F386408

General Info

Members Datasets Scaffolds Average Seq Length
284 164 229 362

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0149987|Ga0496110_0149987_504_1697
Length 397
Sequence MKTEKDDIFAAALFYAALHPSCHGMNRFIVEFREYTDWLPNWVVSIGLLVAAVLIGLAIHRFGFRILTKLVESKDLFWRSLVSRGRRPLRLAILTFTLSFAATVAPLAPRPAEVIRHVLLLAFIIVLGWAAKTALHIWMTVYLRRFKLDAEDNLLARAHVTQSRIAERIGGAMIVILTLAAMLMTFPAVQQYGVSVLASAGVAGIVLGLALQPMLKNIFAGIQLAITQPIRIDDALIVEGEWGNVEEITSTYVVVKLWDWRRMILPLSYFIETPFQNWTREGSALIGTVMIYLDYSIPVSVLRKKVEEITAESKIWDKRVVNVQVTDFRESVMEIRILASANSAPKVFDLRCEVREKLVEFIQREYPQALPKVRTDRPLEGNGAAILGAGAHASFQS

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
3 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
4 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
5 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
6 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
7 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
8 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
9 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
10 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
11 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
12 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
13 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
14 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
15 2643221584 Caulobacter sp. Root656 Isolate Unclassified
16 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
17 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
18 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
19 2738541293 Rhizobium sp. GV031 Isolate Unclassified
20 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
21 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
22 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
23 2818991435 Caulobacter henricii 536 Isolate Unclassified
24 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
25 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
26 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
27 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
28 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
29 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
30 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
31 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
32 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
33 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
34 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
35 2849560528 Caulobacter zeae 410 Isolate Unclassified
36 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
37 2851153111 Caulobacter radicis 736 Isolate Unclassified
38 2851182111 Bosea sp. Tri-44 Isolate Nodule
39 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
40 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
41 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
42 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
43 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
44 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
45 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
46 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
47 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
48 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
49 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
50 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
51 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
52 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
53 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
57 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
62 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
63 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
146 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
147 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
148 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
157 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
158 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
161 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
162 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
163 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
