048907 Bacteria 25051
267 Ga0496104_0109629 3300048907 Bacteria 2646
268 Ga0496104_0282453 3300048907 Unclassified 1573
269 Ga0496105_0008937 3300048908 Bacteria 7812
270 Ga0496105_0277587 3300048908 Bacteria 1352
271 Ga0496106_0001274 3300048909 Bacteria 18882
272 Ga0496107_0001617 3300048910 Bacteria 14027
273 Ga0496107_0068857 3300048910 Bacteria 2568
274 Ga0496108_0273574 3300048911 Unclassified 1470
275 Ga0496109_0097855 3300048912 Bacteria 2720
276 Ga0496110_0007435 3300048913 Bacteria 8751
277 Ga0496113_0429465 3300048916 Unclassified 1061
278 Ga0496114_0006022 3300048917 Bacteria 9542
279 Ga0496114_0921072 3300048917 Unclassified 756
280 Ga0496115_0080892 3300048918 Bacteria 2645
281 Ga0501242_007984 3300049674 Bacteria 1231
282 nmdc:mga08y16_436_c1 3300050511 Bacteria 38489
283 nmdc:mga08x19_139607_c1 3300050514 Unclassified 1636
284 nmdc:mga0a205_6645_c1 3300050515 Bacteria 10468
285 nmdc:mga0a205_87629_c1 3300050515 Bacteria 3007
286 Ga0495601_0369051 3300053077 Bacteria 932
287 Ga0495612_0089198 3300053078 Bacteria 1303
288 Ga0500583_0152180 3300053092 Bacteria 1151
289 Ga0500652_020181 3300053131 Bacteria 2490
290 Ga0500588_0172716 3300053146 Unclassified 791
291 Ga0466962_0000076 3300061719 Bacteria 39679

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_11273176 Ga0157380_112731762 157
2 3300005327 Ga0070658_11743332 Ga0070658_117433321 158
3 3300005434 Ga0070709_10045491 Ga0070709_100454912 158
4 3300005435 Ga0070714_100021592 Ga0070714_1000215925 158
5 3300005436 Ga0070713_100029008 Ga0070713_1000290083 158
6 3300005437 Ga0070710_10007211 Ga0070710_100072115 158
7 3300005439 Ga0070711_100013615 Ga0070711_1000136152 158
8 3300005445 Ga0070708_100019698 Ga0070708_1000196985 158
9 3300005445 Ga0070708_100478735 Ga0070708_1004787352 158
10 3300005467 Ga0070706_100464201 Ga0070706_1004642012 158
11 3300005536 Ga0070697_100096104 Ga0070697_1000961044 158
12 3300006175 Ga0070712_100036318 Ga0070712_1000363182 158
13 3300006914 Ga0075436_100029918 Ga0075436_1000299185 158
14 3300007788 Ga0099795_10066008 Ga0099795_100660082 158
15 3300010159 Ga0099796_10091153 Ga0099796_100911532 158
16 3300025898 Ga0207692_10088930 Ga0207692_100889302 158
17 3300025906 Ga0207699_10045710 Ga0207699_100457102 158
18 3300025916 Ga0207663_10040463 Ga0207663_100404633 158
19 3300025925 Ga0207650_10081400 Ga0207650_100814003 158
20 3300025928 Ga0207700_10113452 Ga0207700_101134522 158
21 3300025939 Ga0207665_10059369 Ga0207665_100593692 158
22 3300031901 Ga0307406_10038051 Ga0307406_100380512 158
23 3300031901 Ga0307406_11275289 Ga0307406_112752891 158
24 3300031995 Ga0307409_100875324 Ga0307409_1008753241 158
25 3300032126 Ga0307415_101706474 Ga0307415_1017064742 158
26 3300045051 Ga0451576_0666514 Ga0451576_0666514_122_604 158
27 3300049674 Ga0501242_007984 Ga0501242_007984_77_559 158
28 3300050514 nmdc:mga08x19_139607_c1 nmdc:mga08x19_139607_c1_1009_1485 158
