F376501

General Info

Members Datasets Scaffolds Average Seq Length
269 196 243 183

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0064729|Ga0501034_0064729_1552_2145
Length 197
Sequence VVKQDERIEETIVINDIKSDAEKKMKKSLEALHSAFNKIRTGRAHPAILDSVMVNYYGQETPLKQVASVNVEDNRTLTVSPWEKNLVPTIEKAIMTSDLGLNPATSGDLIRVPMPMLTEETRKEMVKQAKADAEHGRVSIRNARRDANSMLKDLLKEKEISEDELRKGEEEVQKLTDKYIAEVEKMLKVKEEDLMAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231024 Pseudomonas sp. GM84 Isolate Nodule
3 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
4 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
5 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
6 2765235841 Pseudomonas putida AA7 Isolate Unclassified
7 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
8 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
9 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
10 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
11 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
12 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
13 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
14 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
15 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
16 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
17 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
18 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
106 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
128 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
129 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
132 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
138 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
139 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
140 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
188 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
189 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
190 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
191 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
192 8052494512 Pseudomonas putida LD6 Isolate Unclassified
193 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
194 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
195 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
196 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.59
Metatranscriptomes 0.74
Isolates 9.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 1.49
Rhizoplane 4.46
Rhizosphere 81.41
Stem 0
Stem Tuber 0
Unclassified 10.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_694250 2162886007 Bacteria 830
2 Ga0055536_1015857 3300003781 Bacteria 2553
3 Ga0065704_10013472 3300005289 Bacteria 1993
4 Ga0065704_10017555 3300005289 Bacteria 2085
5 Ga0065704_10207776 3300005289 Bacteria 1120
6 Ga0070658_10412364 3300005327 Unclassified 1161
7 Ga0070683_100606539 3300005329 Bacteria 1048
8 Ga0070670_101215321 3300005331 Unclassified 689
9 Ga0070677_10498273 3300005333 Bacteria 660
10 Ga0070666_10011774 3300005335 Bacteria 5499
11 Ga0068868_100782063 3300005338 Unclassified 860
12 Ga0070669_100002436 3300005353 Bacteria 13474
13 Ga0070669_100735430 3300005353 Bacteria 835
14 Ga0070675_100140367 3300005354 Bacteria 2065
15 Ga0070675_100189266 3300005354 Bacteria 1782
16 Ga0070671_100000013 3300005355 Bacteria 173287
17 Ga0070671_100223142 3300005355 Bacteria 1599
18 Ga0070673_100176865 3300005364 Bacteria 1825
19 Ga0070673_100493054 3300005364 Bacteria 1107
20 Ga0070667_100000015 3300005367 Bacteria 238203
21 Ga0070714_100199047 3300005435 Unclassified 1832
22 Ga0068867_100584671 3300005459 Unclassified 972
23 Ga0070685_10000004 3300005466 Bacteria 246215
24 Ga0070698_100333454 3300005471 Bacteria 1448
25 Ga0070684_101402216 3300005535 Bacteria 658
26 Ga0070672_100930630 3300005543 Bacteria 769
27 Ga0070693_100419604 3300005547 Bacteria 932
28 Ga0070665_100012903 3300005548 Bacteria 8416
29 Ga0068855_100418524 3300005563 Bacteria 1466
30 Ga0070664_100825250 3300005564 Bacteria 868
