F375655

General Info

Members Datasets Scaffolds Average Seq Length
268 178 256 337

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0002906|Ga0395905_0002906_852_1940
Length 362
Sequence MPTWSFSHRICNSRQFTPKEKSLNSLMLDEARSAPECVAIQMKSDADLYAEASAYLRAADPASVVTVARGSSDHAASFFAYLSALRGGRLVSSLPMSLLTLHHAPLRFNAACAVAISQSGRSPDLCTVMSQFHAGGAATLALINDVSSPLTQSVHHALPLNAGAERSVAATKSFICSVVGGARLLGEWFHDADLLRALHELPQSLHSACLKDWSAAIDVLKDADRVMIIGRGTGLAIAQEAALKLKETCAIQAEAFSSAEVRHGPMALVEPGYPMLVFAPRGPAQPDLLNLARDMRSRGASVLLAASADVGDRQLTLAPTLLSELDPIAAIQSFYPMVEALARARGTDPDRPRHLSKVTSTL

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221585 Pelomonas sp. Root662 Isolate Unclassified
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2643221656 Pelomonas sp. Root405 Isolate Unclassified
11 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
116 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
117 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
118 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
119 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
120 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
121 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
122 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
123 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
124 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
156 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
157 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
169 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
173 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
174 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
178 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 0
Isolates 4.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.13
Nodule 0
Rhizoplane 1.49
Rhizosphere 57.46
Stem 0
Stem Tuber 0
Unclassified 17.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003717 3300002773 Bacteria 5109
2 JGI25153J46596_10001057 3300003215 Bacteria 16789
3 JGI25153J46596_10004755 3300003215 Bacteria 7235
4 rootH1_10064001 3300003316 Bacteria 2639
5 rootL2_10025756 3300003322 Bacteria 4016
6 Ga0055525_1000222 3300003759 Bacteria 61500
7 Ga0055526_1005017 3300003771 Bacteria 7744
8 Ga0055530_10011803 3300003791 Bacteria 3102
9 Ga0055531_10000513 3300003794 Bacteria 34951
10 Ga0070682_100066693 3300005337 Bacteria 2290
11 Ga0070692_10063324 3300005345 Bacteria 1953
12 Ga0070667_100008719 3300005367 Bacteria 8406
13 Ga0070667_100180260 3300005367 Bacteria 1868
14 Ga0070709_10001056 3300005434 Bacteria 15203
15 Ga0070714_100002565 3300005435 Bacteria 13384
16 Ga0070710_10044630 3300005437 Bacteria 2460
17 Ga0070705_100129532 3300005440 Bacteria 1643
18 Ga0070708_100133485 3300005445 Bacteria 2299
19 Ga0070708_100160327 3300005445 Bacteria 2096
20 Ga0070662_100009371 3300005457 Bacteria 6399
21 Ga0070662_100086508 3300005457 Bacteria 2344