164 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.63
Metatranscriptomes 0
Isolates 19.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 41.2
Nodule 6.34
Rhizoplane 3.17
Rhizosphere 27.11
Stem 0
Stem Tuber 0
Unclassified 22.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000248 3300002773 Bacteria 36228
2 JGI25152J39213_1004255 3300002773 Bacteria 4573
3 JGI25150J39212_1000017 3300002774 Bacteria 150316
4 JGI25150J39212_1001930 3300002774 Bacteria 5438
5 JGI25159J45721_1000721 3300002987 Bacteria 14418
6 JGI25159J45721_1001392 3300002987 Bacteria 10034
7 JGI25151J46595_10000007 3300003187 Bacteria 411751
8 JGI25151J46595_10004290 3300003187 Bacteria 7579
9 JGI25153J46596_10001151 3300003215 Bacteria 16001
10 JGI25153J46596_10002745 3300003215 Bacteria 10021
11 JGI25153J46596_10013249 3300003215 Bacteria 3498
12 rootL2_10043244 3300003322 Bacteria 2125
13 rootL2_10043245 3300003322 Bacteria 4406
14 JGI25161J50226_1000104 3300003374 Bacteria 67942
15 Ga0055526_1000861 3300003771 Bacteria 22617
16 Ga0055526_1005324 3300003771 Bacteria 7438
17 Ga0055526_1011114 3300003771 Bacteria 4102
18 Ga0055524_1000071 3300003775 Bacteria 127466
19 Ga0055524_1009921 3300003775 Bacteria 3828
20 Ga0055524_1011176 3300003775 Bacteria 3527
21 Ga0055536_1000533 3300003781 Bacteria 26098
22 Ga0055536_1000731 3300003781 Bacteria 22086
23 Ga0055536_1008809 3300003781 Bacteria 4272
24 Ga0055536_1010534 3300003781 Bacteria 3656
25 Ga0055528_1000176 3300003790 Bacteria 54005
26 Ga0055528_1002375 3300003790 Bacteria 10167
27 Ga0055530_10002566 3300003791 Bacteria 11530
28 Ga0055530_10008385 3300003791 Bacteria 4150
29 Ga0055540_1001623 3300003792 Bacteria 13090
30 Ga0055531_10000667 3300003794 Bacteria 29334
31 Ga0055531_10000800 3300003794 Bacteria 26095
32 Ga0055543_1000166 3300004625 Bacteria 55052
33 Ga0055543_1015407 3300004625 Bacteria 1472
34 Ga0065165_1000046 3300005262 Bacteria 198873
35 Ga0065165_1000955 3300005262 Bacteria 36390
36 Ga0065165_1007467 3300005262 Bacteria 5360
37 Ga0065165_1009354 3300005262 Bacteria 4407
38 Ga0081539_10000923 3300005985 Bacteria 55361
39 Ga0075365_10015010 3300006038 Bacteria 4674
40 Ga0075364_10000512 3300006051 Bacteria 19720
41 Ga0075364_10197027 3300006051 Bacteria 1365
42 Ga0075369_10027347 3300006186 Bacteria 2384
43 Ga0075370_10046507 3300006353 Bacteria 2456
44 Ga0079104_1000015 3300006946 Bacteria 321803
45 Ga0157371_10042994 3300013102 Bacteria 3219
46 Ga0157370_10199019 3300013104 Bacteria 1859
47 Ga0157369_10108531 3300013105 Bacteria 2952
48 Ga0209436_100023 3300025208 Bacteria 96401
49 Ga0209436_100027 3300025208 Bacteria 87534
50 Ga0207425_1000018 3300025245 Bacteria 411841
51 Ga0207425_1004274 3300025245 Bacteria 4333
52 Ga0209129_1000026 3300025258 Bacteria 411839
53 Ga0209129_1000242 3300025258 Bacteria 58534
54 Ga0209129_1000952 3300025258 Bacteria 17416
55 Ga0209129_1001954 3300025258 Bacteria 10754
56 Ga0209673_1002378 3300025273 Bacteria 13215
57 Ga0209673_1002764 3300025273 Bacteria 11459
58 Ga0209673_1011585 3300025273 Bacteria 3624
59 Ga0209130_1000173 3300025284 Bacteria 92248
60 Ga0209130_1000201 3300025284 Bacteria 80429
61 Ga0209130_1006392 3300025284 Bacteria 3839
62 Ga0209675_1000926 3300025291 Bacteria 18722
63 Ga0209676_1000038 3300025292 Bacteria 449305
64 Ga0209676_1000128 3300025292 Bacteria 188099
65 Ga0209676_1000151 3300025292 Bacteria 167307
66 Ga0209676_1000644 3300025292 Bacteria 50062
67 Ga0209676_1007532 3300025292 Bacteria 5079
68 Ga0209025_1000035 3300025294 Bacteria 411841
69 Ga0209025_1000738 3300025294 Bacteria 55187
70 Ga0209025_1001249 3300025294 Bacteria 35273
71 Ga0209025_1005863 3300025294 Bacteria 9822
72 Ga0209025_1009297 3300025294 Bacteria 6880
73 Ga0209564_1000034 3300025295 Bacteria 444284
74 Ga0209564_1000909 3300025295 Bacteria 38742
75 Ga0209564_1001125 3300025295 Bacteria 31471
76 Ga0209564_1005848 3300025295 Bacteria 6842
77 Ga0209758_1000040 3300025297 Bacteria 411841
78 Ga0209758_1000882 3300025297 Bacteria 41200
79 Ga0209758_1001059 3300025297 Bacteria 35937
80 Ga0209758_1003686 3300025297 Bacteria 13617
81 Ga0209758_1007405 3300025297 Bacteria 7490
82 Ga0209050_1000796 3300025298 Bacteria 44614
83 Ga0209050_1001101 3300025298 Bacteria 32754