31 Ga0068852_101130564 3300005616 Unclassified 804
32 Ga0068859_100008974 3300005617 Bacteria 10098
33 Ga0068864_100000072 3300005618 Bacteria 110066
34 Ga0068851_10577655 3300005834 Bacteria 682
35 Ga0068863_100310590 3300005841 Bacteria 1530
36 Ga0068858_100103385 3300005842 Bacteria 2657
37 Ga0068860_100000271 3300005843 Bacteria 75530
38 Ga0068862_100174430 3300005844 Bacteria 1926
39 Ga0068862_100567784 3300005844 Bacteria 1085
40 Ga0075432_10241257 3300006058 Bacteria 730
41 Ga0075369_10304569 3300006186 Unclassified 744
42 Ga0075430_100016037 3300006846 Bacteria 6380
43 Ga0075430_100138881 3300006846 Bacteria 2024
44 Ga0075431_100136364 3300006847 Bacteria 2530
45 Ga0075431_100251713 3300006847 Bacteria 1795
46 Ga0075429_100154318 3300006880 Bacteria 2011
47 Ga0097620_100008974 3300006931 Bacteria 10098
48 Ga0099823_1005145 3300006944 Bacteria 12975
49 Ga0099823_1068167 3300006944 Bacteria 1647
50 Ga0105251_10059083 3300009011 Bacteria 1809
51 Ga0105251_10074057 3300009011 Bacteria 1582
52 Ga0105251_10133606 3300009011 Bacteria 1124
53 Ga0105244_10074262 3300009036 Bacteria 1692
54 Ga0105244_10101110 3300009036 Bacteria 1410
55 Ga0105244_10168068 3300009036 Bacteria 1045
56 Ga0105244_10223832 3300009036 Bacteria 882
57 Ga0105250_10035323 3300009092 Bacteria 2005
58 Ga0105250_10043261 3300009092 Bacteria 1805
59 Ga0105247_10011331 3300009101 Bacteria 5379
60 Ga0114129_11605661 3300009147 Unclassified 796
61 Ga0105243_10274497 3300009148 Bacteria 1515
62 Ga0105243_10274498 3300009148 Bacteria 1515
63 Ga0105248_10279503 3300009177 Bacteria 1879
64 Ga0105238_10648063 3300009551 Bacteria 1066
65 Ga0105238_11112416 3300009551 Bacteria 813
66 Ga0105249_11020408 3300009553 Bacteria 896
67 Ga0105239_10527868 3300010375 Bacteria 1343
68 Ga0105239_11314459 3300010375 Bacteria 834
69 Ga0157373_10232034 3300013100 Bacteria 1303
70 Ga0157373_11006921 3300013100 Bacteria 622
71 Ga0157370_10020234 3300013104 Bacteria 6649
72 Ga0157370_10342646 3300013104 Bacteria 1378
73 Ga0157374_10585390 3300013296 Unclassified 1125
74 Ga0157378_10738694 3300013297 Bacteria 1006
75 Ga0157372_10003896 3300013307 Bacteria 16036
76 Ga0157372_10066438 3300013307 Bacteria 4052
77 Ga0157372_10121025 3300013307 Bacteria 3006
78 Ga0157372_10900707 3300013307 Bacteria 1026
79 Ga0157372_11031611 3300013307 Bacteria 952
80 Ga0163163_10000118 3300014325 Bacteria 84379
81 Ga0157379_10169488 3300014968 Bacteria 1971
82 Ga0207425_1020932 3300025245 Bacteria 1392
83 Ga0209676_1000916 3300025292 Bacteria 36772
84 Ga0207696_1000164 3300025711 Bacteria 106057
85 Ga0207696_1010206 3300025711 Bacteria 3458
86 Ga0207696_1012464 3300025711 Bacteria 3005
87 Ga0207655_1001759 3300025728 Bacteria 18987
88 Ga0207655_1033908 3300025728 Bacteria 2305
89 Ga0207655_1056555 3300025728 Bacteria 1546
90 Ga0207655_1059725 3300025728 Bacteria 1482
91 Ga0207655_1079754 3300025728 Bacteria 1185
92 Ga0207713_1011826 3300025735 Bacteria 4712
93 Ga0207713_1035852 3300025735 Bacteria 2136
94 Ga0207713_1057409 3300025735 Bacteria 1505
95 Ga0207682_10015463 3300025893 Bacteria 2970
96 Ga0207710_10186969 3300025900 Bacteria 1019
97 Ga0207680_10038697 3300025903 Bacteria 2762
98 Ga0207645_10259444 3300025907 Unclassified 1151
99 Ga0207705_10378644 3300025909 Unclassified 1093
100 Ga0207681_10002041 3300025923 Bacteria 12952
101 Ga0207694_10832429 3300025924 Unclassified 780
102 Ga0207650_10000013 3300025925 Bacteria 409471
103 Ga0207650_10887222 3300025925 Unclassified 757
104 Ga0207659_10400264 3300025926 Bacteria 1148
105 Ga0207659_10858604 3300025926 Bacteria 780
106 Ga0207664_10129878 3300025929 Bacteria 2120
107 Ga0207644_10000015 3300025931 Bacteria 179880
108 Ga0207644_10191736 3300025931 Bacteria 1607
109 Ga0207706_10349531 3300025933 Bacteria 1286
110 Ga0207709_10178142 3300025935 Bacteria 1499
111 Ga0207709_10200555 3300025935 Bacteria 1425
112 Ga0207669_10056495 3300025937 Bacteria 2384
113 Ga0207691_10473276 3300025940 Bacteria 1065
114 Ga0207711_10000103 3300025941 Bacteria 90172
