F383390

General Info

Members Datasets Scaffolds Average Seq Length
279 211 256 300

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2906610324|2906615729
Length 339
Sequence VSRLRALARRSGLGGCGLAGESALGPGQRGCRAMIMVRLNVYLALLFILVKLKIVPFNRFWKTSPAIVFVLLLIGLFVPMNWGAPQGPALVARHSVAIVPDVAGEVIEVDVQANQPLKAGDVLFKIDPVPFEAQVKAIEAQLKFQQLRFDQTMQLQSSGAGRSFDVEQLKAQLDGARWNLDKTVVRAPADGYVTNVALRKGLRVANLPLAPVMAFIDTSETIIGVEIDQISARYLAPGQDVELTFKMRPGTVQTGKVESILQAIATGQVQASGLAVAPKAVASAPFVVGVRLDDDAFARSLPAGSTGDAAIFTDYVKPANLIRKVILRQIAITNYVNPF

Samples

Sample ID Description Type Environment
1 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
2 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
3 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
4 2643221736 Bosea sp. Root483D1 Isolate Unclassified
5 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
6 2791355199
7 2818991467 Bosea vestrisii 3192 Isolate Unclassified
8 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
9 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
10 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
11 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
12 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
13 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
14 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
15 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
16 2844163670 Ensifer sp. 1H6 Isolate Unclassified
17 2851182111 Bosea sp. Tri-44 Isolate Nodule
18 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
19 2906610324
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
196 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
197 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
198 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
199 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
211 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0
Isolates 7.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.71
Nodule 3.23
Rhizoplane 2.51
Rhizosphere 63.08
Stem 0
Stem Tuber 0
Unclassified 11.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001601 3300002773 Bacteria 9493
2 JGI25150J39212_1000034 3300002774 Bacteria 90946
3 JGI25151J46595_10000056 3300003187 Bacteria 151555
4 JGI25151J46595_10000202 3300003187 Bacteria 73308
5 JGI25153J46596_10000340 3300003215 Bacteria 33344
6 JGI25153J46596_10002368 3300003215 Bacteria 10912
7 JGI25405J52794_10001191 3300003911 Bacteria 4208
8 Ga0070683_100029821 3300005329 Bacteria 4944
9 Ga0068869_100234979 3300005334 Bacteria 1458
10 Ga0070680_100024250 3300005336 Bacteria 4842
11 Ga0070682_100000950 3300005337 Bacteria 16846
12 Ga0070661_100061459 3300005344 Bacteria 2757
13 Ga0070661_100273806 3300005344 Bacteria 1308
14 Ga0070668_100381340 3300005347 Bacteria 1200
15 Ga0070709_10013059 3300005434 Bacteria 4662
16 Ga0070705_100022260 3300005440 Bacteria 3385
17 Ga0070694_100023860 3300005444 Bacteria 3941
18 Ga0070663_100011241 3300005455 Bacteria 5611
19 Ga0070663_100031727 3300005455 Bacteria 3634
20 Ga0070681_10007769 3300005458 Bacteria 10484
21 Ga0070679_100072365 3300005530 Bacteria 3439
22 Ga0070684_100011408 3300005535 Bacteria 7080
23 Ga0070684_100384415 3300005535 Bacteria 1293
24 Ga0068853_100029378 3300005539 Bacteria 4633
25 Ga0070695_100282879 3300005545 Bacteria 1219
26 Ga0070696_100003133 3300005546 Bacteria 11012
27 Ga0070693_100010900 3300005547 Bacteria 4566
28 Ga0070665_100011571 3300005548 Bacteria 8922
29 Ga0070665_100469329 3300005548 Bacteria 1269
30 Ga0070704_100287996 3300005549 Bacteria 1364
31 Ga0068855_100017082 3300005563 Bacteria 8729
32 Ga0068855_100041781 3300005563 Bacteria 5433
33 Ga0070664_100041020 3300005564 Bacteria 3904
34 Ga0070664_100176157 3300005564 Bacteria 1899
35 Ga0068857_100244395 3300005577 Bacteria 1644
36 Ga0068856_100088204 3300005614 Bacteria 3084
37 Ga0068856_100359572 3300005614 Bacteria 1474
38 Ga0070702_100026321 3300005615 Bacteria 3125
39 Ga0070702_100117242 3300005615 Bacteria 1661
40 Ga0068852_100008944 3300005616 Bacteria 7411
41 Ga0068851_10138401 3300005834 Bacteria 1322
42 Ga0068858_100673001 3300005842 Bacteria 1006
43 Ga0081455_10002765 3300005937 Bacteria 20709
44 Ga0081455_10015418 3300005937 Bacteria 7425
45 Ga0081455_10016837 3300005937 Bacteria 7031
46 Ga0081455_10021710 3300005937 Bacteria 6014
47 Ga0081455_10081348 3300005937 Bacteria 2652
48 Ga0081455_10225137 3300005937 Bacteria 1388
49 Ga0081540_1000438 3300005983 Bacteria 41157
50 Ga0081540_1000834 3300005983 Bacteria 28102