84 Ga0209050_1024401 3300025298 Bacteria 2093
85 Ga0209256_1000026 3300025299 Bacteria 432835
86 Ga0209256_1000743 3300025299 Bacteria 42721
87 Ga0209256_1002502 3300025299 Bacteria 14815
88 Ga0209256_1002582 3300025299 Bacteria 14431
89 Ga0207426_1000047 3300025302 Bacteria 417011
90 Ga0209051_1001225 3300025303 Bacteria 23074
91 Ga0209051_1029972 3300025303 Bacteria 2120
92 Ga0209257_1000060 3300025304 Bacteria 372267
93 Ga0209257_1000413 3300025304 Bacteria 82516
94 Ga0209257_1000760 3300025304 Bacteria 48318
95 Ga0207650_10000377 3300025925 Bacteria 41945
96 Ga0209281_1000068 3300027111 Bacteria 280238
97 Ga0307515_10013597 3300028794 Bacteria 15182
98 Ga0307405_10001612 3300031731 Bacteria 9590
99 Ga0307406_10009241 3300031901 Bacteria 5523
100 Ga0307406_10018861 3300031901 Bacteria 4039
101 Ga0307412_10005814 3300031911 Bacteria 6937
102 Ga0439465_0026179 3300041413 Bacteria 1843
103 Ga0439459_0009218 3300042438 Bacteria 1704
104 Ga0495638_0000683 3300046460 Bacteria 36875
105 Ga0495638_0001072 3300046460 Bacteria 26688
106 Ga0495638_0004440 3300046460 Bacteria 10627
107 Ga0495638_0013388 3300046460 Bacteria 5585
108 Ga0495638_0024753 3300046460 Bacteria 3908
109 Ga0495650_0000237 3300046471 Bacteria 110872
110 Ga0495583_0000001 3300046506 Bacteria 811973
111 Ga0495606_0034655 3300046507 Bacteria 3463
112 Ga0495610_0000123 3300046512 Bacteria 87684
113 Ga0495610_0000336 3300046512 Bacteria 49714
114 Ga0495616_0000109 3300046513 Bacteria 71495
115 Ga0495620_0008009 3300046515 Bacteria 5694
116 Ga0495620_0030090 3300046515 Bacteria 2505
117 Ga0495631_0018970 3300046518 Bacteria 3232
118 Ga0495632_0000688 3300046519 Bacteria 30781
119 Ga0495632_0000872 3300046519 Bacteria 26502
120 Ga0495643_0024670 3300046522 Bacteria 3409
121 Ga0495643_0074888 3300046522 Bacteria 1772
122 Ga0495648_0040020 3300046524 Bacteria 2977
123 Ga0495648_0049087 3300046524 Bacteria 2591
124 Ga0495654_0000206 3300046530 Bacteria 56047
125 Ga0495654_0000651 3300046530 Bacteria 27343
126 Ga0495654_0074086 3300046530 Bacteria 1609
127 Ga0495609_0102851 3300046538 Bacteria 1237
128 Ga0495633_0019584 3300046558 Bacteria 3421
129 Ga0495668_0000037 3300046616 Bacteria 233981
130 Ga0495668_0000067 3300046616 Bacteria 176418
131 Ga0495668_0021724 3300046616 Bacteria 3675
132 Ga0495668_0036797 3300046616 Bacteria 2741
133 Ga0495668_0050432 3300046616 Bacteria 2306
134 Ga0495625_0000284 3300046660 Bacteria 78635
135 Ga0495625_0001556 3300046660 Bacteria 27307
136 Ga0495625_0004062 3300046660 Bacteria 13986
137 Ga0495625_0067013 3300046660 Bacteria 2527
138 Ga0495649_0000649 3300046694 Bacteria 28270
139 Ga0495649_0040369 3300046694 Bacteria 2556
140 Ga0495660_0001590 3300046810 Bacteria 15256
141 Ga0495660_0023064 3300046810 Bacteria 3552
142 Ga0495660_0077664 3300046810 Bacteria 1747
143 Ga0495672_0040932 3300047320 Bacteria 2807
144 Ga0495672_0051201 3300047320 Bacteria 2433
145 Ga0495683_0055683 3300047323 Bacteria 1968
146 Ga0495683_0114617 3300047323 Bacteria 1284
147 Ga0495673_0000115 3300047469 Bacteria 154414
148 Ga0495673_0094379 3300047469 Bacteria 1218
149 Ga0495686_0009740 3300047472 Bacteria 6896
150 Ga0496101_0082613 3300048904 Bacteria 2377
151 Ga0496110_0149987 3300048913 Bacteria 2111
152 Ga0496111_0007271 3300048914 Bacteria 7248
153 Ga0496115_0054745 3300048918 Bacteria 3204
154 Ga0496116_0001650 3300048919 Bacteria 24541
155 Ga0496116_0004875 3300048919 Bacteria 12657
156 Ga0496116_0013890 3300048919 Bacteria 6459
157 Ga0496116_0099391 3300048919 Bacteria 1743
158 Ga0496117_0003659 3300048920 Bacteria 17683
159 Ga0496117_0009944 3300048920 Bacteria 8748
160 Ga0496117_0056917 3300048920 Bacteria 2719
161 Ga0496118_0002287 3300048921 Bacteria 26125
162 Ga0496118_0011617 3300048921 Bacteria 8568
163 Ga0496118_0054040 3300048921 Bacteria 3046
164 Ga0496119_0005800 3300048922 Bacteria 11680
165 Ga0496121_0001095 3300048924 Bacteria 47819
166 Ga0496121_0006203 3300048924 Bacteria 14983
167 Ga0496122_0000042 3300048925 Bacteria 280482
168 Ga0496122_0003833 3300048925 Bacteria 19330
169 Ga0496122_0007544 3300048925 Bacteria 12052
170 Ga0496122_0009471 3300048925 Bacteria 10258
171 Ga0496122_0012921 3300048925 Bacteria 8244
172 Ga0496122_0097686 3300048925 Bacteria 1975