115 Ga0207711_10000277 3300025941 Bacteria 55359
116 Ga0207661_10414675 3300025944 Bacteria 1223
117 Ga0207651_10218503 3300025960 Bacteria 1539
118 Ga0207712_10586416 3300025961 Bacteria 963
119 Ga0207658_10000005 3300025986 Bacteria 408341
120 Ga0207677_10807195 3300026023 Unclassified 840
121 Ga0207703_10005017 3300026035 Bacteria 10732
122 Ga0207641_10014806 3300026088 Bacteria 6393
123 Ga0207648_10551929 3300026089 Bacteria 1058
124 Ga0207676_10000010 3300026095 Bacteria 519402
125 Ga0207675_101508860 3300026118 Unclassified 693
126 Ga0209389_1003256 3300027296 Bacteria 12985
127 Ga0209971_1001142 3300027682 Bacteria 6713
128 Ga0209974_10002118 3300027876 Bacteria 7263
129 Ga0268266_10001307 3300028379 Bacteria 30263
130 Ga0268266_10011282 3300028379 Bacteria 7776
131 Ga0268266_10404323 3300028379 Bacteria 1291
132 Ga0268265_10001515 3300028380 Bacteria 19408
133 Ga0268265_10516351 3300028380 Bacteria 1128
134 Ga0268264_10000036 3300028381 Bacteria 392994
135 Ga0265324_10152337 3300029957 Bacteria 785
136 Ga0265339_10365907 3300031249 Bacteria 678
137 Ga0307408_100000042 3300031548 Bacteria 172505
138 Ga0316576_10025375 3300031727 Bacteria 4149
139 Ga0316576_10041780 3300031727 Bacteria 3303
140 Ga0316576_10047640 3300031727 Bacteria 3106
141 Ga0316576_10956975 3300031727 Bacteria 611
142 Ga0316578_10018268 3300031728 Bacteria 3838
143 Ga0316578_10151875 3300031728 Bacteria 1395
144 Ga0316577_10022272 3300031733 Bacteria 3518
145 Ga0307410_10155625 3300031852 Bacteria 1707
146 Ga0307416_100204838 3300032002 Unclassified 1876
147 Ga0316580_10044096 3300032139 Bacteria 1376
148 Ga0316574_0005602 3300035398 Bacteria 6711
149 Ga0316574_0042546 3300035398 Bacteria 2803
150 Ga0316574_0130457 3300035398 Bacteria 1617
151 Ga0316584_0044691 3300036712 Bacteria 3304
152 Ga0395899_0165771 3300037312 Bacteria 1559
153 Ga0395900_0018581 3300037418 Bacteria 7090
154 Ga0395901_1832267 3300038443 Unclassified 555
155 Ga0439438_002786 3300041405 Bacteria 7318
156 Ga0439438_019366 3300041405 Bacteria 1923
157 Ga0439447_002283 3300041407 Bacteria 7041
158 Ga0439461_0028974 3300041410 Bacteria 1143
159 Ga0439466_0002286 3300041411 Bacteria 7519
160 Ga0451787_493771 3300041441 Unclassified 828
161 Ga0451795_0299074 3300041456 Unclassified 809
162 Ga0451795_0399164 3300041456 Bacteria 1176
163 Ga0451795_1023846 3300041456 Unclassified 2111
164 Ga0451795_1614724 3300041456 Unclassified 762
165 Ga0451802_2066254 3300041460 Unclassified 849
166 Ga0451855_0628583 3300041511 Bacteria 874
167 Ga0439431_0004888 3300041997 Bacteria 2955
168 Ga0439431_0042479 3300041997 Bacteria 1161
169 Ga0439437_004137 3300042000 Bacteria 1578
170 Ga0439432_002084 3300042006 Bacteria 7550
171 Ga0439432_002805 3300042006 Bacteria 6495
172 Ga0439452_019132 3300042010 Bacteria 1815
173 Ga0450911_000008 3300042115 Bacteria 168304
174 Ga0450900_004026 3300042136 Bacteria 1668
175 Ga0450904_000727 3300042139 Bacteria 5761
176 Ga0450905_010691 3300042142 Bacteria 1274
177 Ga0439446_0017432 3300042156 Bacteria 2007
178 Ga0439434_0004422 3300042435 Bacteria 4109
179 Ga0439434_0099091 3300042435 Bacteria 938
180 Ga0439459_0007443 3300042438 Bacteria 1849
181 Ga0439464_0019764 3300042439 Bacteria 1840
182 Ga0439464_0028043 3300042439 Bacteria 1568
183 Ga0450916_000732 3300042530 Bacteria 3019
184 Ga0450916_004455 3300042530 Bacteria 1581
185 Ga0451577_0894782 3300042876 Unclassified 799
186 Ga0453683_0070802 3300044673 Unclassified 2181
187 Ga0453683_0085034 3300044673 Bacteria 1982
188 Ga0453683_0129296 3300044673 Bacteria 1591
189 Ga0453683_0309741 3300044673 Unclassified 1011
190 Ga0453683_0696159 3300044673 Bacteria 666
191 Ga0453684_0106831 3300044712 Bacteria 3410
192 Ga0453684_0217267 3300044712 Bacteria 2217
193 Ga0453684_0355392 3300044712 Bacteria 1651
194 Ga0453684_0491722 3300044712 Bacteria 1360
195 Ga0451576_0000003 3300045051 Bacteria 1550573
196 Ga0495653_0177077 3300046463 Bacteria 1467
197 Ga0495580_0528230 3300046472 Bacteria 786