51 Ga0081540_1000860 3300005983 Bacteria 27489
52 Ga0081540_1002151 3300005983 Bacteria 16380
53 Ga0081540_1010623 3300005983 Bacteria 6215
54 Ga0075365_10002566 3300006038 Bacteria 8967
55 Ga0075365_10006317 3300006038 Bacteria 6507
56 Ga0075365_10135075 3300006038 Bacteria 1709
57 Ga0075363_100024071 3300006048 Bacteria 3092
58 Ga0075364_10055126 3300006051 Bacteria 2601
59 Ga0075362_10024015 3300006177 Bacteria 2583
60 Ga0075367_10013426 3300006178 Bacteria 4402
61 Ga0075367_10088475 3300006178 Bacteria 1882
62 Ga0075367_10162853 3300006178 Bacteria 1387
63 Ga0075369_10125249 3300006186 Bacteria 1165
64 Ga0075370_10010855 3300006353 Bacteria 4774
65 Ga0105245_10063696 3300009098 Bacteria 3330
66 Ga0105241_10166597 3300009174 Bacteria 1816
67 Ga0105241_10169038 3300009174 Unclassified 1804
68 Ga0105237_10078205 3300009545 Bacteria 3297
69 Ga0105238_10023939 3300009551 Bacteria 6225
70 Ga0105238_10046872 3300009551 Bacteria 4359
71 Ga0105238_10157858 3300009551 Bacteria 2244
72 Ga0105239_10101011 3300010375 Bacteria 3191
73 Ga0157369_10004890 3300013105 Bacteria 15715
74 Ga0157369_10051000 3300013105 Bacteria 4479
75 Ga0171463_1003 3300013249 Bacteria 695693
76 Ga0157372_10102866 3300013307 Bacteria 3263
77 Ga0157375_10170316 3300013308 Unclassified 2325
78 Ga0183363_1059 3300015690 Bacteria 33798
79 Ga0207425_1000010 3300025245 Bacteria 572898
80 Ga0209129_1000034 3300025258 Bacteria 330950
81 Ga0209025_1000016 3300025294 Bacteria 770739
82 Ga0209025_1000022 3300025294 Bacteria 574487
83 Ga0209025_1022439 3300025294 Bacteria 3346
84 Ga0209758_1000080 3300025297 Bacteria 261472
85 Ga0209758_1004342 3300025297 Bacteria 11877
86 Ga0209256_1000102 3300025299 Bacteria 199097
87 Ga0209256_1000176 3300025299 Bacteria 126545
88 Ga0207647_10077939 3300025904 Bacteria 1991
89 Ga0207707_10087567 3300025912 Bacteria 2721
90 Ga0207707_10288323 3300025912 Bacteria 1420
91 Ga0207671_10112851 3300025914 Bacteria 2070
92 Ga0207657_10043413 3300025919 Bacteria 3960
93 Ga0207694_10063082 3300025924 Bacteria 2886
94 Ga0207687_10062192 3300025927 Bacteria 2639
95 Ga0207669_10356687 3300025937 Bacteria 1132
96 Ga0207689_10252367 3300025942 Bacteria 1459
97 Ga0207689_10460469 3300025942 Bacteria 1063
98 Ga0207679_10160773 3300025945 Bacteria 1839
99 Ga0207667_10285566 3300025949 Bacteria 1686
100 Ga0207668_10045606 3300025972 Bacteria 2991
101 Ga0207640_10272247 3300025981 Bacteria 1325
102 Ga0207640_10284676 3300025981 Bacteria 1300
103 Ga0207639_10091757 3300026041 Bacteria 2433
104 Ga0207678_10000157 3300026067 Bacteria 56289
105 Ga0207678_10046189 3300026067 Bacteria 3766
106 Ga0207678_10057323 3300026067 Bacteria 3352
107 Ga0207702_10073283 3300026078 Bacteria 2952
108 Ga0207674_10181761 3300026116 Bacteria 2054
109 Ga0207698_10022086 3300026142 Bacteria 4414
110 Ga0268266_10018977 3300028379 Bacteria 5858
111 Ga0268266_10112926 3300028379 Bacteria 2409
112 Ga0265339_10001606 3300031249 Bacteria 16730
113 Ga0307513_10105925 3300031456 Bacteria 2819
114 Ga0307412_10265334 3300031911 Bacteria 1341
115 Ga0307416_100091922 3300032002 Bacteria 2608
116 Ga0373934_0095710 3300035086 Bacteria 1199
117 Ga0373923_0003954 3300035111 Bacteria 4841
118 Ga0373943_0058894 3300035170 Bacteria 1913
119 Ga0373946_0017731 3300035171 Bacteria 2727
120 Ga0373924_0021389 3300035410 Bacteria 2522
121 Ga0373924_0022170 3300035410 Bacteria 2482
122 Ga0373935_0039187 3300035692 Bacteria 2970
123 Ga0373927_0022118 3300035695 Bacteria 4166
124 Ga0373933_0035866 3300035724 Bacteria 2900
125 Ga0373947_0008313 3300035725 Bacteria 5978
126 Ga0373937_0080616 3300036401 Bacteria 3010
127 Ga0373925_0007949 3300037068 Bacteria 7723
128 Ga0395899_0055951 3300037312 Bacteria 2917
129 Ga0395900_0006892 3300037418 Bacteria 11790
130 Ga0395901_0008864 3300038443 Bacteria 10185
131 Ga0495592_0023961 3300046454 Bacteria 4642
132 Ga0495592_0085290 3300046454 Bacteria 2277
133 Ga0495603_0158670 3300046455 Bacteria 1312
134 Ga0495629_0039402 3300046459 Bacteria 3326
135 Ga0495629_0041342 3300046459 Bacteria 3244
136 Ga0495638_0001644 3300046460 Bacteria 19838
137 Ga0495651_0003588 3300046462 Bacteria 11903
138 Ga0495639_0040298 3300046475 Bacteria 2101
139 Ga0495662_0030825 3300046476 Bacteria 2589
140 Ga0495664_0012504 3300046477 Bacteria 4808
141 Ga0495664_0143888 3300046477 Bacteria 1445
142 Ga0495608_0019434 3300046511 Bacteria 4675
143 Ga0495618_0129998 3300046514 Bacteria 1611
144 Ga0495620_0089310 3300046515 Bacteria 1238