173 Ga0496122_0196100 3300048925 Bacteria 1186
174 Ga0496123_0000030 3300048926 Bacteria 291764
175 Ga0496123_0001682 3300048926 Bacteria 29611
176 Ga0496123_0013700 3300048926 Bacteria 6781
177 Ga0496123_0029216 3300048926 Bacteria 4065
178 Ga0496123_0042800 3300048926 Bacteria 3119
179 Ga0496123_0054375 3300048926 Bacteria 2636
180 Ga0496124_0002304 3300048927 Bacteria 25197
181 Ga0496124_0015473 3300048927 Bacteria 7310
182 Ga0496124_0029740 3300048927 Bacteria 4860
183 Ga0496124_0035685 3300048927 Bacteria 4348
184 Ga0496124_0123688 3300048927 Bacteria 2064
185 Ga0496125_0005479 3300048928 Bacteria 14086
186 Ga0496125_0007633 3300048928 Bacteria 11473
187 Ga0496125_0011767 3300048928 Bacteria 8720
188 Ga0496125_0125763 3300048928 Bacteria 1817
189 Ga0496125_0178963 3300048928 Bacteria 1415
190 Ga0496126_0001375 3300048929 Bacteria 38456
191 Ga0495678_053175 3300049459 Bacteria 1556
192 Ga0501037_0031020 3300049573 Bacteria 3947
193 Ga0501038_0206089 3300049574 Bacteria 1576
194 Ga0501043_0167982 3300049579 Bacteria 1712
195 Ga0501080_0041682 3300049742 Bacteria 4277
196 Ga0501035_0273472 3300049822 Bacteria 1429
197 Ga0501035_0397435 3300049822 Bacteria 1147
198 Ga0501044_0011134 3300049823 Bacteria 9755
199 nmdc:mga00v17_35_c1 3300050491 Bacteria 85646
200 nmdc:mga00v17_82120_c1 3300050491 Bacteria 2013
201 nmdc:mga0sz30_78976_c1 3300050516 Bacteria 1422
202 Ga0500651_0078991 3300053093 Bacteria 2040
203 Ga0500651_0095541 3300053093 Bacteria 1827
204 Ga0500554_000242 3300053102 Bacteria 11735
205 Ga0500556_0000331 3300053104 Bacteria 35528
206 Ga0500556_0005097 3300053104 Bacteria 3716
207 Ga0500594_0001926 3300053118 Bacteria 4495
208 Ga0500608_000032 3300053122 Bacteria 64445
209 Ga0500608_047207 3300053122 Bacteria 2069
210 Ga0500618_000081 3300053125 Bacteria 77777
211 Ga0500618_000123 3300053125 Bacteria 63600
212 Ga0500618_001399 3300053125 Bacteria 10838
213 Ga0500618_003208 3300053125 Bacteria 5711
214 Ga0500618_013298 3300053125 Bacteria 2131
215 Ga0500658_0005613 3300053134 Bacteria 4671
216 Ga0500559_0000148 3300053136 Bacteria 55272
217 Ga0500559_0002147 3300053136 Bacteria 10498
218 Ga0500568_0000412 3300053139 Bacteria 32747
219 Ga0500568_0008670 3300053139 Bacteria 4879
220 Ga0500568_0055163 3300053139 Bacteria 1552
221 Ga0500573_0003555 3300053140 Bacteria 8071
222 Ga0500616_0000308 3300053153 Bacteria 70261
223 Ga0500616_0000871 3300053153 Bacteria 33381
224 Ga0500622_0002912 3300053156 Bacteria 11921
225 Ga0500622_0049740 3300053156 Bacteria 2161
226 Ga0500636_0003943 3300053177 Bacteria 8369
227 Ga0500645_002118 3300053730 Bacteria 9149
228 Ga0500609_000271 3300053731 Bacteria 7552
229 Ga0501082_0244233 3300060353 Bacteria 1562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0000336 Ga0495610_0000336_24112_25233 321
2 3300053102 Ga0500554_000242 Ga0500554_000242_3587_4678 323
3 3300013102 Ga0157371_10042994 Ga0157371_100429942 328
4 3300013105 Ga0157369_10108531 Ga0157369_101085311 328
5 3300053122 Ga0500608_000032 Ga0500608_000032_37998_39074 328
6 3300003781 Ga0055536_1008809 Ga0055536_10088092 329
7 3300003781 Ga0055536_1010534 Ga0055536_10105344 329
8 3300025292 Ga0209676_1000038 Ga0209676_1000038445 329
9 3300025304 Ga0209257_1000060 Ga0209257_1000060165 329
10 3300048918 Ga0496115_0054745 Ga0496115_0054745_693_1811 330
11 3300053156 Ga0500622_0049740 Ga0500622_0049740_132_1217 332
12 3300002987 JGI25159J45721_1001392 JGI25159J45721_10013924 333
13 3300003215 JGI25153J46596_10001151 JGI25153J46596_1000115112 333
14 3300003374 JGI25161J50226_1000104 JGI25161J50226_100010430 333
15 3300003771 Ga0055526_1005324 Ga0055526_10053245 333
16 3300003771 Ga0055526_1011114 Ga0055526_10111141 333
17 3300003790 Ga0055528_1002375 Ga0055528_10023756 333
18 3300003792 Ga0055540_1001623 Ga0055540_10016233 333
19 3300004625 Ga0055543_1000166 Ga0055543_100016648 333
20 3300005262 Ga0065165_1009354 Ga0065165_10093544 333
21 3300025208 Ga0209436_100023 Ga0209436_10002352 333
22 3300025208 Ga0209436_100027 Ga0209436_10002766 333
23 3300025258 Ga0209129_1000952 Ga0209129_10009528 333
24 3300025284 Ga0209130_1000173 Ga0209130_100017348 333
25 3300025295 Ga0209564_1001125 Ga0209564_100112515 333