29 3300005330 Ga0070690_100690000 Ga0070690_1006900002 159
30 3300005471 Ga0070698_100373111 Ga0070698_1003731112 159
31 3300005617 Ga0068859_100038136 Ga0068859_1000381362 159
32 3300005618 Ga0068864_100067746 Ga0068864_1000677462 159
33 3300005844 Ga0068862_100536863 Ga0068862_1005368632 159
34 3300005937 Ga0081455_10439296 Ga0081455_104392962 159
35 3300006931 Ga0097620_100038135 Ga0097620_1000381352 159
36 3300009093 Ga0105240_10027364 Ga0105240_100273647 159
37 3300010375 Ga0105239_10015925 Ga0105239_100159256 159
38 3300025913 Ga0207695_10065744 Ga0207695_100657443 159
39 3300026118 Ga0207675_101283322 Ga0207675_1012833221 159
40 3300028380 Ga0268265_10147248 Ga0268265_101472482 159
41 3300000546 LJNas_1007771 LJNas_10077712 160
42 3300005293 Ga0065715_10777895 Ga0065715_107778951 160
43 3300005329 Ga0070683_100018620 Ga0070683_1000186203 160
44 3300005330 Ga0070690_100001165 Ga0070690_1000011657 160
45 3300005335 Ga0070666_10000467 Ga0070666_100004678 160
46 3300005336 Ga0070680_100000310 Ga0070680_10000031012 160
47 3300005336 Ga0070680_100080417 Ga0070680_1000804174 160
48 3300005336 Ga0070680_100095448 Ga0070680_1000954482 160
49 3300005337 Ga0070682_100122291 Ga0070682_1001222912 160
50 3300005340 Ga0070689_100055761 Ga0070689_1000557614 160
51 3300005356 Ga0070674_100057889 Ga0070674_1000578891 160
52 3300005364 Ga0070673_100204463 Ga0070673_1002044632 160
53 3300005364 Ga0070673_100464467 Ga0070673_1004644671 160
54 3300005367 Ga0070667_100004454 Ga0070667_10000445411 160
55 3300005435 Ga0070714_100004693 Ga0070714_1000046934 160
56 3300005436 Ga0070713_100043459 Ga0070713_1000434595 160
57 3300005436 Ga0070713_100271283 Ga0070713_1002712832 160
58 3300005437 Ga0070710_10032185 Ga0070710_100321853 160
59 3300005437 Ga0070710_10273056 Ga0070710_102730562 160
60 3300005439 Ga0070711_100006856 Ga0070711_1000068564 160
61 3300005439 Ga0070711_100052159 Ga0070711_1000521592 160
62 3300005440 Ga0070705_100224824 Ga0070705_1002248241 160
63 3300005455 Ga0070663_100637460 Ga0070663_1006374602 160
64 3300005458 Ga0070681_10020714 Ga0070681_100207141 160
65 3300005458 Ga0070681_10020979 Ga0070681_100209792 160
66 3300005459 Ga0068867_100015242 Ga0068867_1000152426 160
67 3300005468 Ga0070707_100211348 Ga0070707_1002113482 160
68 3300005518 Ga0070699_100122478 Ga0070699_1001224783 160
69 3300005518 Ga0070699_100773261 Ga0070699_1007732612 160
70 3300005530 Ga0070679_100001074 Ga0070679_10000107417 160
71 3300005530 Ga0070679_100084703 Ga0070679_1000847032 160
72 3300005530 Ga0070679_100197231 Ga0070679_1001972312 160
73 3300005535 Ga0070684_100018468 Ga0070684_1000184683 160
74 3300005543 Ga0070672_100001333 Ga0070672_1000013337 160
75 3300005545 Ga0070695_100313692 Ga0070695_1003136922 160
76 3300005546 Ga0070696_100000267 Ga0070696_10000026727 160
77 3300005546 Ga0070696_100265179 Ga0070696_1002651792 160
78 3300005546 Ga0070696_101016587 Ga0070696_1010165871 160