145 Ga0495628_0009768 3300046516 Bacteria 8178
146 Ga0495631_0123989 3300046518 Bacteria 1111
147 Ga0495632_0082878 3300046519 Bacteria 1528
148 Ga0495652_0005812 3300046529 Bacteria 11550
149 Ga0495640_0036489 3300046533 Bacteria 3473
150 Ga0495587_0006565 3300046536 Bacteria 7574
151 Ga0495645_0028962 3300046543 Bacteria 4025
152 Ga0495645_0079316 3300046543 Bacteria 2358
153 Ga0495667_0005708 3300046559 Bacteria 8424
154 Ga0495634_0019245 3300046642 Bacteria 4852
155 Ga0495635_0075487 3300046663 Bacteria 2309
156 Ga0495661_0027351 3300046665 Bacteria 3663
157 Ga0495599_0028210 3300046678 Bacteria 3518
158 Ga0495599_0205825 3300046678 Bacteria 1208
159 Ga0495623_0011888 3300046679 Bacteria 5641
160 Ga0495646_0009638 3300046680 Bacteria 6132
161 Ga0495658_0283589 3300046683 Bacteria 1045
162 Ga0495624_0030319 3300046690 Bacteria 3524
163 Ga0495670_0080420 3300046691 Bacteria 1660
164 Ga0495600_0036783 3300046809 Bacteria 3181
165 Ga0495604_0005487 3300047317 Bacteria 10056
166 Ga0495674_0011383 3300047319 Bacteria 8397
167 Ga0495674_0059786 3300047319 Bacteria 3327
168 Ga0495672_0019817 3300047320 Bacteria 4426
169 Ga0495680_0005531 3300047322 Bacteria 11860
170 Ga0495675_0003412 3300047444 Bacteria 9573
171 Ga0495673_0086442 3300047469 Bacteria 1289
172 Ga0495684_0183958 3300047471 Bacteria 1548
173 Ga0495686_0067905 3300047472 Bacteria 2200
174 Ga0495686_0123802 3300047472 Bacteria 1538
175 Ga0495593_0065955 3300047673 Bacteria 1887
176 Ga0495602_0010182 3300048088 Bacteria 9761
177 Ga0496101_0053229 3300048904 Bacteria 2919
178 Ga0496102_0451489 3300048905 Bacteria 1206
179 Ga0496103_0000898 3300048906 Bacteria 21446
180 Ga0496104_0068473 3300048907 Bacteria 3373
181 Ga0496106_0002217 3300048909 Bacteria 14492
182 Ga0496107_0029873 3300048910 Bacteria 3881
183 Ga0496115_0028863 3300048918 Bacteria 4351
184 Ga0496119_0175251 3300048922 Bacteria 1129
185 Ga0496121_0000594 3300048924 Bacteria 67953
186 Ga0496121_0012617 3300048924 Bacteria 9180
187 Ga0496121_0017181 3300048924 Bacteria 7409
188 Ga0496121_0070473 3300048924 Bacteria 2816
189 Ga0496121_0115679 3300048924 Bacteria 2036
190 Ga0496122_0011832 3300048925 Bacteria 8772
191 Ga0496122_0159922 3300048925 Unclassified 1375
192 Ga0496123_0002967 3300048926 Bacteria 19753
193 Ga0496123_0079519 3300048926 Bacteria 2003
194 Ga0496124_0015302 3300048927 Bacteria 7363
195 Ga0496125_0013564 3300048928 Bacteria 8004
196 Ga0496126_0008961 3300048929 Bacteria 10710
197 Ga0496126_0014582 3300048929 Bacteria 7939
198 Ga0496126_0154891 3300048929 Bacteria 1962
199 Ga0496126_0236319 3300048929 Bacteria 1529
200 Ga0496126_0262678 3300048929 Bacteria 1435
201 Ga0501031_0027207 3300049568 Bacteria 3729
202 Ga0501032_0015921 3300049569 Bacteria 5297
203 Ga0501033_0057320 3300049570 Bacteria 2879
204 Ga0501034_0089018 3300049571 Bacteria 3085
205 Ga0501036_0017373 3300049572 Bacteria 6014
206 Ga0501037_0001832 3300049573 Bacteria 15431
207 Ga0501038_0063616 3300049574 Bacteria 3148
208 Ga0501039_0023288 3300049575 Bacteria 4754
209 Ga0501046_0010850 3300049580 Bacteria 7809
210 Ga0501048_0056497 3300049582 Bacteria 2784
211 Ga0501067_0041182 3300049583 Bacteria 2565
212 Ga0501067_0075870 3300049583 Bacteria 1862
213 Ga0501069_0007557 3300049585 Bacteria 5703
214 Ga0501069_0143574 3300049585 Bacteria 1370
215 Ga0501070_0013556 3300049586 Bacteria 6871
216 Ga0501071_0051744 3300049587 Bacteria 2961
217 Ga0501073_0030767 3300049589 Bacteria 3832
218 Ga0501074_0096336 3300049590 Bacteria 2118
219 Ga0501080_0014111 3300049742 Bacteria 7354
220 Ga0501080_0151320 3300049742 Bacteria 2144
221 Ga0501035_0076435 3300049822 Bacteria 2961
222 Ga0501044_0035625 3300049823 Bacteria 5210
223 Ga0501045_0207833 3300049824 Bacteria 1458
224 nmdc:mga03n38_16750_c1 3300050490 Bacteria 2858
225 nmdc:mga00v17_27876_c1 3300050491 Bacteria 3301
226 nmdc:mga0yw44_1874_c1 3300050492 Bacteria 8651
227 nmdc:mga0yw44_33243_c1 3300050492 Bacteria 3012
228 nmdc:mga0yw44_81620_c1 3300050492 Bacteria 2027
229 nmdc:mga06z11_30480_c1 3300050494 Bacteria 2610
230 nmdc:mga06z11_40864_c1 3300050494 Bacteria 2317
231 nmdc:mga07m45_215326_c1 3300050496 Bacteria 1117
232 nmdc:mga07m45_40863_c1 3300050496 Bacteria 2596
233 Ga0495612_0015932 3300053078 Bacteria 3012
234 Ga0500635_0118813 3300053080 Bacteria 988
235 Ga0495619_0231481 3300053085 Bacteria 1280
236 Ga0500643_000707 3300053087 Bacteria 22129
237 Ga0500644_0004606 3300053088 Bacteria 3457
238 Ga0500646_0033069 3300053090 Bacteria 1429