198 Ga0495582_0272072 3300046473 Bacteria 972
199 Ga0495596_0125225 3300046500 Bacteria 997
200 Ga0495620_0000003 3300046515 Bacteria 345923
201 Ga0495630_0001744 3300046517 Bacteria 15191
202 Ga0495632_0005859 3300046519 Bacteria 8028
203 Ga0495643_0000712 3300046522 Bacteria 38101
204 Ga0495643_0008742 3300046522 Bacteria 6385
205 Ga0495648_0011710 3300046524 Bacteria 6581
206 Ga0495666_0168486 3300046526 Bacteria 1013
207 Ga0495586_0425341 3300046535 Unclassified 765
208 Ga0496109_0478435 3300048912 Bacteria 1176
209 Ga0496110_0367655 3300048913 Bacteria 1310
210 Ga0496114_0339932 3300048917 Bacteria 1327
211 Ga0496116_0138519 3300048919 Bacteria 1373
212 Ga0496117_0016215 3300048920 Bacteria 6296
213 Ga0496117_0131800 3300048920 Bacteria 1513
214 Ga0496118_0021388 3300048921 Bacteria 5694
215 Ga0496119_0000207 3300048922 Bacteria 83748
216 Ga0496119_0205510 3300048922 Bacteria 1016
217 Ga0496120_0001363 3300048923 Bacteria 29968
218 Ga0496121_0118367 3300048924 Bacteria 2005
219 Ga0496121_0170880 3300048924 Bacteria 1579
220 Ga0496122_0161570 3300048925 Bacteria 1365
221 Ga0496123_0194703 3300048926 Bacteria 1045
222 Ga0496124_0027019 3300048927 Bacteria 5163
223 Ga0496124_0041281 3300048927 Bacteria 3982
224 Ga0496124_0136556 3300048927 Bacteria 1941
225 Ga0496125_0007893 3300048928 Bacteria 11239
226 Ga0496126_0443135 3300048929 Bacteria 1046
227 Ga0501308_030210 3300049128 Bacteria 724
228 Ga0501314_012754 3300049530 Bacteria 809
229 Ga0501034_0014288 3300049571 Bacteria 8182
230 Ga0501034_0014888 3300049571 Bacteria 7999
231 Ga0501034_0064729 3300049571 Bacteria 3670
232 Ga0501047_0191367 3300049581 Bacteria 1909
233 Ga0501225_0063171 3300049705 Bacteria 1044
234 Ga0501080_0074071 3300049742 Bacteria 3168
235 Ga0501044_0025742 3300049823 Bacteria 6237
236 Ga0501226_000005 3300049853 Bacteria 271019
237 nmdc:mga09592_453806_c1 3300050508 Bacteria 1106
238 nmdc:mga0qj67_214985_c1 3300050509 Bacteria 1561
239 nmdc:mga0qj67_297132_c1 3300050509 Bacteria 1309
240 nmdc:mga06r32_228023_c1 3300050510 Bacteria 1851
241 nmdc:mga06r32_258386_c1 3300050510 Bacteria 1729
242 nmdc:mga0sz30_268476_c1 3300050516 Unclassified 760
243 Ga0500659_0007453 3300053135 Bacteria 6038

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_0628583 Ga0451855_0628583_76_636 134
2 3300041456 Ga0451795_0299074 Ga0451795_0299074_232_792 153
3 3300025944 Ga0207661_10414675 Ga0207661_104146752 159
4 3300041456 Ga0451795_0399164 Ga0451795_0399164_392_952 161
5 3300041456 Ga0451795_1023846 Ga0451795_1023846_293_853 161
6 3300044673 Ga0453683_0085034 Ga0453683_0085034_705_1265 162
7 3300041456 Ga0451795_1614724 Ga0451795_1614724_54_614 164
8 3300013100 Ga0157373_10232034 Ga0157373_102320342 166
9 3300013307 Ga0157372_10121025 Ga0157372_101210252 166
10 3300042876 Ga0451577_0894782 Ga0451577_0894782_156_713 166
11 3300044673 Ga0453683_0129296 Ga0453683_0129296_575_1132 166
12 3300044712 Ga0453684_0217267 Ga0453684_0217267_1615_2172 166
13 3300041441 Ga0451787_493771 Ga0451787_493771_79_639 167
14 3300046526 Ga0495666_0168486 Ga0495666_0168486_36_548 169
15 iso_pu_bacteria 640427133 640487493 169
16 3300044673 Ga0453683_0070802 Ga0453683_0070802_1582_2139 171
17 3300044712 Ga0453684_0491722 Ga0453684_0491722_31_549 172
18 3300038443 Ga0395901_1832267 Ga0395901_1832267_11_532 173
19 3300046463 Ga0495653_0177077 Ga0495653_0177077_614_1174 174
20 3300046472 Ga0495580_0528230 Ga0495580_0528230_11_571 174
21 3300046473 Ga0495582_0272072 Ga0495582_0272072_175_735 174
22 3300046517 Ga0495630_0001744 Ga0495630_0001744_13303_13863 174
23 3300046535 Ga0495586_0425341 Ga0495586_0425341_12_572 174
24 3300005844 Ga0068862_100567784 Ga0068862_1005677841 180
25 iso_pu_bacteria 2511231024 2511375531 181
26 iso_pu_bacteria 2554235231 2555245886 181
27 iso_pu_bacteria 2600254954 2600446506 181
28 iso_pu_bacteria 2600255389 2602010431 181
29 iso_pu_bacteria 2765235841 2765582323 181
30 iso_pu_bacteria 2806310737 2807409826 181