22 Ga0070662_100148132 3300005457 Bacteria 1825
23 Ga0068867_100000083 3300005459 Bacteria 58784
24 Ga0068867_100048785 3300005459 Bacteria 3116
25 Ga0070706_100280846 3300005467 Bacteria 1554
26 Ga0070707_100100654 3300005468 Bacteria 2800
27 Ga0070698_100206605 3300005471 Bacteria 1899
28 Ga0070699_100077303 3300005518 Bacteria 2897
29 Ga0070679_100131520 3300005530 Bacteria 2483
30 Ga0070697_100027990 3300005536 Bacteria 4511
31 Ga0070704_100018299 3300005549 Bacteria 4477
32 Ga0068857_100015430 3300005577 Bacteria 6671
33 Ga0075365_10005572 3300006038 Bacteria 6805
34 Ga0075365_10027973 3300006038 Bacteria 3591
35 Ga0075368_10009936 3300006042 Bacteria 3432
36 Ga0075363_100010376 3300006048 Bacteria 4420
37 Ga0075363_100083347 3300006048 Bacteria 1752
38 Ga0070716_100059268 3300006173 Bacteria 2206
39 Ga0075362_10012181 3300006177 Bacteria 3410
40 Ga0075367_10006653 3300006178 Bacteria 5860
41 Ga0075370_10015296 3300006353 Bacteria 4105
42 Ga0075433_10036728 3300006852 Bacteria 4222
43 Ga0075434_100071949 3300006871 Bacteria 3450
44 Ga0075429_100007851 3300006880 Bacteria 9269
45 Ga0075436_100008551 3300006914 Bacteria 6997
46 Ga0075435_100022703 3300007076 Bacteria 4842
47 Ga0105240_10013307 3300009093 Bacteria 11309
48 Ga0105240_10035441 3300009093 Bacteria 6430
49 Ga0105243_10000919 3300009148 Bacteria 27591
50 Ga0105243_10015671 3300009148 Bacteria 5731
51 Ga0105243_10064536 3300009148 Bacteria 2939
52 Ga0105243_10197919 3300009148 Bacteria 1760
53 Ga0105237_10003357 3300009545 Bacteria 19066
54 Ga0105238_10030082 3300009551 Bacteria 5527
55 Ga0105238_10054287 3300009551 Bacteria 4024
56 Ga0105239_10003475 3300010375 Bacteria 19275
57 Ga0157370_10023081 3300013104 Bacteria 6184
58 Ga0157375_10467457 3300013308 Bacteria 1427
59 Ga0157377_10000104 3300014745 Bacteria 58794
60 Ga0157377_10000546 3300014745 Bacteria 15869
61 Ga0213872_10000045 3300021361 Bacteria 112229
62 Ga0213872_10001196 3300021361 Bacteria 17590
63 Ga0209563_100088 3300025230 Bacteria 175375
64 Ga0207425_1001190 3300025245 Bacteria 11583
65 Ga0209129_1000481 3300025258 Bacteria 29172
66 Ga0209673_1005064 3300025273 Bacteria 6783
67 Ga0209673_1029679 3300025273 Bacteria 1737
68 Ga0209673_1038628 3300025273 Bacteria 1387
69 Ga0209564_1001182 3300025295 Bacteria 30216
70 Ga0209758_1000859 3300025297 Bacteria 42074
71 Ga0209758_1001201 3300025297 Bacteria 32708
72 Ga0209050_1000706 3300025298 Bacteria 49523
73 Ga0209050_1006687 3300025298 Bacteria 6748
74 Ga0209256_1036066 3300025299 Bacteria 1300
75 Ga0209051_1000833 3300025303 Bacteria 31762
76 Ga0209257_1000161 3300025304 Bacteria 176089
77 Ga0209257_1001107 3300025304 Bacteria 35003
78 Ga0209257_1024437 3300025304 Bacteria 2092
79 Ga0207692_10017293 3300025898 Bacteria 3214
80 Ga0207705_10153313 3300025909 Bacteria 1727
81 Ga0207684_10188210 3300025910 Bacteria 1780