239 Ga0500583_0036060 3300053092 Bacteria 2212
240 Ga0500562_001107 3300053108 Bacteria 6624
241 Ga0500562_001780 3300053108 Bacteria 5384
242 Ga0500592_005709 3300053116 Bacteria 1980
243 Ga0500595_000662 3300053119 Bacteria 20656
244 Ga0500595_004598 3300053119 Bacteria 6156
245 Ga0500658_0026987 3300053134 Bacteria 2217
246 Ga0500559_0034451 3300053136 Bacteria 2184
247 Ga0500568_0092984 3300053139 Bacteria 1136
248 Ga0500577_0000021 3300053142 Bacteria 43315
249 Ga0500616_0011874 3300053153 Bacteria 5120
250 Ga0500616_0047738 3300053153 Bacteria 2272
251 Ga0500639_186628 3300053163 Bacteria 909
252 Ga0500636_0000189 3300053177 Bacteria 33076
253 Ga0500636_0001042 3300053177 Bacteria 14859
254 Ga0500599_000207 3300053736 Bacteria 5486
255 Ga0501084_0152483 3300054114 Bacteria 1948
256 Ga0501082_0000027 3300060353 Bacteria 100915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100234979 Ga0068869_1002349792 215
2 3300025942 Ga0207689_10252367 Ga0207689_102523672 215
3 3300053163 Ga0500639_186628 Ga0500639_186628_138_893 228
4 3300047471 Ga0495684_0183958 Ga0495684_0183958_744_1538 231
5 3300006038 Ga0075365_10006317 Ga0075365_100063176 239
6 3300050492 nmdc:mga0yw44_1874_c1 nmdc:mga0yw44_1874_c1_2825_3766 239
7 3300053080 Ga0500635_0118813 Ga0500635_0118813_11_799 239
8 3300005842 Ga0068858_100673001 Ga0068858_1006730011 256
9 3300009551 Ga0105238_10157858 Ga0105238_101578583 256
10 3300053116 Ga0500592_005709 Ga0500592_005709_247_1188 259
11 3300005548 Ga0070665_100011571 Ga0070665_1000115713 263
12 3300028379 Ga0268266_10018977 Ga0268266_100189773 263
13 3300053136 Ga0500559_0034451 Ga0500559_0034451_1212_2075 264
14 3300048924 Ga0496121_0017181 Ga0496121_0017181_2057_2998 266
15 3300049568 Ga0501031_0027207 Ga0501031_0027207_2497_3438 268
16 3300049569 Ga0501032_0015921 Ga0501032_0015921_3758_4699 268
17 3300049570 Ga0501033_0057320 Ga0501033_0057320_272_1213 268
18 3300049572 Ga0501036_0017373 Ga0501036_0017373_674_1615 268
19 3300049573 Ga0501037_0001832 Ga0501037_0001832_7245_8186 268
20 3300049574 Ga0501038_0063616 Ga0501038_0063616_855_1796 268
21 3300049575 Ga0501039_0023288 Ga0501039_0023288_3677_4618 268
22 3300049580 Ga0501046_0010850 Ga0501046_0010850_2132_3073 268
23 3300049582 Ga0501048_0056497 Ga0501048_0056497_431_1372 268
24 3300049583 Ga0501067_0075870 Ga0501067_0075870_834_1775 268
25 3300049585 Ga0501069_0007557 Ga0501069_0007557_4202_5143 268
26 3300049587 Ga0501071_0051744 Ga0501071_0051744_363_1304 268
27 3300049589 Ga0501073_0030767 Ga0501073_0030767_1667_2608 268
28 3300049590 Ga0501074_0096336 Ga0501074_0096336_600_1541 268
29 3300049742 Ga0501080_0014111 Ga0501080_0014111_1620_2561 268
30 3300049822 Ga0501035_0076435 Ga0501035_0076435_1621_2562 268
31 3300049823 Ga0501044_0035625 Ga0501044_0035625_3691_4632 268
32 3300049824 Ga0501045_0207833 Ga0501045_0207833_169_1110 268
33 3300054114 Ga0501084_0152483 Ga0501084_0152483_609_1550 268
34 3300025299 Ga0209256_1000176 Ga0209256_100017642 270
35 3300006038 Ga0075365_10002566 Ga0075365_100025664 271
36 3300006051 Ga0075364_10055126 Ga0075364_100551262 271
37 3300006177 Ga0075362_10024015 Ga0075362_100240153 271
38 3300006178 Ga0075367_10088475 Ga0075367_100884751 271
39 3300050491 nmdc:mga00v17_27876_c1 nmdc:mga00v17_27876_c1_271_1212 271
40 3300050492 nmdc:mga0yw44_33243_c1 nmdc:mga0yw44_33243_c1_666_1607 271
41 3300050494 nmdc:mga06z11_30480_c1 nmdc:mga06z11_30480_c1_890_1831 271
42 3300060353 Ga0501082_0000027 Ga0501082_0000027_57513_58454 271
43 3300013249 Ga0171463_1003 Ga0171463_1003385 272
44 3300015690 Ga0183363_1059 Ga0183363_105912 272
45 3300005336 Ga0070680_100024250 Ga0070680_1000242503 273
46 3300005337 Ga0070682_100000950 Ga0070682_10000095016 273
47 3300005344 Ga0070661_100061459 Ga0070661_1000614591 273
48 3300005440 Ga0070705_100022260 Ga0070705_1000222601 273
49 3300005444 Ga0070694_100023860 Ga0070694_1000238603 273
50 3300005455 Ga0070663_100031727 Ga0070663_1000317273 273
51 3300005458 Ga0070681_10007769 Ga0070681_100077695 273
52 3300005530 Ga0070679_100072365 Ga0070679_1000723653 273
53 3300005535 Ga0070684_100384415 Ga0070684_1003844152 273
54 3300005545 Ga0070695_100282879 Ga0070695_1002828791 273
55 3300005546 Ga0070696_100003133 Ga0070696_1000031338 273
56 3300005547 Ga0070693_100010900 Ga0070693_1000109006 273
57 3300005549 Ga0070704_100287996 Ga0070704_1002879961 273
58 3300005563 Ga0068855_100017082 Ga0068855_1000170827 273