26 3300025297 Ga0209758_1000882 Ga0209758_100088215 333
27 3300025302 Ga0207426_1000047 Ga0207426_100004748 333
28 3300025303 Ga0209051_1029972 Ga0209051_10299723 333
29 3300041413 Ga0439465_0026179 Ga0439465_0026179_173_1273 333
30 3300046558 Ga0495633_0019584 Ga0495633_0019584_56_1192 333
31 3300053136 Ga0500559_0002147 Ga0500559_0002147_5343_6419 334
32 3300002773 JGI25152J39213_1004255 JGI25152J39213_10042556 335
33 3300003781 Ga0055536_1000533 Ga0055536_10005339 336
34 3300003791 Ga0055530_10008385 Ga0055530_100083854 336
35 3300003794 Ga0055531_10000667 Ga0055531_1000066716 336
36 3300025292 Ga0209676_1000151 Ga0209676_100015123 336
37 3300025298 Ga0209050_1001101 Ga0209050_100110119 336
38 3300025304 Ga0209257_1000413 Ga0209257_100041351 336
39 3300031901 Ga0307406_10018861 Ga0307406_100188615 336
40 3300048926 Ga0496123_0001682 Ga0496123_0001682_156_1331 336
41 3300003781 Ga0055536_1000731 Ga0055536_10007319 337
42 3300003791 Ga0055530_10002566 Ga0055530_100025669 337
43 3300025292 Ga0209676_1000128 Ga0209676_10001289 337
44 3300025298 Ga0209050_1000796 Ga0209050_100079632 337
45 3300025303 Ga0209051_1001225 Ga0209051_100122514 337
46 3300053093 Ga0500651_0078991 Ga0500651_0078991_74_1228 337
47 iso_pu_bacteria 8005301065 8005306842 337
48 3300053156 Ga0500622_0002912 Ga0500622_0002912_7489_8619 338
49 3300053136 Ga0500559_0000148 Ga0500559_0000148_24954_26045 339
50 3300047320 Ga0495672_0051201 Ga0495672_0051201_309_1400 340
51 3300048925 Ga0496122_0000042 Ga0496122_0000042_85853_86884 340
52 3300048925 Ga0496122_0007544 Ga0496122_0007544_8950_10125 340
53 3300048926 Ga0496123_0000030 Ga0496123_0000030_204876_205907 340
54 3300053730 Ga0500645_002118 Ga0500645_002118_7479_8570 340
55 iso_pu_bacteria 2643221614 2644086719 341
56 iso_pu_bacteria 2643221661 2644341673 341
57 iso_pu_bacteria 2643221666 2644367960 341
58 3300048919 Ga0496116_0013890 Ga0496116_0013890_5233_6363 343
59 3300048927 Ga0496124_0123688 Ga0496124_0123688_708_1793 343
60 3300048928 Ga0496125_0005479 Ga0496125_0005479_4849_5934 343
61 3300048928 Ga0496125_0007633 Ga0496125_0007633_7247_8377 343
62 3300048929 Ga0496126_0001375 Ga0496126_0001375_16472_17557 343
63 3300046616 Ga0495668_0000067 Ga0495668_0000067_134132_135214 345
64 3300048925 Ga0496122_0196100 Ga0496122_0196100_53_1138 345
65 3300025292 Ga0209676_1000644 Ga0209676_100064421 347
66 3300046460 Ga0495638_0004440 Ga0495638_0004440_3017_4138 347
67 3300046616 Ga0495668_0000037 Ga0495668_0000037_206286_207371 347
68 3300046616 Ga0495668_0036797 Ga0495668_0036797_473_1564 347
69 3300046660 Ga0495625_0001556 Ga0495625_0001556_15270_16361 347
70 3300046810 Ga0495660_0077664 Ga0495660_0077664_611_1705 347
71 3300047472 Ga0495686_0009740 Ga0495686_0009740_1566_2657 347
72 3300053122 Ga0500608_047207 Ga0500608_047207_352_1443 347
73 3300046471 Ga0495650_0000237 Ga0495650_0000237_85415_86506 348
74 3300046507 Ga0495606_0034655 Ga0495606_0034655_1125_2279 348
75 3300046660 Ga0495625_0067013 Ga0495625_0067013_1061_2152 348
76 3300047469 Ga0495673_0000115 Ga0495673_0000115_70646_71728 348
77 3300053104 Ga0500556_0005097 Ga0500556_0005097_2137_3228 348
78 3300025298 Ga0209050_1024401 Ga0209050_10244013 350
79 3300003775 Ga0055524_1009921 Ga0055524_10099212 351
80 3300005262 Ga0065165_1000955 Ga0065165_10009555 351
81 3300025273 Ga0209673_1011585 Ga0209673_10115853 351
82 3300025295 Ga0209564_1000909 Ga0209564_10009098 351
83 3300025299 Ga0209256_1000743 Ga0209256_100074316 351
84 3300046515 Ga0495620_0008009 Ga0495620_0008009_3375_4466 351
85 3300046616 Ga0495668_0050432 Ga0495668_0050432_877_1974 351
86 3300046694 Ga0495649_0000649 Ga0495649_0000649_6256_7401 351
87 3300047323 Ga0495683_0055683 Ga0495683_0055683_66_1163 351
88 3300053125 Ga0500618_000123 Ga0500618_000123_46175_47269 351
89 iso_pu_bacteria 2928972540 2928972897 351
90 iso_pu_bacteria 2977240413 2977242677 351
91 3300028794 Ga0307515_10013597 Ga0307515_100135971 352
92 3300042438 Ga0439459_0009218 Ga0439459_0009218_279_1385 352
93 3300046460 Ga0495638_0024753 Ga0495638_0024753_144_1241 352
94 3300046513 Ga0495616_0000109 Ga0495616_0000109_62822_63919 352
95 3300046519 Ga0495632_0000872 Ga0495632_0000872_9291_10388 352