82 Ga0207695_10013742 3300025913 Bacteria 9633
83 Ga0207695_10209599 3300025913 Bacteria 1860
84 Ga0207671_10036894 3300025914 Bacteria 3625
85 Ga0207693_10008099 3300025915 Bacteria 8621
86 Ga0207663_10061390 3300025916 Bacteria 2385
87 Ga0207657_10026339 3300025919 Bacteria 5345
88 Ga0207646_10001282 3300025922 Bacteria 31406
89 Ga0207664_10004507 3300025929 Bacteria 9438
90 Ga0207706_10002534 3300025933 Bacteria 17812
91 Ga0207706_10002795 3300025933 Bacteria 16962
92 Ga0207706_10172358 3300025933 Bacteria 1901
93 Ga0207706_10206469 3300025933 Bacteria 1722
94 Ga0207709_10000675 3300025935 Bacteria 27560
95 Ga0207709_10008364 3300025935 Bacteria 5725
96 Ga0207709_10078363 3300025935 Bacteria 2121
97 Ga0207704_10214226 3300025938 Bacteria 1420
98 Ga0207665_10015084 3300025939 Bacteria 5073
99 Ga0207665_10143701 3300025939 Bacteria 1704
100 Ga0207661_10123983 3300025944 Bacteria 2204
101 Ga0207712_10459618 3300025961 Bacteria 1081
102 Ga0207658_10001310 3300025986 Bacteria 19633
103 Ga0207677_10271385 3300026023 Bacteria 1388
104 Ga0207678_10045301 3300026067 Bacteria 3804
105 Ga0207648_10000243 3300026089 Bacteria 58746
106 Ga0207648_10003157 3300026089 Bacteria 17364
107 Ga0207674_10055677 3300026116 Bacteria 4020
108 Ga0207674_10075962 3300026116 Bacteria 3369
109 Ga0207683_10034605 3300026121 Bacteria 4391
110 Ga0207698_10032612 3300026142 Bacteria 3776
111 Ga0207698_10038392 3300026142 Bacteria 3538
112 Ga0207698_10121095 3300026142 Bacteria 2215
113 Ga0209813_10053953 3300027866 Bacteria 1265
114 Ga0268266_10241065 3300028379 Bacteria 1669
115 Ga0307517_10004774 3300028786 Bacteria 20694
116 Ga0307517_10081549 3300028786 Bacteria 2756
117 Ga0307517_10100404 3300028786 Bacteria 2286
118 Ga0307517_10184892 3300028786 Bacteria 1336
119 Ga0307515_10000093 3300028794 Bacteria 212053
120 Ga0307515_10000110 3300028794 Bacteria 195560
121 Ga0307515_10000521 3300028794 Bacteria 91558
122 Ga0307515_10014947 3300028794 Bacteria 14342
123 Ga0307515_10020162 3300028794 Bacteria 11919
124 Ga0307515_10026895 3300028794 Bacteria 9868
125 Ga0307515_10071573 3300028794 Bacteria 4697
126 Ga0307515_10110938 3300028794 Bacteria 3205
127 Ga0265331_10003373 3300031250 Bacteria 10353
128 Ga0265327_10000020 3300031251 Bacteria 424552
129 Ga0307513_10151172 3300031456 Unclassified 2230
130 Ga0307509_10001461 3300031507 Bacteria 40003
131 Ga0307509_10008460 3300031507 Bacteria 13108
132 Ga0307509_10064531 3300031507 Bacteria 3851
133 Ga0307509_10069865 3300031507 Bacteria 3669
134 Ga0307509_10071888 3300031507 Bacteria 3606
135 Ga0307509_10077041 3300031507 Bacteria 3457
136 Ga0307508_10000150 3300031616 Bacteria 83110
137 Ga0307508_10003770 3300031616 Bacteria 15140
138 Ga0307508_10005377 3300031616 Bacteria 12191
139 Ga0307508_10012427 3300031616 Bacteria 7784
140 Ga0307508_10095975 3300031616 Bacteria 2556
141 Ga0307514_10000780 3300031649 Bacteria 52828