79 3300005548 Ga0070665_100000552 Ga0070665_10000055238 160
80 3300005548 Ga0070665_100018711 Ga0070665_1000187117 160
81 3300005549 Ga0070704_100059840 Ga0070704_1000598402 160
82 3300005563 Ga0068855_100004496 Ga0068855_10000449612 160
83 3300005563 Ga0068855_100156160 Ga0068855_1001561603 160
84 3300005563 Ga0068855_100157845 Ga0068855_1001578453 160
85 3300005563 Ga0068855_100971319 Ga0068855_1009713192 160
86 3300005563 Ga0068855_101850983 Ga0068855_1018509831 160
87 3300005578 Ga0068854_100721519 Ga0068854_1007215192 160
88 3300005614 Ga0068856_100017320 Ga0068856_1000173203 160
89 3300005614 Ga0068856_100140670 Ga0068856_1001406702 160
90 3300005614 Ga0068856_100852298 Ga0068856_1008522981 160
91 3300005615 Ga0070702_100232958 Ga0070702_1002329581 160
92 3300005617 Ga0068859_100011570 Ga0068859_1000115702 160
93 3300005617 Ga0068859_100677944 Ga0068859_1006779442 160
94 3300005841 Ga0068863_100058263 Ga0068863_1000582633 160
95 3300005842 Ga0068858_100001625 Ga0068858_1000016257 160
96 3300005843 Ga0068860_100000924 Ga0068860_1000009248 160
97 3300005843 Ga0068860_101631112 Ga0068860_1016311122 160
98 3300005985 Ga0081539_10000007 Ga0081539_10000007236 160
99 3300006028 Ga0070717_10000590 Ga0070717_1000059015 160
100 3300006163 Ga0070715_10466365 Ga0070715_104663651 160
101 3300006175 Ga0070712_100106874 Ga0070712_1001068742 160
102 3300006175 Ga0070712_100394264 Ga0070712_1003942642 160
103 3300006175 Ga0070712_100437410 Ga0070712_1004374102 160
104 3300006237 Ga0097621_100811065 Ga0097621_1008110652 160
105 3300006844 Ga0075428_100371370 Ga0075428_1003713702 160
106 3300006846 Ga0075430_100031941 Ga0075430_1000319415 160
107 3300006852 Ga0075433_10006176 Ga0075433_1000617610 160
108 3300006852 Ga0075433_10125822 Ga0075433_101258222 160
109 3300006871 Ga0075434_100015501 Ga0075434_1000155013 160
110 3300006871 Ga0075434_100185600 Ga0075434_1001856002 160
111 3300006881 Ga0068865_100593268 Ga0068865_1005932681 160
112 3300006931 Ga0097620_100011570 Ga0097620_1000115702 160
113 3300006931 Ga0097620_100677846 Ga0097620_1006778462 160
114 3300007076 Ga0075435_100535956 Ga0075435_1005359562 160
115 3300007265 Ga0099794_10226068 Ga0099794_102260681 160
116 3300007265 Ga0099794_10403115 Ga0099794_104031152 160
117 3300007788 Ga0099795_10007383 Ga0099795_100073833 160
118 3300007788 Ga0099795_10251211 Ga0099795_102512111 160
119 3300009093 Ga0105240_10000847 Ga0105240_100008476 160
120 3300009093 Ga0105240_10024775 Ga0105240_100247752 160
121 3300009093 Ga0105240_10165531 Ga0105240_101655312 160
122 3300009093 Ga0105240_10511447 Ga0105240_105114472 160
123 3300009101 Ga0105247_10035266 Ga0105247_100352664 160
124 3300009177 Ga0105248_10006845 Ga0105248_100068457 160
125 3300009545 Ga0105237_10510654 Ga0105237_105106542 160
126 3300009545 Ga0105237_11545039 Ga0105237_115450392 160
127 3300009551 Ga0105238_10001146 Ga0105238_100011468 160
128 3300009551 Ga0105238_10102025 Ga0105238_101020253 160