31 iso_pu_bacteria 2806310745 2807458174 181
32 iso_pu_bacteria 2808606373 2808904840 181
33 iso_pu_bacteria 2811994881 2812371023 181
34 iso_pu_bacteria 2823421272 2823422976 181
35 iso_pu_bacteria 2919155634 2919158802 181
36 iso_pu_bacteria 2919501602 2919505632 181
37 iso_pu_bacteria 2923519811 2923525130 181
38 iso_pu_bacteria 2926063275 2926067309 181
39 iso_pu_bacteria 3007803356 3007808638 181
40 iso_pu_bacteria 3007872151 3007874440 181
41 iso_pu_bacteria 8002745576 8002745868 181
42 iso_pu_bacteria 8034962539 8034964095 181
43 iso_pu_bacteria 8052494512 8052495775 181
44 iso_pu_bacteria 8054929484 8054929585 181
45 iso_pu_bacteria 8056115690 8056120163 181
46 iso_pu_bacteria 8056137416 8056141777 181
47 iso_pu_bacteria 8057160832 8057162602 181
48 3300044673 Ga0453683_0309741 Ga0453683_0309741_12_566 183
49 iso_pu_bacteria 2890804823 2890806669 183
50 iso_pu_bacteria 8036736890 8036737634 183
51 3300006186 Ga0075369_10304569 Ga0075369_103045692 184
52 3300029957 Ga0265324_10152337 Ga0265324_101523371 184
53 3300037418 Ga0395900_0018581 Ga0395900_0018581_5807_6370 184
54 3300041460 Ga0451802_2066254 Ga0451802_2066254_60_620 184
55 3300042435 Ga0439434_0099091 Ga0439434_0099091_133_696 184
56 3300044673 Ga0453683_0696159 Ga0453683_0696159_70_636 184
57 3300044712 Ga0453684_0355392 Ga0453684_0355392_851_1417 184
58 3300045051 Ga0451576_0000003 Ga0451576_0000003_627618_628181 184
59 3300050516 nmdc:mga0sz30_268476_c1 nmdc:mga0sz30_268476_c1_103_657 184
60 2162886007 SwRhRL2b_contig_694250 SwRhRL2b_0477.00005220 185
61 3300003781 Ga0055536_1015857 Ga0055536_10158574 185
62 3300005289 Ga0065704_10013472 Ga0065704_100134722 185
63 3300005289 Ga0065704_10017555 Ga0065704_100175552 185
64 3300005289 Ga0065704_10207776 Ga0065704_102077762 185
65 3300005327 Ga0070658_10412364 Ga0070658_104123642 185
66 3300005329 Ga0070683_100606539 Ga0070683_1006065391 185
67 3300005331 Ga0070670_101215321 Ga0070670_1012153211 185
68 3300005333 Ga0070677_10498273 Ga0070677_104982731 185
69 3300005335 Ga0070666_10011774 Ga0070666_100117743 185
70 3300005338 Ga0068868_100782063 Ga0068868_1007820631 185
71 3300005353 Ga0070669_100002436 Ga0070669_10000243613 185
72 3300005353 Ga0070669_100735430 Ga0070669_1007354301 185
73 3300005354 Ga0070675_100140367 Ga0070675_1001403671 185
74 3300005354 Ga0070675_100189266 Ga0070675_1001892662 185
75 3300005355 Ga0070671_100000013 Ga0070671_100000013148 185
76 3300005355 Ga0070671_100223142 Ga0070671_1002231422 185
77 3300005364 Ga0070673_100176865 Ga0070673_1001768651 185
78 3300005364 Ga0070673_100493054 Ga0070673_1004930542 185
79 3300005367 Ga0070667_100000015 Ga0070667_10000001568 185
80 3300005435 Ga0070714_100199047 Ga0070714_1001990471 185
81 3300005459 Ga0068867_100584671 Ga0068867_1005846711 185
82 3300005466 Ga0070685_10000004 Ga0070685_1000000461 185
83 3300005471 Ga0070698_100333454 Ga0070698_1003334541 185
84 3300005535 Ga0070684_101402216 Ga0070684_1014022161 185
85 3300005543 Ga0070672_100930630 Ga0070672_1009306301 185
86 3300005547 Ga0070693_100419604 Ga0070693_1004196042 185
87 3300005548 Ga0070665_100012903 Ga0070665_1000129036 185
88 3300005563 Ga0068855_100418524 Ga0068855_1004185242 185
89 3300005564 Ga0070664_100825250 Ga0070664_1008252501 185
90 3300005616 Ga0068852_101130564 Ga0068852_1011305642 185
91 3300005617 Ga0068859_100008974 Ga0068859_1000089744 185
92 3300005618 Ga0068864_100000072 Ga0068864_10000007270 185
93 3300005834 Ga0068851_10577655 Ga0068851_105776551 185
94 3300005841 Ga0068863_100310590 Ga0068863_1003105902 185
95 3300005842 Ga0068858_100103385 Ga0068858_1001033852 185
96 3300005843 Ga0068860_100000271 Ga0068860_10000027127 185
97 3300005844 Ga0068862_100174430 Ga0068862_1001744303 185
98 3300006058 Ga0075432_10241257 Ga0075432_102412572 185
99 3300006846 Ga0075430_100016037 Ga0075430_1000160377 185
100 3300006846 Ga0075430_100138881 Ga0075430_1001388812 185
101 3300006847 Ga0075431_100136364 Ga0075431_1001363642 185
102 3300006847 Ga0075431_100251713 Ga0075431_1002517131 185