142 Ga0307514_10003863 3300031649 Bacteria 14082
143 Ga0307514_10006326 3300031649 Bacteria 10346
144 Ga0307514_10097720 3300031649 Bacteria 2118
145 Ga0307516_10092122 3300031730 Bacteria 2858
146 Ga0307516_10164842 3300031730 Bacteria 1962
147 Ga0307516_10273970 3300031730 Bacteria 1372
148 Ga0307409_100168679 3300031995 Bacteria 1924
149 Ga0307411_10000368 3300032005 Bacteria 15274
150 Ga0307507_10029743 3300033179 Bacteria 5783
151 Ga0307507_10053118 3300033179 Bacteria 3875
152 Ga0307510_10000360 3300033180 Bacteria 42908
153 Ga0307510_10013533 3300033180 Bacteria 9677
154 Ga0307510_10078519 3300033180 Bacteria 3227
155 Ga0307510_10099867 3300033180 Bacteria 2698
156 Ga0307510_10128302 3300033180 Bacteria 2218
157 Ga0307510_10240009 3300033180 Bacteria 1307
158 Ga0373943_0030701 3300035170 Bacteria 2545
159 Ga0373924_0005011 3300035410 Bacteria 4662
160 Ga0373931_0021283 3300035691 Bacteria 3253
161 Ga0373927_0109513 3300035695 Bacteria 1799
162 Ga0373947_0059601 3300035725 Bacteria 2314
163 Ga0395900_0017145 3300037418 Bacteria 7392
164 Ga0395905_0002635 3300037471 Bacteria 19696
165 Ga0395905_0002906 3300037471 Bacteria 18693
166 Ga0395905_0009501 3300037471 Bacteria 9503
167 Ga0395905_0025365 3300037471 Bacteria 5590
168 Ga0436361_0224989 3300039447 Bacteria 10880
169 Ga0436361_0694787 3300039447 Bacteria 33732
170 Ga0439449_0000524 3300042007 Bacteria 14275
171 Ga0450911_005505 3300042115 Bacteria 1961
172 Ga0450912_001836 3300042116 Bacteria 1355
173 Ga0450919_000919 3300042121 Bacteria 3812
174 Ga0450888_000044 3300042126 Bacteria 8907
175 Ga0450890_001995 3300042127 Bacteria 2878
176 Ga0450891_000948 3300042129 Bacteria 3027
177 Ga0450898_002163 3300042134 Bacteria 2720
178 Ga0450903_004970 3300042138 Bacteria 2240
179 Ga0450889_004449 3300042144 Bacteria 1386
180 Ga0439434_0031687 3300042435 Bacteria 1608
181 Ga0439464_0001135 3300042439 Bacteria 6168
182 Ga0450918_000028 3300042531 Bacteria 30240
183 Ga0451577_0000031 3300042876 Bacteria 388524
184 Ga0466969_0013317 3300044656 Bacteria 4331
185 Ga0466972_0001039 3300044658 Bacteria 13334
186 Ga0466972_0006603 3300044658 Bacteria 5826
187 Ga0466965_0005703 3300044683 Bacteria 5616
188 Ga0466966_0066790 3300044684 Bacteria 2259
189 Ga0466961_0047574 3300044693 Bacteria 2742
190 Ga0466961_0071848 3300044693 Bacteria 2195
191 Ga0466961_0174656 3300044693 Bacteria 1335
192 Ga0466963_0002273 3300044694 Bacteria 10673
193 Ga0466964_0020755 3300044706 Bacteria 2532
194 Ga0453684_0008697 3300044712 Bacteria 18059
195 Ga0453684_0030271 3300044712 Bacteria 7653
196 Ga0466971_0050975 3300044719 Bacteria 1862
197 Ga0466970_0013279 3300044765 Bacteria 4221
198 Ga0466959_0000197 3300045049 Bacteria 39640
199 Ga0466959_0043460 3300045049 Bacteria 3312
200 Ga0451576_0065465 3300045051 Bacteria 3784
201 Ga0451576_0318744 3300045051 Bacteria 1627