129 3300009551 Ga0105238_10671881 Ga0105238_106718812 160
130 3300009551 Ga0105238_11363343 Ga0105238_113633431 160
131 3300009551 Ga0105238_11464468 Ga0105238_114644681 160
132 3300010159 Ga0099796_10002480 Ga0099796_100024805 160
133 3300010375 Ga0105239_10893596 Ga0105239_108935962 160
134 3300013104 Ga0157370_10000396 Ga0157370_1000039637 160
135 3300013104 Ga0157370_10243599 Ga0157370_102435992 160
136 3300013104 Ga0157370_10969415 Ga0157370_109694151 160
137 3300013105 Ga0157369_10010072 Ga0157369_100100727 160
138 3300013105 Ga0157369_10041843 Ga0157369_100418434 160
139 3300013105 Ga0157369_10565223 Ga0157369_105652231 160
140 3300013296 Ga0157374_10218517 Ga0157374_102185172 160
141 3300013297 Ga0157378_10004289 Ga0157378_100042898 160
142 3300013307 Ga0157372_11202463 Ga0157372_112024631 160
143 3300013307 Ga0157372_11527132 Ga0157372_115271322 160
144 3300013308 Ga0157375_10179931 Ga0157375_101799312 160
145 3300014325 Ga0163163_12136616 Ga0163163_121366161 160
146 3300014968 Ga0157379_10012170 Ga0157379_100121705 160
147 3300014969 Ga0157376_10001559 Ga0157376_100015594 160
148 3300014969 Ga0157376_10321960 Ga0157376_103219603 160
149 3300020070 Ga0206356_10053723 Ga0206356_100537231 160
150 3300020078 Ga0206352_10019620 Ga0206352_100196201 160
151 3300022467 Ga0224712_10275260 Ga0224712_102752601 160
152 3300025898 Ga0207692_10122373 Ga0207692_101223732 160
153 3300025906 Ga0207699_10370651 Ga0207699_103706511 160
154 3300025906 Ga0207699_10425348 Ga0207699_104253482 160
155 3300025909 Ga0207705_10721396 Ga0207705_107213961 160
156 3300025910 Ga0207684_10863847 Ga0207684_108638472 160
157 3300025912 Ga0207707_10000104 Ga0207707_1000010424 160
158 3300025912 Ga0207707_10004033 Ga0207707_1000403310 160
159 3300025912 Ga0207707_10006165 Ga0207707_100061652 160
160 3300025912 Ga0207707_10020734 Ga0207707_100207342 160
161 3300025912 Ga0207707_10064092 Ga0207707_100640922 160
162 3300025913 Ga0207695_10003434 Ga0207695_1000343415 160
163 3300025913 Ga0207695_10042395 Ga0207695_100423953 160
164 3300025913 Ga0207695_10127759 Ga0207695_101277592 160
165 3300025913 Ga0207695_10222793 Ga0207695_102227931 160
166 3300025913 Ga0207695_10251397 Ga0207695_102513972 160
167 3300025914 Ga0207671_10203583 Ga0207671_102035832 160
168 3300025915 Ga0207693_10167986 Ga0207693_101679862 160
169 3300025915 Ga0207693_10357515 Ga0207693_103575152 160
170 3300025915 Ga0207693_10605279 Ga0207693_106052792 160
171 3300025916 Ga0207663_10249122 Ga0207663_102491222 160
172 3300025916 Ga0207663_10253453 Ga0207663_102534532 160
173 3300025916 Ga0207663_10347734 Ga0207663_103477342 160
174 3300025917 Ga0207660_10002002 Ga0207660_100020027 160
175 3300025917 Ga0207660_10088299 Ga0207660_100882992 160
176 3300025917 Ga0207660_10271067 Ga0207660_102710671 160
177 3300025920 Ga0207649_10277256 Ga0207649_102772562 160
178 3300025921 Ga0207652_10000756 Ga0207652_1000075615 160
179 3300025921 Ga0207652_10187114 Ga0207652_101871142 160