103 3300006880 Ga0075429_100154318 Ga0075429_1001543182 185
104 3300006931 Ga0097620_100008974 Ga0097620_1000089744 185
105 3300006944 Ga0099823_1005145 Ga0099823_10051458 185
106 3300006944 Ga0099823_1068167 Ga0099823_10681672 185
107 3300009011 Ga0105251_10059083 Ga0105251_100590833 185
108 3300009011 Ga0105251_10074057 Ga0105251_100740572 185
109 3300009011 Ga0105251_10133606 Ga0105251_101336062 185
110 3300009036 Ga0105244_10074262 Ga0105244_100742622 185
111 3300009036 Ga0105244_10101110 Ga0105244_101011102 185
112 3300009036 Ga0105244_10168068 Ga0105244_101680682 185
113 3300009036 Ga0105244_10223832 Ga0105244_102238322 185
114 3300009092 Ga0105250_10035323 Ga0105250_100353232 185
115 3300009092 Ga0105250_10043261 Ga0105250_100432613 185
116 3300009101 Ga0105247_10011331 Ga0105247_100113316 185
117 3300009147 Ga0114129_11605661 Ga0114129_116056611 185
118 3300009148 Ga0105243_10274497 Ga0105243_102744972 185
119 3300009148 Ga0105243_10274498 Ga0105243_102744982 185
120 3300009177 Ga0105248_10279503 Ga0105248_102795032 185
121 3300009551 Ga0105238_10648063 Ga0105238_106480631 185
122 3300009551 Ga0105238_11112416 Ga0105238_111124161 185
123 3300009553 Ga0105249_11020408 Ga0105249_110204081 185
124 3300010375 Ga0105239_10527868 Ga0105239_105278681 185
125 3300010375 Ga0105239_11314459 Ga0105239_113144591 185
126 3300013100 Ga0157373_11006921 Ga0157373_110069211 185
127 3300013104 Ga0157370_10020234 Ga0157370_100202346 185
128 3300013104 Ga0157370_10342646 Ga0157370_103426461 185
129 3300013296 Ga0157374_10585390 Ga0157374_105853902 185
130 3300013297 Ga0157378_10738694 Ga0157378_107386942 185
131 3300013307 Ga0157372_10003896 Ga0157372_1000389613 185
132 3300013307 Ga0157372_10066438 Ga0157372_100664384 185
133 3300013307 Ga0157372_10900707 Ga0157372_109007072 185
134 3300013307 Ga0157372_11031611 Ga0157372_110316111 185
135 3300014325 Ga0163163_10000118 Ga0163163_1000011868 185
136 3300014968 Ga0157379_10169488 Ga0157379_101694882 185
137 3300025245 Ga0207425_1020932 Ga0207425_10209322 185
138 3300025292 Ga0209676_1000916 Ga0209676_100091616 185
139 3300025711 Ga0207696_1000164 Ga0207696_100016436 185
140 3300025711 Ga0207696_1010206 Ga0207696_10102062 185
141 3300025711 Ga0207696_1012464 Ga0207696_10124644 185
142 3300025728 Ga0207655_1001759 Ga0207655_100175914 185
143 3300025728 Ga0207655_1033908 Ga0207655_10339083 185
144 3300025728 Ga0207655_1056555 Ga0207655_10565552 185
145 3300025728 Ga0207655_1059725 Ga0207655_10597252 185
146 3300025728 Ga0207655_1079754 Ga0207655_10797542 185
147 3300025735 Ga0207713_1011826 Ga0207713_10118265 185
148 3300025735 Ga0207713_1035852 Ga0207713_10358522 185
149 3300025735 Ga0207713_1057409 Ga0207713_10574092 185
150 3300025893 Ga0207682_10015463 Ga0207682_100154633 185
151 3300025900 Ga0207710_10186969 Ga0207710_101869692 185
152 3300025903 Ga0207680_10038697 Ga0207680_100386973 185
153 3300025907 Ga0207645_10259444 Ga0207645_102594441 185
154 3300025909 Ga0207705_10378644 Ga0207705_103786442 185
155 3300025923 Ga0207681_10002041 Ga0207681_1000204112 185
156 3300025924 Ga0207694_10832429 Ga0207694_108324292 185
157 3300025925 Ga0207650_10000013 Ga0207650_10000013318 185
158 3300025925 Ga0207650_10887222 Ga0207650_108872221 185
159 3300025926 Ga0207659_10400264 Ga0207659_104002642 185
160 3300025926 Ga0207659_10858604 Ga0207659_108586041 185
161 3300025929 Ga0207664_10129878 Ga0207664_101298783 185
162 3300025931 Ga0207644_10000015 Ga0207644_10000015112 185
163 3300025931 Ga0207644_10191736 Ga0207644_101917362 185
164 3300025933 Ga0207706_10349531 Ga0207706_103495311 185
165 3300025935 Ga0207709_10178142 Ga0207709_101781422 185
166 3300025935 Ga0207709_10200555 Ga0207709_102005552 185
167 3300025937 Ga0207669_10056495 Ga0207669_100564951 185
168 3300025940 Ga0207691_10473276 Ga0207691_104732761 185
169 3300025941 Ga0207711_10000103 Ga0207711_1000010325 185
170 3300025941 Ga0207711_10000277 Ga0207711_1000027747 185