59 3300005564 Ga0070664_100176157 Ga0070664_1001761571 273
60 3300005614 Ga0068856_100088204 Ga0068856_1000882042 273
61 3300005615 Ga0070702_100117242 Ga0070702_1001172422 273
62 3300009098 Ga0105245_10063696 Ga0105245_100636963 273
63 3300009174 Ga0105241_10169038 Ga0105241_101690383 273
64 3300009545 Ga0105237_10078205 Ga0105237_100782054 273
65 3300009551 Ga0105238_10023939 Ga0105238_100239395 273
66 3300013308 Ga0157375_10170316 Ga0157375_101703163 273
67 3300025299 Ga0209256_1000102 Ga0209256_1000102177 273
68 3300025904 Ga0207647_10077939 Ga0207647_100779392 273
69 3300025912 Ga0207707_10087567 Ga0207707_100875673 273
70 3300025914 Ga0207671_10112851 Ga0207671_101128511 273
71 3300025919 Ga0207657_10043413 Ga0207657_100434133 273
72 3300025924 Ga0207694_10063082 Ga0207694_100630822 273
73 3300025927 Ga0207687_10062192 Ga0207687_100621923 273
74 3300025981 Ga0207640_10284676 Ga0207640_102846762 273
75 3300026067 Ga0207678_10000157 Ga0207678_1000015712 273
76 3300048904 Ga0496101_0053229 Ga0496101_0053229_1235_2176 273
77 3300048906 Ga0496103_0000898 Ga0496103_0000898_11404_12345 273
78 3300048907 Ga0496104_0068473 Ga0496104_0068473_1768_2709 273
79 3300048909 Ga0496106_0002217 Ga0496106_0002217_12679_13620 273
80 3300048910 Ga0496107_0029873 Ga0496107_0029873_2032_2973 273
81 3300048918 Ga0496115_0028863 Ga0496115_0028863_37_978 273
82 iso_pu_bacteria 2844163670 2844166689 275
83 3300053177 Ga0500636_0001042 Ga0500636_0001042_13707_14714 278
84 iso_pu_bacteria 8016511872 8016513620 278
85 3300047472 Ga0495686_0067905 Ga0495686_0067905_766_1707 279
86 3300005329 Ga0070683_100029821 Ga0070683_1000298213 283
87 3300005344 Ga0070661_100273806 Ga0070661_1002738061 283
88 3300005535 Ga0070684_100011408 Ga0070684_1000114083 283
89 3300005539 Ga0068853_100029378 Ga0068853_1000293784 283
90 3300005563 Ga0068855_100041781 Ga0068855_1000417813 283
91 3300005564 Ga0070664_100041020 Ga0070664_1000410203 283
92 3300005577 Ga0068857_100244395 Ga0068857_1002443953 283
93 3300005614 Ga0068856_100359572 Ga0068856_1003595723 283
94 3300005616 Ga0068852_100008944 Ga0068852_1000089443 283
95 3300009174 Ga0105241_10166597 Ga0105241_101665971 283
96 3300009551 Ga0105238_10046872 Ga0105238_100468723 283
97 3300010375 Ga0105239_10101011 Ga0105239_101010113 283
98 3300013105 Ga0157369_10051000 Ga0157369_100510003 283
99 3300013307 Ga0157372_10102866 Ga0157372_101028663 283
100 3300025945 Ga0207679_10160773 Ga0207679_101607731 283
101 3300025949 Ga0207667_10285566 Ga0207667_102855661 283
102 3300025981 Ga0207640_10272247 Ga0207640_102722471 283
103 3300026041 Ga0207639_10091757 Ga0207639_100917572 283
104 3300026078 Ga0207702_10073283 Ga0207702_100732833 283
105 3300026116 Ga0207674_10181761 Ga0207674_101817611 283
106 3300026142 Ga0207698_10022086 Ga0207698_100220863 283
107 iso_pu_bacteria 2851182111 2851184677 283
108 3300046454 Ga0495592_0023961 Ga0495592_0023961_1763_2722 286
109 3300046462 Ga0495651_0003588 Ga0495651_0003588_4123_5082 286
110 3300046477 Ga0495664_0012504 Ga0495664_0012504_2384_3343 286
111 3300046511 Ga0495608_0019434 Ga0495608_0019434_1387_2346 286
112 3300046516 Ga0495628_0009768 Ga0495628_0009768_5065_6024 286
113 3300046529 Ga0495652_0005812 Ga0495652_0005812_7903_8862 286
114 3300046536 Ga0495587_0006565 Ga0495587_0006565_2523_3482 286
115 3300046543 Ga0495645_0028962 Ga0495645_0028962_2446_3405 286
116 3300046559 Ga0495667_0005708 Ga0495667_0005708_2523_3482 286
117 3300046663 Ga0495635_0075487 Ga0495635_0075487_1207_2166 286
118 3300046679 Ga0495623_0011888 Ga0495623_0011888_2627_3586 286
119 3300046680 Ga0495646_0009638 Ga0495646_0009638_3022_3981 286
120 3300046809 Ga0495600_0036783 Ga0495600_0036783_277_1236 286
121 3300047317 Ga0495604_0005487 Ga0495604_0005487_6635_7594 286
122 3300047319 Ga0495674_0011383 Ga0495674_0011383_2570_3529 286
123 3300047322 Ga0495680_0005531 Ga0495680_0005531_8306_9265 286
124 3300047444 Ga0495675_0003412 Ga0495675_0003412_1730_2689 286
125 3300048088 Ga0495602_0010182 Ga0495602_0010182_2364_3323 286
126 iso_pu_bacteria 2513237102 2513701895 286
127 iso_pu_bacteria 2513237144 2513911744 286
128 iso_pu_bacteria 2517093001 2517108225 286
129 iso_pu_bacteria 2643221736 2644744059 286
130 iso_pu_bacteria 2791355196 2793065249 286
131 iso_pu_bacteria 2791355199 2793076781 286
132 iso_pu_bacteria 2818991467 2819718528 286
133 iso_pu_bacteria 2824617872 2824626126 286
134 iso_pu_bacteria 2824626560 2824634838 286
135 iso_pu_bacteria 2824635225 2824643162 286