180 3300025921 Ga0207652_10249468 Ga0207652_102494682 160
181 3300025924 Ga0207694_10007642 Ga0207694_100076427 160
182 3300025924 Ga0207694_10116858 Ga0207694_101168581 160
183 3300025924 Ga0207694_10518812 Ga0207694_105188121 160
184 3300025924 Ga0207694_11033406 Ga0207694_110334062 160
185 3300025928 Ga0207700_10091362 Ga0207700_100913623 160
186 3300025928 Ga0207700_11953422 Ga0207700_119534221 160
187 3300025929 Ga0207664_10048054 Ga0207664_100480546 160
188 3300025936 Ga0207670_10005761 Ga0207670_100057617 160
189 3300025937 Ga0207669_10944808 Ga0207669_109448082 160
190 3300025939 Ga0207665_10002230 Ga0207665_1000223014 160
191 3300025940 Ga0207691_10001031 Ga0207691_100010318 160
192 3300025941 Ga0207711_10000769 Ga0207711_100007696 160
193 3300025944 Ga0207661_10027421 Ga0207661_100274212 160
194 3300025949 Ga0207667_10005469 Ga0207667_100054696 160
195 3300025960 Ga0207651_10380867 Ga0207651_103808672 160
196 3300025981 Ga0207640_10652828 Ga0207640_106528282 160
197 3300025986 Ga0207658_10002773 Ga0207658_100027736 160
198 3300026035 Ga0207703_10004034 Ga0207703_1000403411 160
199 3300026035 Ga0207703_10193395 Ga0207703_101933952 160
200 3300026067 Ga0207678_10032726 Ga0207678_100327262 160
201 3300026067 Ga0207678_10512045 Ga0207678_105120452 160
202 3300026067 Ga0207678_10585861 Ga0207678_105858612 160
203 3300026078 Ga0207702_10017544 Ga0207702_100175446 160
204 3300026078 Ga0207702_10107423 Ga0207702_101074232 160
205 3300026078 Ga0207702_10788950 Ga0207702_107889501 160
206 3300026088 Ga0207641_10024081 Ga0207641_100240814 160
207 3300026089 Ga0207648_10023968 Ga0207648_100239682 160
208 3300027907 Ga0207428_10000016 Ga0207428_10000016230 160
209 3300028016 Ga0265354_1000428 Ga0265354_10004285 160
210 3300028036 Ga0265355_1001273 Ga0265355_10012732 160
211 3300028379 Ga0268266_10000610 Ga0268266_1000061038 160
212 3300028379 Ga0268266_10144645 Ga0268266_101446452 160
213 3300028381 Ga0268264_10094954 Ga0268264_100949542 160
214 3300028381 Ga0268264_10633448 Ga0268264_106334482 160
215 3300028653 Ga0265323_10006982 Ga0265323_100069822 160
216 3300028653 Ga0265323_10130499 Ga0265323_101304991 160
217 3300028666 Ga0265336_10005576 Ga0265336_100055764 160
218 3300028666 Ga0265336_10049643 Ga0265336_100496432 160
219 3300028800 Ga0265338_10053305 Ga0265338_100533052 160
220 3300028800 Ga0265338_10286243 Ga0265338_102862432 160
221 3300028800 Ga0265338_10727341 Ga0265338_107273412 160
222 3300030878 Ga0265770_1002733 Ga0265770_10027332 160
223 3300030879 Ga0265765_1014848 Ga0265765_10148481 160
224 3300031018 Ga0265773_1012934 Ga0265773_10129341 160
225 3300031090 Ga0265760_10002039 Ga0265760_100020398 160
226 3300031090 Ga0265760_10032395 Ga0265760_100323952 160
227 3300031249 Ga0265339_10358431 Ga0265339_103584311 160
228 3300031251 Ga0265327_10016182 Ga0265327_100161824 160
229 3300031730 Ga0307516_10000013 Ga0307516_10000013191 160