202 Ga0451576_0442951 3300045051 Bacteria 1363
203 Ga0466967_0082490 3300045976 Bacteria 2905
204 Ga0495592_0000145 3300046454 Bacteria 62850
205 Ga0495632_0009866 3300046519 Bacteria 5710
206 Ga0495632_0027994 3300046519 Bacteria 2944
207 Ga0495645_0013857 3300046543 Bacteria 5715
208 Ga0495625_0035048 3300046660 Bacteria 3701
209 Ga0495624_0048260 3300046690 Bacteria 2703
210 Ga0495649_0016275 3300046694 Bacteria 4216
211 Ga0495660_0050618 3300046810 Bacteria 2262
212 Ga0495687_001992 3300047443 Bacteria 17348
213 Ga0495687_012487 3300047443 Bacteria 4486
214 Ga0495687_013191 3300047443 Bacteria 4325
215 Ga0496102_0077260 3300048905 Bacteria 3064
216 Ga0496103_0075523 3300048906 Bacteria 2114
217 Ga0496107_0188500 3300048910 Bacteria 1532
218 Ga0496112_0362344 3300048915 Bacteria 1392
219 Ga0501047_0112563 3300049581 Bacteria 2604
220 Ga0501211_001515 3300049658 Bacteria 2488
221 Ga0501221_000227 3300049704 Bacteria 8057
222 Ga0501229_002005 3300049706 Bacteria 2392
223 nmdc:mga03683_13182_c1 3300050489 Bacteria 3036
224 nmdc:mga00v17_36808_c1 3300050491 Bacteria 2919
225 nmdc:mga0yw44_32996_c1 3300050492 Bacteria 3021
226 nmdc:mga0k408_146058_c1 3300050493 Bacteria 1408
227 nmdc:mga0k408_29244_c1 3300050493 Bacteria 3136
228 nmdc:mga0k408_31269_c2 3300050493 Bacteria 2089
229 nmdc:mga0k408_4153_c1 3300050493 Bacteria 7690
230 nmdc:mga0k408_6734_c1 3300050493 Bacteria 6130
231 nmdc:mga0k408_7545_c1 3300050493 Bacteria 5810
232 nmdc:mga0k408_7844_c1 3300050493 Bacteria 5709
233 nmdc:mga06z11_70817_c1 3300050494 Bacteria 1844
234 nmdc:mga07m45_11786_c1 3300050496 Bacteria 4602
235 nmdc:mga07m45_16713_c1 3300050496 Bacteria 3930
236 nmdc:mga07m45_3213_c1 3300050496 Bacteria 7839
237 nmdc:mga07m45_34888_c1 3300050496 Bacteria 2797
238 nmdc:mga07m45_6636_c1 3300050496 Bacteria 3945
239 nmdc:mga07m45_6934_c1 3300050496 Bacteria 5763
240 nmdc:mga07m45_8791_c1 3300050496 Bacteria 5207
241 nmdc:mga07m45_9371_c1 3300050496 Bacteria 5077
242 nmdc:mga09592_22946_c1 3300050508 Bacteria 5149
243 nmdc:mga0n895_240284_c1 3300050512 Bacteria 1838
244 nmdc:mga08x19_23043_c1 3300050514 Bacteria 3861
245 nmdc:mga0a205_42228_c1 3300050515 Bacteria 4393
246 Ga0500578_0085248 3300053086 Bacteria 2007
247 Ga0500644_0014861 3300053088 Bacteria 2206
248 Ga0500651_0012909 3300053093 Bacteria 5075
249 Ga0500650_0074056 3300053098 Bacteria 1592
250 Ga0500628_001689 3300053129 Bacteria 3729
251 Ga0500652_000630 3300053131 Bacteria 12093
252 Ga0500655_010612 3300053133 Bacteria 1664
253 Ga0500559_0000107 3300053136 Bacteria 65560
254 Ga0500622_0003559 3300053156 Bacteria 10296
255 Ga0500622_0034687 3300053156 Bacteria 2642
256 Ga0500587_003639 3300053739 Bacteria 2143

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_16713_c1 nmdc:mga07m45_16713_c1_1554_2588 269
2 3300026121 Ga0207683_10034605 Ga0207683_100346052 277