96 3300046524 Ga0495648_0040020 Ga0495648_0040020_87_1184 352
97 3300046530 Ga0495654_0000206 Ga0495654_0000206_30775_31866 352
98 3300046538 Ga0495609_0102851 Ga0495609_0102851_56_1153 352
99 3300046810 Ga0495660_0001590 Ga0495660_0001590_3705_4811 352
100 3300053731 Ga0500609_000271 Ga0500609_000271_3809_4906 352
101 3300002987 JGI25159J45721_1000721 JGI25159J45721_10007211 353
102 3300004625 Ga0055543_1015407 Ga0055543_10154072 353
103 3300005262 Ga0065165_1000046 Ga0065165_100004680 353
104 3300025284 Ga0209130_1000201 Ga0209130_100020152 353
105 3300025294 Ga0209025_1000738 Ga0209025_100073823 353
106 3300031731 Ga0307405_10001612 Ga0307405_100016122 353
107 3300003794 Ga0055531_10000800 Ga0055531_1000080025 354
108 3300025292 Ga0209676_1007532 Ga0209676_10075322 354
109 3300025299 Ga0209256_1002502 Ga0209256_100250211 354
110 3300025304 Ga0209257_1000760 Ga0209257_100076022 354
111 3300031901 Ga0307406_10009241 Ga0307406_100092413 354
112 3300048919 Ga0496116_0001650 Ga0496116_0001650_9870_10991 354
113 3300048920 Ga0496117_0003659 Ga0496117_0003659_4837_5958 354
114 3300048921 Ga0496118_0002287 Ga0496118_0002287_11090_12211 354
115 3300048925 Ga0496122_0003833 Ga0496122_0003833_4659_5780 354
116 3300048926 Ga0496123_0054375 Ga0496123_0054375_372_1493 354
117 3300048927 Ga0496124_0002304 Ga0496124_0002304_12994_14115 354
118 3300048928 Ga0496125_0125763 Ga0496125_0125763_529_1650 354
119 iso_pu_bacteria 2849573788 2849575605 354
120 iso_pu_bacteria 2857504554 2857507558 354
121 3300003322 rootL2_10043244 rootL2_100432442 355
122 3300006946 Ga0079104_1000015 Ga0079104_1000015259 355
123 3300027111 Ga0209281_1000068 Ga0209281_1000068130 355
124 3300046506 Ga0495583_0000001 Ga0495583_0000001_786487_787590 356
125 iso_pu_bacteria 2643221552 2643781740 356
126 iso_pu_bacteria 2643221584 2643928352 356
127 iso_pu_bacteria 2849560528 2849565110 356
128 iso_pu_bacteria 2851153111 2851156004 356
129 iso_pu_bacteria 2898329390 2898331668 356
130 3300046460 Ga0495638_0001072 Ga0495638_0001072_13857_14948 357
131 3300046660 Ga0495625_0004062 Ga0495625_0004062_2200_3291 357
132 3300049822 Ga0501035_0273472 Ga0501035_0273472_34_1170 358
133 3300049822 Ga0501035_0397435 Ga0501035_0397435_28_1104 358
134 3300046522 Ga0495643_0024670 Ga0495643_0024670_1678_2775 359
135 iso_pu_bacteria 2513237084 2513573278 359
136 iso_pu_bacteria 2513237144 2513908351 359
137 iso_pu_bacteria 2513237146 2513926790 359
138 iso_pu_bacteria 2599185170 2599420717 359
139 iso_pu_bacteria 2838035591 2838040609 359
140 iso_pu_bacteria 2838661181 2838665003 359
141 iso_pu_bacteria 2933016740 2933017521 359
142 iso_pu_bacteria 2791355048 2792459884 360
143 iso_pu_bacteria 2843744320 2843744524 360
144 iso_pu_bacteria 8005688590 8005693460 360
145 3300046660 Ga0495625_0000284 Ga0495625_0000284_52790_53893 361
146 3300049573 Ga0501037_0031020 Ga0501037_0031020_1932_3068 361
147 3300049574 Ga0501038_0206089 Ga0501038_0206089_35_1171 361
148 iso_pu_bacteria 2582581280 2585154856 361
149 iso_pu_bacteria 2582581293 2585198627 361
150 iso_pu_bacteria 2599185156 2599331387 361
151 iso_pu_bacteria 2765235802 2765468822 361
152 iso_pu_bacteria 2842922631 2842923782 361
153 3300025297 Ga0209758_1003686 Ga0209758_100368611 362
154 3300053177 Ga0500636_0003943 Ga0500636_0003943_5602_6693 362
155 3300002774 JGI25150J39212_1001930 JGI25150J39212_10019303 363
156 3300003187 JGI25151J46595_10004290 JGI25151J46595_100042905 363
157 3300003215 JGI25153J46596_10013249 JGI25153J46596_100132493 363
158 3300003775 Ga0055524_1011176 Ga0055524_10111762 363
159 3300003790 Ga0055528_1000176 Ga0055528_100017624 363
160 3300005262 Ga0065165_1007467 Ga0065165_10074671 363
161 3300025245 Ga0207425_1004274 Ga0207425_10042742 363
162 3300025258 Ga0209129_1000242 Ga0209129_100024229 363
163 3300025258 Ga0209129_1001954 Ga0209129_10019544 363
164 3300025273 Ga0209673_1002378 Ga0209673_10023787 363
165 3300025284 Ga0209130_1006392 Ga0209130_10063923 363
166 3300025294 Ga0209025_1001249 Ga0209025_100124910 363
167 3300025294 Ga0209025_1005863 Ga0209025_10058638 363
168 3300025294 Ga0209025_1009297 Ga0209025_10092975 363
169 3300025295 Ga0209564_1005848 Ga0209564_10058481 363
170 3300025297 Ga0209758_1001059 Ga0209758_10010596 363