136 iso_pu_bacteria 2824644064 2824651339 286
137 iso_pu_bacteria 2824714736 2824721426 286
138 iso_pu_bacteria 2824723954 2824731353 286
139 iso_pu_bacteria 2841911363 2841916635 286
140 iso_pu_bacteria 2841917233 2841922532 286
141 iso_pu_bacteria 2857524615 2857529647 286
142 iso_pu_bacteria 2857524615 2857530417 286
143 iso_pu_bacteria 2906610324 2906616475 286
144 iso_pu_bacteria 8056967851 8056969370 286
145 3300048924 Ga0496121_0070473 Ga0496121_0070473_1481_2413 287
146 3300049571 Ga0501034_0089018 Ga0501034_0089018_1874_2815 287
147 3300049742 Ga0501080_0151320 Ga0501080_0151320_536_1477 287
148 3300005834 Ga0068851_10138401 Ga0068851_101384011 288
149 3300037312 Ga0395899_0055951 Ga0395899_0055951_1253_2194 288
150 3300037418 Ga0395900_0006892 Ga0395900_0006892_2156_3097 288
151 3300038443 Ga0395901_0008864 Ga0395901_0008864_8622_9563 288
152 3300046690 Ga0495624_0030319 Ga0495624_0030319_1622_2560 289
153 3300048929 Ga0496126_0014582 Ga0496126_0014582_1086_2024 289
154 3300053142 Ga0500577_0000021 Ga0500577_0000021_3718_4656 289
155 3300053177 Ga0500636_0000189 Ga0500636_0000189_21801_22739 289
156 3300002773 JGI25152J39213_1001601 JGI25152J39213_10016013 290
157 3300002774 JGI25150J39212_1000034 JGI25150J39212_100003426 290
158 3300003187 JGI25151J46595_10000056 JGI25151J46595_1000005642 290
159 3300003187 JGI25151J46595_10000202 JGI25151J46595_1000020226 290
160 3300003215 JGI25153J46596_10000340 JGI25153J46596_100003405 290
161 3300003215 JGI25153J46596_10002368 JGI25153J46596_100023685 290
162 3300003911 JGI25405J52794_10001191 JGI25405J52794_100011914 290
163 3300005347 Ga0070668_100381340 Ga0070668_1003813402 290
164 3300005434 Ga0070709_10013059 Ga0070709_100130591 290
165 3300005455 Ga0070663_100011241 Ga0070663_1000112412 290
166 3300005548 Ga0070665_100469329 Ga0070665_1004693292 290
167 3300005615 Ga0070702_100026321 Ga0070702_1000263212 290
168 3300005937 Ga0081455_10002765 Ga0081455_100027653 290
169 3300005937 Ga0081455_10015418 Ga0081455_100154186 290
170 3300005937 Ga0081455_10016837 Ga0081455_100168373 290
171 3300005937 Ga0081455_10021710 Ga0081455_100217106 290
172 3300005937 Ga0081455_10081348 Ga0081455_100813483 290
173 3300005937 Ga0081455_10225137 Ga0081455_102251373 290
174 3300005983 Ga0081540_1000438 Ga0081540_100043819 290
175 3300005983 Ga0081540_1000834 Ga0081540_10008344 290
176 3300005983 Ga0081540_1000860 Ga0081540_100086027 290
177 3300005983 Ga0081540_1002151 Ga0081540_10021514 290
178 3300005983 Ga0081540_1010623 Ga0081540_10106234 290
179 3300006038 Ga0075365_10135075 Ga0075365_101350753 290
180 3300006048 Ga0075363_100024071 Ga0075363_1000240712 290
181 3300006178 Ga0075367_10013426 Ga0075367_100134263 290
182 3300006178 Ga0075367_10162853 Ga0075367_101628532 290
183 3300006186 Ga0075369_10125249 Ga0075369_101252492 290
184 3300006353 Ga0075370_10010855 Ga0075370_100108556 290
185 3300013105 Ga0157369_10004890 Ga0157369_100048904 290
186 3300025245 Ga0207425_1000010 Ga0207425_1000010168 290
187 3300025258 Ga0209129_1000034 Ga0209129_1000034174 290
188 3300025294 Ga0209025_1000016 Ga0209025_1000016261 290
189 3300025294 Ga0209025_1000022 Ga0209025_1000022414 290
190 3300025294 Ga0209025_1022439 Ga0209025_10224393 290
191 3300025297 Ga0209758_1000080 Ga0209758_1000080105 290
192 3300025297 Ga0209758_1004342 Ga0209758_10043427 290
193 3300025912 Ga0207707_10288323 Ga0207707_102883232 290
194 3300025937 Ga0207669_10356687 Ga0207669_103566871 290
195 3300025942 Ga0207689_10460469 Ga0207689_104604692 290
196 3300025972 Ga0207668_10045606 Ga0207668_100456062 290
197 3300026067 Ga0207678_10046189 Ga0207678_100461893 290
198 3300026067 Ga0207678_10057323 Ga0207678_100573232 290
199 3300028379 Ga0268266_10112926 Ga0268266_101129262 290
200 3300031249 Ga0265339_10001606 Ga0265339_100016069 290
201 3300031456 Ga0307513_10105925 Ga0307513_101059252 290
202 3300031911 Ga0307412_10265334 Ga0307412_102653342 290
203 3300032002 Ga0307416_100091922 Ga0307416_1000919223 290
204 3300035086 Ga0373934_0095710 Ga0373934_0095710_17_958 290
205 3300035111 Ga0373923_0003954 Ga0373923_0003954_3844_4785 290
206 3300035170 Ga0373943_0058894 Ga0373943_0058894_408_1349 290
207 3300035171 Ga0373946_0017731 Ga0373946_0017731_57_998 290
208 3300035410 Ga0373924_0021389 Ga0373924_0021389_82_1023 290
209 3300035410 Ga0373924_0022170 Ga0373924_0022170_145_1086 290
210 3300035692 Ga0373935_0039187 Ga0373935_0039187_1663_2604 290
211 3300035695 Ga0373927_0022118 Ga0373927_0022118_2964_3905 290