3 3300039447 Ga0436361_0694787 Ga0436361_0694787_18750_19649 278
4 3300042134 Ga0450898_002163 Ga0450898_002163_1507_2553 297
5 3300042435 Ga0439434_0031687 Ga0439434_0031687_27_1046 299
6 3300049581 Ga0501047_0112563 Ga0501047_0112563_241_1239 311
7 iso_pu_bacteria 2585428057 2587725442 311
8 iso_pu_bacteria 2585428058 2587737027 311
9 iso_pu_bacteria 2588253510 2588294317 311
10 iso_pu_bacteria 2643221585 2643933825 311
11 iso_pu_bacteria 2643221592 2643968563 311
12 iso_pu_bacteria 2643221625 2644140645 311
13 iso_pu_bacteria 2643221639 2644218822 311
14 iso_pu_bacteria 2643221648 2644272835 311
15 iso_pu_bacteria 2643221656 2644315319 311
16 3300005457 Ga0070662_100009371 Ga0070662_1000093715 313
17 3300042876 Ga0451577_0000031 Ga0451577_0000031_327252_328259 314
18 3300044712 Ga0453684_0008697 Ga0453684_0008697_6708_7715 314
19 iso_pu_bacteria 8057160832 8057163825 314
20 3300003322 rootL2_10025756 rootL2_100257563 315
21 3300005445 Ga0070708_100160327 Ga0070708_1001603272 315
22 3300005459 Ga0068867_100048785 Ga0068867_1000487852 315
23 3300005467 Ga0070706_100280846 Ga0070706_1002808462 315
24 3300005577 Ga0068857_100015430 Ga0068857_1000154305 315
25 3300006038 Ga0075365_10005572 Ga0075365_100055722 315
26 3300006038 Ga0075365_10027973 Ga0075365_100279733 315
27 3300006042 Ga0075368_10009936 Ga0075368_100099362 315
28 3300006048 Ga0075363_100010376 Ga0075363_1000103763 315
29 3300006048 Ga0075363_100083347 Ga0075363_1000833472 315
30 3300006173 Ga0070716_100059268 Ga0070716_1000592682 315
31 3300006177 Ga0075362_10012181 Ga0075362_100121814 315
32 3300006178 Ga0075367_10006653 Ga0075367_100066535 315
33 3300006353 Ga0075370_10015296 Ga0075370_100152963 315
34 3300006880 Ga0075429_100007851 Ga0075429_1000078517 315
35 3300009093 Ga0105240_10013307 Ga0105240_100133077 315
36 3300009093 Ga0105240_10035441 Ga0105240_100354415 315
37 3300009148 Ga0105243_10000919 Ga0105243_1000091915 315
38 3300009148 Ga0105243_10015671 Ga0105243_100156715 315
39 3300009148 Ga0105243_10064536 Ga0105243_100645362 315
40 3300009148 Ga0105243_10197919 Ga0105243_101979192 315
41 3300009545 Ga0105237_10003357 Ga0105237_100033578 315
42 3300009551 Ga0105238_10030082 Ga0105238_100300824 315
43 3300009551 Ga0105238_10054287 Ga0105238_100542872 315
44 3300010375 Ga0105239_10003475 Ga0105239_100034755 315
45 3300013104 Ga0157370_10023081 Ga0157370_100230812 315
46 3300013308 Ga0157375_10467457 Ga0157375_104674571 315
47 3300014745 Ga0157377_10000104 Ga0157377_1000010439 315
48 3300014745 Ga0157377_10000546 Ga0157377_1000054612 315
49 3300025304 Ga0209257_1024437 Ga0209257_10244372 315
50 3300025898 Ga0207692_10017293 Ga0207692_100172932 315
51 3300025910 Ga0207684_10188210 Ga0207684_101882102 315
52 3300025913 Ga0207695_10209599 Ga0207695_102095992 315
53 3300025914 Ga0207671_10036894 Ga0207671_100368944 315
54 3300025915 Ga0207693_10008099 Ga0207693_100080993 315