171 3300025299 Ga0209256_1002582 Ga0209256_100258212 363
172 3300025925 Ga0207650_10000377 Ga0207650_100003773 363
173 3300046524 Ga0495648_0049087 Ga0495648_0049087_1405_2505 363
174 3300046694 Ga0495649_0040369 Ga0495649_0040369_838_1938 363
175 3300048919 Ga0496116_0099391 Ga0496116_0099391_329_1429 363
176 3300048920 Ga0496117_0056917 Ga0496117_0056917_227_1327 363
177 3300048921 Ga0496118_0054040 Ga0496118_0054040_108_1208 363
178 3300048925 Ga0496122_0012921 Ga0496122_0012921_5273_6373 363
179 3300048926 Ga0496123_0013700 Ga0496123_0013700_1709_2809 363
180 3300048927 Ga0496124_0015473 Ga0496124_0015473_913_2013 363
181 3300048928 Ga0496125_0011767 Ga0496125_0011767_2669_3769 363
182 3300050516 nmdc:mga0sz30_78976_c1 nmdc:mga0sz30_78976_c1_248_1348 363
183 3300053093 Ga0500651_0095541 Ga0500651_0095541_624_1724 363
184 3300053134 Ga0500658_0005613 Ga0500658_0005613_1700_2800 363
185 3300053139 Ga0500568_0008670 Ga0500568_0008670_1895_2995 363
186 3300053139 Ga0500568_0055163 Ga0500568_0055163_244_1344 363
187 iso_pu_bacteria 2818991435 2819539326 363
188 iso_pu_bacteria 2818991454 2819647800 363
189 iso_pu_bacteria 2883577096 2883577953 363
190 3300046460 Ga0495638_0013388 Ga0495638_0013388_1690_2805 364
191 iso_pu_bacteria 2767802442 2770200244 364
192 iso_pu_bacteria 2837678835 2837682016 364
193 3300003322 rootL2_10043245 rootL2_100432453 365
194 iso_pu_bacteria 2851182111 2851187186 365
195 iso_pu_bacteria 2941485952 2941486791 365
196 iso_pu_bacteria 8057529695 8057535208 365
197 3300006186 Ga0075369_10027347 Ga0075369_100273472 367
198 3300048922 Ga0496119_0005800 Ga0496119_0005800_7134_8267 368
199 3300053104 Ga0500556_0000331 Ga0500556_0000331_5593_6726 368
200 iso_pu_bacteria 2818991461 2819685513 368
201 3300003771 Ga0055526_1000861 Ga0055526_100086117 369
202 3300003775 Ga0055524_1000071 Ga0055524_100007180 369
203 3300025291 Ga0209675_1000926 Ga0209675_10009269 369
204 3300025295 Ga0209564_1000034 Ga0209564_1000034344 369
205 3300025299 Ga0209256_1000026 Ga0209256_1000026332 369
206 iso_pu_bacteria 2585427594 2585842825 369
207 iso_pu_bacteria 2585427633 2585996995 369
208 iso_pu_bacteria 2585427634 2586001594 369
209 iso_pu_bacteria 2599185236 2599722460 369
210 iso_pu_bacteria 2600254933 2600373793 369
211 iso_pu_bacteria 2738541293 2738799670 369
212 iso_pu_bacteria 2821123053 2821126005 369
213 iso_pu_bacteria 2854896431 2854900394 369
214 iso_pu_bacteria 2854916844 2854917553 369
215 iso_pu_bacteria 2857531043 2857532567 369
216 iso_pu_bacteria 2919450847 2919452003 369
217 iso_pu_bacteria 8001845381 8001849911 369
218 3300053140 Ga0500573_0003555 Ga0500573_0003555_2951_4078 370
219 iso_pu_bacteria 2510917026 2511170917 371
220 3300005985 Ga0081539_10000923 Ga0081539_1000092340 372
221 3300025297 Ga0209758_1007405 Ga0209758_10074053 372
222 3300049579 Ga0501043_0167982 Ga0501043_0167982_368_1534 372
223 3300049742 Ga0501080_0041682 Ga0501080_0041682_1125_2291 372
224 3300049823 Ga0501044_0011134 Ga0501044_0011134_153_1319 372
225 3300053125 Ga0500618_013298 Ga0500618_013298_874_1992 372
226 3300060353 Ga0501082_0244233 Ga0501082_0244233_19_1185 372
227 3300002773 JGI25152J39213_1000248 JGI25152J39213_10002486 373
228 3300002774 JGI25150J39212_1000017 JGI25150J39212_100001784 373
229 3300003187 JGI25151J46595_10000007 JGI25151J46595_10000007317 373
230 3300003215 JGI25153J46596_10002745 JGI25153J46596_100027453 373
231 3300006038 Ga0075365_10015010 Ga0075365_100150104 373
232 3300006051 Ga0075364_10000512 Ga0075364_1000051221 373
233 3300006051 Ga0075364_10197027 Ga0075364_101970271 373
234 3300006353 Ga0075370_10046507 Ga0075370_100465073 373
235 3300013104 Ga0157370_10199019 Ga0157370_101990192 373
236 3300025245 Ga0207425_1000018 Ga0207425_100001820 373
237 3300025258 Ga0209129_1000026 Ga0209129_1000026309 373
238 3300025273 Ga0209673_1002764 Ga0209673_10027643 373
239 3300025294 Ga0209025_1000035 Ga0209025_1000035309 373
240 3300025297 Ga0209758_1000040 Ga0209758_1000040309 373
241 3300031911 Ga0307412_10005814 Ga0307412_100058145 373
242 3300046460 Ga0495638_0000683 Ga0495638_0000683_32649_33770 373
243 3300046512 Ga0495610_0000123 Ga0495610_0000123_33058_34182 373