171 3300025960 Ga0207651_10218503 Ga0207651_102185032 185
172 3300025961 Ga0207712_10586416 Ga0207712_105864162 185
173 3300025986 Ga0207658_10000005 Ga0207658_10000005319 185
174 3300026023 Ga0207677_10807195 Ga0207677_108071951 185
175 3300026035 Ga0207703_10005017 Ga0207703_1000501710 185
176 3300026088 Ga0207641_10014806 Ga0207641_100148063 185
177 3300026089 Ga0207648_10551929 Ga0207648_105519292 185
178 3300026095 Ga0207676_10000010 Ga0207676_10000010416 185
179 3300026118 Ga0207675_101508860 Ga0207675_1015088601 185
180 3300027296 Ga0209389_1003256 Ga0209389_10032566 185
181 3300027682 Ga0209971_1001142 Ga0209971_10011426 185
182 3300027876 Ga0209974_10002118 Ga0209974_100021183 185
183 3300028379 Ga0268266_10001307 Ga0268266_1000130721 185
184 3300028379 Ga0268266_10011282 Ga0268266_100112825 185
185 3300028379 Ga0268266_10404323 Ga0268266_104043231 185
186 3300028380 Ga0268265_10001515 Ga0268265_100015152 185
187 3300028380 Ga0268265_10516351 Ga0268265_105163512 185
188 3300028381 Ga0268264_10000036 Ga0268264_10000036201 185
189 3300031249 Ga0265339_10365907 Ga0265339_103659071 185
190 3300031548 Ga0307408_100000042 Ga0307408_100000042128 185
191 3300031727 Ga0316576_10025375 Ga0316576_100253755 185
192 3300031727 Ga0316576_10041780 Ga0316576_100417803 185
193 3300031727 Ga0316576_10047640 Ga0316576_100476402 185
194 3300031727 Ga0316576_10956975 Ga0316576_109569751 185
195 3300031728 Ga0316578_10018268 Ga0316578_100182684 185
196 3300031728 Ga0316578_10151875 Ga0316578_101518752 185
197 3300031733 Ga0316577_10022272 Ga0316577_100222723 185
198 3300031852 Ga0307410_10155625 Ga0307410_101556252 185
199 3300032002 Ga0307416_100204838 Ga0307416_1002048383 185
200 3300032139 Ga0316580_10044096 Ga0316580_100440962 185
201 3300035398 Ga0316574_0005602 Ga0316574_0005602_1185_1742 185
202 3300035398 Ga0316574_0042546 Ga0316574_0042546_1237_1794 185
203 3300035398 Ga0316574_0130457 Ga0316574_0130457_803_1360 185
204 3300036712 Ga0316584_0044691 Ga0316584_0044691_844_1401 185
205 3300037312 Ga0395899_0165771 Ga0395899_0165771_892_1452 185
206 3300041405 Ga0439438_002786 Ga0439438_002786_1860_2417 185
207 3300041405 Ga0439438_019366 Ga0439438_019366_831_1388 185
208 3300041407 Ga0439447_002283 Ga0439447_002283_2596_3153 185
209 3300041410 Ga0439461_0028974 Ga0439461_0028974_416_973 185
210 3300041411 Ga0439466_0002286 Ga0439466_0002286_4606_5163 185
211 3300041997 Ga0439431_0004888 Ga0439431_0004888_974_1531 185
212 3300041997 Ga0439431_0042479 Ga0439431_0042479_426_983 185
213 3300042000 Ga0439437_004137 Ga0439437_004137_500_1057 185
214 3300042006 Ga0439432_002084 Ga0439432_002084_2355_2912 185
215 3300042006 Ga0439432_002805 Ga0439432_002805_1092_1649 185
216 3300042010 Ga0439452_019132 Ga0439452_019132_803_1360 185
217 3300042115 Ga0450911_000008 Ga0450911_000008_113292_113849 185
218 3300042136 Ga0450900_004026 Ga0450900_004026_512_1069 185
219 3300042139 Ga0450904_000727 Ga0450904_000727_694_1251 185
220 3300042142 Ga0450905_010691 Ga0450905_010691_380_937 185
221 3300042156 Ga0439446_0017432 Ga0439446_0017432_1066_1623 185
222 3300042435 Ga0439434_0004422 Ga0439434_0004422_1512_2069 185
223 3300042438 Ga0439459_0007443 Ga0439459_0007443_316_873 185
224 3300042439 Ga0439464_0019764 Ga0439464_0019764_1050_1607 185
225 3300042439 Ga0439464_0028043 Ga0439464_0028043_421_978 185
226 3300042530 Ga0450916_000732 Ga0450916_000732_89_646 185
227 3300042530 Ga0450916_004455 Ga0450916_004455_91_648 185
228 3300044712 Ga0453684_0106831 Ga0453684_0106831_767_1324 185
229 3300046500 Ga0495596_0125225 Ga0495596_0125225_374_931 185
230 3300046515 Ga0495620_0000003 Ga0495620_0000003_158640_159197 185
231 3300046519 Ga0495632_0005859 Ga0495632_0005859_4942_5499 185
232 3300046522 Ga0495643_0000712 Ga0495643_0000712_3189_3746 185
233 3300046522 Ga0495643_0008742 Ga0495643_0008742_5248_5805 185
234 3300046524 Ga0495648_0011710 Ga0495648_0011710_5371_5928 185
235 3300048912 Ga0496109_0478435 Ga0496109_0478435_501_1058 185