55 3300025916 Ga0207663_10061390 Ga0207663_100613902 315
56 3300025919 Ga0207657_10026339 Ga0207657_100263393 315
57 3300025929 Ga0207664_10004507 Ga0207664_100045073 315
58 3300025933 Ga0207706_10172358 Ga0207706_101723582 315
59 3300025933 Ga0207706_10206469 Ga0207706_102064692 315
60 3300025939 Ga0207665_10015084 Ga0207665_100150843 315
61 3300025944 Ga0207661_10123983 Ga0207661_101239832 315
62 3300025961 Ga0207712_10459618 Ga0207712_104596181 315
63 3300026023 Ga0207677_10271385 Ga0207677_102713851 315
64 3300026067 Ga0207678_10045301 Ga0207678_100453013 315
65 3300026116 Ga0207674_10055677 Ga0207674_100556772 315
66 3300026116 Ga0207674_10075962 Ga0207674_100759622 315
67 3300026142 Ga0207698_10121095 Ga0207698_101210952 315
68 3300027866 Ga0209813_10053953 Ga0209813_100539531 315
69 3300028786 Ga0307517_10184892 Ga0307517_101848921 315
70 3300031250 Ga0265331_10003373 Ga0265331_100033732 315
71 3300031251 Ga0265327_10000020 Ga0265327_10000020334 315
72 3300031616 Ga0307508_10005377 Ga0307508_100053774 315
73 3300031730 Ga0307516_10092122 Ga0307516_100921222 315
74 3300035170 Ga0373943_0030701 Ga0373943_0030701_170_1180 315
75 3300035410 Ga0373924_0005011 Ga0373924_0005011_1748_2758 315
76 3300035691 Ga0373931_0021283 Ga0373931_0021283_313_1323 315
77 3300035695 Ga0373927_0109513 Ga0373927_0109513_356_1366 315
78 3300035725 Ga0373947_0059601 Ga0373947_0059601_376_1386 315
79 3300037418 Ga0395900_0017145 Ga0395900_0017145_6276_7286 315
80 3300037471 Ga0395905_0025365 Ga0395905_0025365_853_1863 315
81 3300042007 Ga0439449_0000524 Ga0439449_0000524_9205_10215 315
82 3300042115 Ga0450911_005505 Ga0450911_005505_129_1139 315
83 3300042121 Ga0450919_000919 Ga0450919_000919_562_1572 315
84 3300042531 Ga0450918_000028 Ga0450918_000028_7738_8748 315
85 3300044656 Ga0466969_0013317 Ga0466969_0013317_1972_2982 315
86 3300044658 Ga0466972_0001039 Ga0466972_0001039_4286_5296 315
87 3300044693 Ga0466961_0047574 Ga0466961_0047574_659_1669 315
88 3300044693 Ga0466961_0174656 Ga0466961_0174656_222_1232 315
89 3300044712 Ga0453684_0030271 Ga0453684_0030271_5944_6963 315
90 3300045049 Ga0466959_0043460 Ga0466959_0043460_2173_3183 315
91 3300045051 Ga0451576_0318744 Ga0451576_0318744_484_1494 315
92 3300046454 Ga0495592_0000145 Ga0495592_0000145_48986_49996 315
93 3300046519 Ga0495632_0027994 Ga0495632_0027994_917_1936 315
94 3300046543 Ga0495645_0013857 Ga0495645_0013857_4480_5490 315
95 3300046660 Ga0495625_0035048 Ga0495625_0035048_1758_2768 315
96 3300046690 Ga0495624_0048260 Ga0495624_0048260_1439_2449 315
97 3300046694 Ga0495649_0016275 Ga0495649_0016275_2821_3840 315
98 3300046810 Ga0495660_0050618 Ga0495660_0050618_105_1124 315
99 3300047443 Ga0495687_001992 Ga0495687_001992_13397_14407 315
100 3300047443 Ga0495687_012487 Ga0495687_012487_3108_4127 315
101 3300047443 Ga0495687_013191 Ga0495687_013191_2956_3966 315