230 3300035695 Ga0373927_0105415 Ga0373927_0105415_1157_1639 160
231 3300035724 Ga0373933_0365376 Ga0373933_0365376_354_836 160
232 3300035725 Ga0373947_0165577 Ga0373947_0165577_680_1162 160
233 3300036401 Ga0373937_0322214 Ga0373937_0322214_206_688 160
234 3300037068 Ga0373925_0245838 Ga0373925_0245838_930_1412 160
235 3300038443 Ga0395901_0492438 Ga0395901_0492438_78_560 160
236 3300039438 Ga0436360_0223028 Ga0436360_0223028_1546_2028 160
237 3300039447 Ga0436361_0718806 Ga0436361_0718806_959_1441 160
238 3300039450 Ga0436363_1236949 Ga0436363_1236949_228_710 160
239 3300042134 Ga0450898_040901 Ga0450898_040901_61_585 160
240 3300042531 Ga0450918_016383 Ga0450918_016383_91_615 160
241 3300042876 Ga0451577_0017923 Ga0451577_0017923_4908_5390 160
242 3300042876 Ga0451577_0089599 Ga0451577_0089599_1018_1506 160
243 3300042876 Ga0451577_0311422 Ga0451577_0311422_574_1056 160
244 3300044656 Ga0466969_0000292 Ga0466969_0000292_11943_12425 160
245 3300044658 Ga0466972_0030681 Ga0466972_0030681_1236_1718 160
246 3300044658 Ga0466972_0222226 Ga0466972_0222226_161_643 160
247 3300044684 Ga0466966_0009319 Ga0466966_0009319_3837_4319 160
248 3300044684 Ga0466966_0016227 Ga0466966_0016227_1081_1563 160
249 3300044693 Ga0466961_0000741 Ga0466961_0000741_10774_11256 160
250 3300044706 Ga0466964_0000022 Ga0466964_0000022_20433_20915 160
251 3300044706 Ga0466964_0371264 Ga0466964_0371264_170_652 160
252 3300044712 Ga0453684_0109619 Ga0453684_0109619_1763_2245 160
253 3300044719 Ga0466971_0008605 Ga0466971_0008605_1692_2174 160
254 3300044765 Ga0466970_0002411 Ga0466970_0002411_4158_4640 160
255 3300044842 Ga0466957_0008395 Ga0466957_0008395_4411_4893 160
256 3300044901 Ga0466960_0069044 Ga0466960_0069044_417_899 160
257 3300045049 Ga0466959_0003199 Ga0466959_0003199_8795_9277 160
258 3300045049 Ga0466959_0114990 Ga0466959_0114990_572_1054 160
259 3300045051 Ga0451576_0110954 Ga0451576_0110954_869_1351 160
260 3300045836 Ga0466958_0058517 Ga0466958_0058517_734_1216 160
261 3300047317 Ga0495604_0495749 Ga0495604_0495749_141_623 160
262 3300048903 Ga0496100_0049193 Ga0496100_0049193_940_1422 160
263 3300048903 Ga0496100_0324535 Ga0496100_0324535_226_708 160
264 3300048904 Ga0496101_0090768 Ga0496101_0090768_770_1252 160
265 3300048905 Ga0496102_0106945 Ga0496102_0106945_773_1255 160
266 3300048905 Ga0496102_1104164 Ga0496102_1104164_221_703 160
267 3300048906 Ga0496103_0725969 Ga0496103_0725969_103_585 160
268 3300048907 Ga0496104_0000936 Ga0496104_0000936_17671_18153 160
269 3300048907 Ga0496104_0109629 Ga0496104_0109629_787_1269 160
270 3300048907 Ga0496104_0282453 Ga0496104_0282453_994_1476 160
271 3300048908 Ga0496105_0008937 Ga0496105_0008937_2486_2968 160
272 3300048908 Ga0496105_0277587 Ga0496105_0277587_754_1236 160
273 3300048909 Ga0496106_0001274 Ga0496106_0001274_4808_5290 160
274 3300048910 Ga0496107_0001617 Ga0496107_0001617_4241_4723 160
275 3300048910 Ga0496107_0068857 Ga0496107_0068857_775_1257 160