236 3300048913 Ga0496110_0367655 Ga0496110_0367655_271_828 185
237 3300048917 Ga0496114_0339932 Ga0496114_0339932_579_1136 185
238 3300048919 Ga0496116_0138519 Ga0496116_0138519_247_804 185
239 3300048920 Ga0496117_0016215 Ga0496117_0016215_5498_6055 185
240 3300048920 Ga0496117_0131800 Ga0496117_0131800_715_1272 185
241 3300048921 Ga0496118_0021388 Ga0496118_0021388_194_751 185
242 3300048922 Ga0496119_0000207 Ga0496119_0000207_83057_83614 185
243 3300048922 Ga0496119_0205510 Ga0496119_0205510_274_831 185
244 3300048923 Ga0496120_0001363 Ga0496120_0001363_29105_29662 185
245 3300048924 Ga0496121_0118367 Ga0496121_0118367_743_1300 185
246 3300048924 Ga0496121_0170880 Ga0496121_0170880_597_1154 185
247 3300048925 Ga0496122_0161570 Ga0496122_0161570_119_676 185
248 3300048926 Ga0496123_0194703 Ga0496123_0194703_26_583 185
249 3300048927 Ga0496124_0027019 Ga0496124_0027019_3952_4509 185
250 3300048927 Ga0496124_0041281 Ga0496124_0041281_2823_3380 185
251 3300048927 Ga0496124_0136556 Ga0496124_0136556_763_1320 185
252 3300048928 Ga0496125_0007893 Ga0496125_0007893_5306_5863 185
253 3300048929 Ga0496126_0443135 Ga0496126_0443135_393_950 185
254 3300049128 Ga0501308_030210 Ga0501308_030210_120_677 185
255 3300049530 Ga0501314_012754 Ga0501314_012754_189_746 185
256 3300049571 Ga0501034_0014288 Ga0501034_0014288_7550_8110 185
257 3300049571 Ga0501034_0014888 Ga0501034_0014888_2659_3216 185
258 3300049571 Ga0501034_0064729 Ga0501034_0064729_1552_2145 185
259 3300049581 Ga0501047_0191367 Ga0501047_0191367_279_836 185
260 3300049705 Ga0501225_0063171 Ga0501225_0063171_19_576 185
261 3300049742 Ga0501080_0074071 Ga0501080_0074071_724_1284 185
262 3300049823 Ga0501044_0025742 Ga0501044_0025742_1798_2358 185
263 3300049853 Ga0501226_000005 Ga0501226_000005_169354_169911 185
264 3300050508 nmdc:mga09592_453806_c1 nmdc:mga09592_453806_c1_109_669 185
265 3300050509 nmdc:mga0qj67_214985_c1 nmdc:mga0qj67_214985_c1_514_1074 185
266 3300050509 nmdc:mga0qj67_297132_c1 nmdc:mga0qj67_297132_c1_459_1019 185
267 3300050510 nmdc:mga06r32_228023_c1 nmdc:mga06r32_228023_c1_459_1019 185
268 3300050510 nmdc:mga06r32_258386_c1 nmdc:mga06r32_258386_c1_19_579 185
269 3300053135 Ga0500659_0007453 Ga0500659_0007453_4113_4670 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

32

195

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9417 1 185
5mlc-assembly1.cif.gz_9 cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions 0.9189 103 185
5jsn-assembly2.cif.gz_D bcl2-inhibitor complex 0.9188 1 182
3lhp-assembly1.cif.gz_S crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex 0.9146 1 183
5jsb-assembly1.cif.gz_B crystal structure of mcl1-inhibitor complex 0.9139 103 182
ID Description Score Start End Superfamily
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9973 31 105 3.30.1360.40
1is1A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9915 3 185 1.10.132.20
4kc6A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9877 106 179 1.10.132.20
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9842 31 105 3.30.1360.40
1iseA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9836 3 185 1.10.132.20
ID Description Score Start End GO Terms
AF-A0A3B9XQ89-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9928 1 184 GO:0002184
GO:0005829
GO:0043023
AF-A0A420VBI8-F1-model_v4 Multifunctional fusion protein [Includes: Uridylate kinase (UK) (EC 2.7.4.22) (Uridine monophosphate kinase) (UMP kinase) (UMPK); Ribosome-recycling factor (RRF) (Ribosome-releasing factor)] 0.9876 1 185 GO:0005524
GO:0005737
GO:0006225
GO:0006415
GO:0033862
GO:0044210
AF-A0A2A4RE35-F1-model_v4 Ribosome recycling factor 0.9872 1 129 GO:0002184
GO:0005829
GO:0043023
AF-Q7MIG3-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.987 1 185 GO:0002184
GO:0005829
GO:0043023
AF-A0A6L8FMD9-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.987 14 185 GO:0005737
GO:0006415
GO:0043023

Feature Viewer

pLDDT pTM Quality
79.1 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map