212 3300035724 Ga0373933_0035866 Ga0373933_0035866_971_1912 290
213 3300035725 Ga0373947_0008313 Ga0373947_0008313_3421_4362 290
214 3300036401 Ga0373937_0080616 Ga0373937_0080616_543_1484 290
215 3300037068 Ga0373925_0007949 Ga0373925_0007949_4994_5935 290
216 3300046454 Ga0495592_0085290 Ga0495592_0085290_155_1096 290
217 3300046455 Ga0495603_0158670 Ga0495603_0158670_201_1142 290
218 3300046459 Ga0495629_0039402 Ga0495629_0039402_1246_2187 290
219 3300046459 Ga0495629_0041342 Ga0495629_0041342_220_1161 290
220 3300046460 Ga0495638_0001644 Ga0495638_0001644_7270_8211 290
221 3300046475 Ga0495639_0040298 Ga0495639_0040298_1132_2073 290
222 3300046476 Ga0495662_0030825 Ga0495662_0030825_131_1072 290
223 3300046477 Ga0495664_0143888 Ga0495664_0143888_374_1315 290
224 3300046514 Ga0495618_0129998 Ga0495618_0129998_649_1590 290
225 3300046515 Ga0495620_0089310 Ga0495620_0089310_280_1221 290
226 3300046518 Ga0495631_0123989 Ga0495631_0123989_88_1029 290
227 3300046519 Ga0495632_0082878 Ga0495632_0082878_75_1016 290
228 3300046533 Ga0495640_0036489 Ga0495640_0036489_193_1134 290
229 3300046543 Ga0495645_0079316 Ga0495645_0079316_524_1465 290
230 3300046642 Ga0495634_0019245 Ga0495634_0019245_3878_4819 290
231 3300046665 Ga0495661_0027351 Ga0495661_0027351_1268_2209 290
232 3300046678 Ga0495599_0028210 Ga0495599_0028210_2371_3312 290
233 3300046678 Ga0495599_0205825 Ga0495599_0205825_151_1092 290
234 3300046683 Ga0495658_0283589 Ga0495658_0283589_91_1032 290
235 3300046691 Ga0495670_0080420 Ga0495670_0080420_173_1114 290
236 3300047319 Ga0495674_0059786 Ga0495674_0059786_80_1021 290
237 3300047320 Ga0495672_0019817 Ga0495672_0019817_983_1924 290
238 3300047469 Ga0495673_0086442 Ga0495673_0086442_279_1220 290
239 3300047472 Ga0495686_0123802 Ga0495686_0123802_112_1053 290
240 3300047673 Ga0495593_0065955 Ga0495593_0065955_933_1874 290
241 3300048905 Ga0496102_0451489 Ga0496102_0451489_235_1176 290
242 3300048922 Ga0496119_0175251 Ga0496119_0175251_131_1072 290
243 3300048924 Ga0496121_0000594 Ga0496121_0000594_35280_36221 290
244 3300048924 Ga0496121_0012617 Ga0496121_0012617_7694_8635 290
245 3300048924 Ga0496121_0115679 Ga0496121_0115679_778_1719 290
246 3300048925 Ga0496122_0011832 Ga0496122_0011832_1436_2377 290
247 3300048925 Ga0496122_0159922 Ga0496122_0159922_244_1185 290
248 3300048926 Ga0496123_0002967 Ga0496123_0002967_16837_17778 290
249 3300048926 Ga0496123_0079519 Ga0496123_0079519_1011_1952 290
250 3300048927 Ga0496124_0015302 Ga0496124_0015302_1528_2469 290
251 3300048928 Ga0496125_0013564 Ga0496125_0013564_3281_4222 290
252 3300048929 Ga0496126_0008961 Ga0496126_0008961_7753_8694 290
253 3300048929 Ga0496126_0154891 Ga0496126_0154891_136_1077 290
254 3300048929 Ga0496126_0236319 Ga0496126_0236319_140_1081 290
255 3300048929 Ga0496126_0262678 Ga0496126_0262678_62_1003 290
256 3300049583 Ga0501067_0041182 Ga0501067_0041182_11_952 290
257 3300049585 Ga0501069_0143574 Ga0501069_0143574_135_1076 290
258 3300049586 Ga0501070_0013556 Ga0501070_0013556_4608_5549 290
259 3300050490 nmdc:mga03n38_16750_c1 nmdc:mga03n38_16750_c1_124_1065 290
260 3300050492 nmdc:mga0yw44_81620_c1 nmdc:mga0yw44_81620_c1_951_1892 290
261 3300050494 nmdc:mga06z11_40864_c1 nmdc:mga06z11_40864_c1_862_1803 290
262 3300050496 nmdc:mga07m45_215326_c1 nmdc:mga07m45_215326_c1_159_1100 290
263 3300050496 nmdc:mga07m45_40863_c1 nmdc:mga07m45_40863_c1_710_1651 290
264 3300053078 Ga0495612_0015932 Ga0495612_0015932_268_1209 290
265 3300053085 Ga0495619_0231481 Ga0495619_0231481_109_1050 290
266 3300053087 Ga0500643_000707 Ga0500643_000707_8669_9610 290
267 3300053088 Ga0500644_0004606 Ga0500644_0004606_1939_2880 290
268 3300053090 Ga0500646_0033069 Ga0500646_0033069_112_1053 290
269 3300053092 Ga0500583_0036060 Ga0500583_0036060_1079_2020 290
270 3300053108 Ga0500562_001107 Ga0500562_001107_1912_2853 290
271 3300053108 Ga0500562_001780 Ga0500562_001780_3658_4599 290
272 3300053119 Ga0500595_000662 Ga0500595_000662_16963_17904 290
273 3300053119 Ga0500595_004598 Ga0500595_004598_783_1724 290
274 3300053134 Ga0500658_0026987 Ga0500658_0026987_909_1850 290
275 3300053139 Ga0500568_0092984 Ga0500568_0092984_62_1003 290
276 3300053153 Ga0500616_0011874 Ga0500616_0011874_2171_3112 290
277 3300053153 Ga0500616_0047738 Ga0500616_0047738_992_1933 290
278 3300053736 Ga0500599_000207 Ga0500599_000207_919_1860 290
279 iso_pu_bacteria 2906610324 2906615729 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