276 3300048911 Ga0496108_0273574 Ga0496108_0273574_72_554 160
277 3300048912 Ga0496109_0097855 Ga0496109_0097855_882_1364 160
278 3300048913 Ga0496110_0007435 Ga0496110_0007435_7641_8123 160
279 3300048916 Ga0496113_0429465 Ga0496113_0429465_34_516 160
280 3300048917 Ga0496114_0006022 Ga0496114_0006022_6741_7223 160
281 3300048917 Ga0496114_0921072 Ga0496114_0921072_31_513 160
282 3300048918 Ga0496115_0080892 Ga0496115_0080892_1885_2367 160
283 3300050511 nmdc:mga08y16_436_c1 nmdc:mga08y16_436_c1_35410_35892 160
284 3300050515 nmdc:mga0a205_6645_c1 nmdc:mga0a205_6645_c1_3705_4187 160
285 3300050515 nmdc:mga0a205_87629_c1 nmdc:mga0a205_87629_c1_2123_2605 160
286 3300053077 Ga0495601_0369051 Ga0495601_0369051_354_863 160
287 3300053078 Ga0495612_0089198 Ga0495612_0089198_340_822 160
288 3300053092 Ga0500583_0152180 Ga0500583_0152180_225_707 160
289 3300053131 Ga0500652_020181 Ga0500652_020181_1602_2084 160
290 3300053146 Ga0500588_0172716 Ga0500588_0172716_24_506 160
291 3300061719 Ga0466962_0000076 Ga0466962_0000076_2149_2631 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

50

193

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ge4-assembly1.cif.gz_E crystal structure of ferritin:dna-binding protein dps from brucella melitensis 0.9776 1 160
1o9r-assembly1.cif.gz_A the x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect dna without binding 0.9771 2 160
3ge4-assembly1.cif.gz_E crystal structure of ferritin:dna-binding protein dps from brucella melitensis 0.9717 1 160
5ww9-assembly1.cif.gz_B crystal structure of r73e mutant of the second dna-binding protein under starvation from mycobacterium smegmatis 0.9696 15 158
8pv9-assembly1.cif.gz_A structure of dps determined by cryoem at 100 kev 0.9695 1 154
ID Description Score Start End Superfamily
1o9rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9771 2 160 1.20.1260.10
2yw7A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9675 11 155 1.20.1260.10
4dyuA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9666 1 154 1.20.1260.10
1o9rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9652 2 160 1.20.1260.10
2yw6A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9651 11 158 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2V7RXL1-F1-model_v4 DNA starvation/stationary phase protection protein Dps 0.9952 1 157 GO:0008199
GO:0016722
AF-A0A1V1PNB9-F1-model_v4 Non-specific DNA-binding protein Dps (EC 1.16.3.1) 0.9952 1 157 GO:0003677
GO:0004322
GO:0008199
AF-E6PI45-F1-model_v4 DNA protection during starvation protein (EC 1.16.-.-) 0.9939 1 157 GO:0008199
GO:0016722
AF-A0A2V9P229-F1-model_v4 DNA starvation/stationary phase protection protein Dps 0.9936 1 160 GO:0008199
GO:0016722
AF-A0A2W4X8B7-F1-model_v4 DNA starvation/stationary phase protection protein Dps 0.9935 1 156 GO:0008199
GO:0016722

Feature Viewer

pLDDT pTM Quality
96.98 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map