244 3300046515 Ga0495620_0030090 Ga0495620_0030090_651_1775 373
245 3300046518 Ga0495631_0018970 Ga0495631_0018970_513_1634 373
246 3300046519 Ga0495632_0000688 Ga0495632_0000688_3904_5025 373
247 3300046522 Ga0495643_0074888 Ga0495643_0074888_189_1313 373
248 3300046530 Ga0495654_0000651 Ga0495654_0000651_23981_25102 373
249 3300046530 Ga0495654_0074086 Ga0495654_0074086_101_1222 373
250 3300046616 Ga0495668_0021724 Ga0495668_0021724_1165_2286 373
251 3300046810 Ga0495660_0023064 Ga0495660_0023064_243_1364 373
252 3300047320 Ga0495672_0040932 Ga0495672_0040932_287_1408 373
253 3300047323 Ga0495683_0114617 Ga0495683_0114617_136_1257 373
254 3300047469 Ga0495673_0094379 Ga0495673_0094379_66_1190 373
255 3300048904 Ga0496101_0082613 Ga0496101_0082613_1146_2267 373
256 3300048913 Ga0496110_0149987 Ga0496110_0149987_504_1697 373
257 3300048914 Ga0496111_0007271 Ga0496111_0007271_3091_4284 373
258 3300048919 Ga0496116_0004875 Ga0496116_0004875_3275_4396 373
259 3300048920 Ga0496117_0009944 Ga0496117_0009944_4063_5184 373
260 3300048921 Ga0496118_0011617 Ga0496118_0011617_4064_5185 373
261 3300048924 Ga0496121_0001095 Ga0496121_0001095_41007_42128 373
262 3300048924 Ga0496121_0006203 Ga0496121_0006203_10844_11965 373
263 3300048925 Ga0496122_0009471 Ga0496122_0009471_6874_8067 373
264 3300048925 Ga0496122_0097686 Ga0496122_0097686_222_1343 373
265 3300048926 Ga0496123_0029216 Ga0496123_0029216_2045_3238 373
266 3300048926 Ga0496123_0042800 Ga0496123_0042800_1409_2530 373
267 3300048927 Ga0496124_0029740 Ga0496124_0029740_2152_3273 373
268 3300048927 Ga0496124_0035685 Ga0496124_0035685_1248_2369 373
269 3300048928 Ga0496125_0178963 Ga0496125_0178963_272_1393 373
270 3300049459 Ga0495678_053175 Ga0495678_053175_216_1337 373
271 3300050491 nmdc:mga00v17_35_c1 nmdc:mga00v17_35_c1_77045_78166 373
272 3300050491 nmdc:mga00v17_82120_c1 nmdc:mga00v17_82120_c1_77_1270 373
273 3300053118 Ga0500594_0001926 Ga0500594_0001926_1836_2957 373
274 3300053125 Ga0500618_000081 Ga0500618_000081_2273_3466 373
275 3300053125 Ga0500618_001399 Ga0500618_001399_2332_3453 373
276 3300053125 Ga0500618_003208 Ga0500618_003208_1077_2198 373
277 3300053139 Ga0500568_0000412 Ga0500568_0000412_26570_27691 373
278 3300053153 Ga0500616_0000308 Ga0500616_0000308_65824_66945 373
279 3300053153 Ga0500616_0000871 Ga0500616_0000871_2825_3946 373
280 iso_pu_bacteria 2838736955 2838737518 373
281 iso_pu_bacteria 2841840854 2841842113 373
282 iso_pu_bacteria 2842140634 2842141892 373
283 iso_pu_bacteria 2929199973 2929205870 373
284 iso_pu_bacteria 8055909800 8055912385 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00924

MS_channel_2nd

Mechanosensitive ion channel, beta-domain

214

280

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ae1-assembly2.cif.gz_D ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 0.7493 258 336
5ae3-assembly1.cif.gz_D ether lipid-generating enzyme agps in complex with antimycin a 0.7431 258 336
5ae1-assembly1.cif.gz_A ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 0.7105 260 336
5ae3-assembly1.cif.gz_C ether lipid-generating enzyme agps in complex with antimycin a 0.7091 260 336
5ae3-assembly2.cif.gz_B ether lipid-generating enzyme agps in complex with antimycin a 0.7065 260 336
ID Description Score Start End Superfamily
af_A0A0R0ELK1_770_819_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9167 205 253 2.30.30.60
af_P0AAT4_202_252_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9086 206 254 2.30.30.60
af_P77338_945_994_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9071 205 254 2.30.30.60
af_Q54ZV3_691_741_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8927 205 253 2.30.30.60
af_P77338_945_994_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8908 205 254 2.30.30.60
ID Description Score Start End GO Terms
AF-A0A455U548-F1-model_v4 Cation efflux protein cytoplasmic domain-containing protein 0.9243 255 348
AF-A0A7X6VVX4-F1-model_v4 Mechanosensitive ion channel family protein 0.8521 248 350
AF-A0A4Q3R067-F1-model_v4 deleted 0.8508 17 200
AF-A0A4Q3R067-F1-model_v4 deleted 0.8068 17 200
AF-A0A4V2B584-F1-model_v4 deleted 0.804 17 160

Feature Viewer

pLDDT pTM Quality
80.03 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map