94

143

0.96

PF13437

HlyD_3

HlyD family secretion protein

184

289

0.84

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

91

267

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rcn-assembly1.cif.gz_B structure and function of a single-chain, multi-domain long-chain acyl-coa carboxylase 0.8481 62 171
5vyz-assembly1.cif.gz_A crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.84 64 168
5vyz-assembly1.cif.gz_B crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.8391 64 168
5vyz-assembly1.cif.gz_C crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.8344 64 168
3hbl-assembly1.cif.gz_B crystal structure of s. aureus pyruvate carboxylase t908a mutant 0.816 62 168
ID Description Score Start End Superfamily
4rcnB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8688 62 168 2.40.50.100
af_P96890_525_598_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8597 64 156 2.40.50.100
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8575 61 168 2.40.50.100
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8551 61 171 2.40.50.100
3fppB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8524 61 170 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A377UX66-F1-model_v4 Auxiliary transport protein, MFP family 0.8188 175 287
AF-A0A3D4Z3W7-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.7837 50 265 GO:0030313
AF-R7L5N4-F1-model_v4 Efflux transporter RND family MFP subunit 0.7721 50 265 GO:0016020
GO:0022857
AF-S3V1V0-F1-model_v4 deleted 0.7656 51 269
AF-M3HI03-F1-model_v4 HlyD family secretion domain protein 0.7654 51 263 GO:0015562
GO:1990281

Feature Viewer

pLDDT pTM Quality
72.2 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map