102 3300048905 Ga0496102_0077260 Ga0496102_0077260_606_1616 315
103 3300048906 Ga0496103_0075523 Ga0496103_0075523_791_1801 315
104 3300048910 Ga0496107_0188500 Ga0496107_0188500_418_1428 315
105 3300048915 Ga0496112_0362344 Ga0496112_0362344_42_1052 315
106 3300050489 nmdc:mga03683_13182_c1 nmdc:mga03683_13182_c1_1937_2947 315
107 3300050491 nmdc:mga00v17_36808_c1 nmdc:mga00v17_36808_c1_1018_2028 315
108 3300050492 nmdc:mga0yw44_32996_c1 nmdc:mga0yw44_32996_c1_122_1132 315
109 3300050493 nmdc:mga0k408_146058_c1 nmdc:mga0k408_146058_c1_193_1203 315
110 3300050493 nmdc:mga0k408_29244_c1 nmdc:mga0k408_29244_c1_806_1816 315
111 3300050493 nmdc:mga0k408_4153_c1 nmdc:mga0k408_4153_c1_3723_4733 315
112 3300050493 nmdc:mga0k408_6734_c1 nmdc:mga0k408_6734_c1_1867_2877 315
113 3300050493 nmdc:mga0k408_7545_c1 nmdc:mga0k408_7545_c1_2956_3966 315
114 3300050493 nmdc:mga0k408_7844_c1 nmdc:mga0k408_7844_c1_2147_3157 315
115 3300050496 nmdc:mga07m45_11786_c1 nmdc:mga07m45_11786_c1_1361_2371 315
116 3300050496 nmdc:mga07m45_3213_c1 nmdc:mga07m45_3213_c1_2428_3438 315
117 3300050496 nmdc:mga07m45_6636_c1 nmdc:mga07m45_6636_c1_632_1642 315
118 3300050496 nmdc:mga07m45_6934_c1 nmdc:mga07m45_6934_c1_2961_3971 315
119 3300050496 nmdc:mga07m45_8791_c1 nmdc:mga07m45_8791_c1_2961_3971 315
120 3300050508 nmdc:mga09592_22946_c1 nmdc:mga09592_22946_c1_2702_3712 315
121 3300053086 Ga0500578_0085248 Ga0500578_0085248_284_1294 315
122 3300053098 Ga0500650_0074056 Ga0500650_0074056_275_1285 315
123 3300053136 Ga0500559_0000107 Ga0500559_0000107_55266_56276 315
124 3300053156 Ga0500622_0034687 Ga0500622_0034687_875_1885 315
125 3300053739 Ga0500587_003639 Ga0500587_003639_961_1971 315
126 iso_pu_bacteria 2643221544 2643746732 315
127 iso_pu_bacteria 3007866637 3007867657 315
128 3300025273 Ga0209673_1038628 Ga0209673_10386281 317
129 3300025303 Ga0209051_1000833 Ga0209051_100083325 317
130 3300025304 Ga0209257_1000161 Ga0209257_10001615 317
131 3300025909 Ga0207705_10153313 Ga0207705_101533132 317
132 3300042138 Ga0450903_004970 Ga0450903_004970_139_1158 317
133 3300042144 Ga0450889_004449 Ga0450889_004449_77_1096 317
134 3300042439 Ga0439464_0001135 Ga0439464_0001135_3773_4792 317
135 3300045051 Ga0451576_0065465 Ga0451576_0065465_1067_2086 317
136 3300025933 Ga0207706_10002795 Ga0207706_100027953 318
137 3300031456 Ga0307513_10151172 Ga0307513_101511722 318
138 3300003316 rootH1_10064001 rootH1_100640012 319
139 3300003759 Ga0055525_1000222 Ga0055525_100022211 319
140 3300003794 Ga0055531_10000513 Ga0055531_1000051318 319
141 3300005337 Ga0070682_100066693 Ga0070682_1000666932 319
142 3300005345 Ga0070692_10063324 Ga0070692_100633241 319
143 3300005367 Ga0070667_100008719 Ga0070667_1000087192 319
144 3300005367 Ga0070667_100180260 Ga0070667_1001802602 319
145 3300005434 Ga0070709_10001056 Ga0070709_100010564 319
146 3300005435 Ga0070714_100002565 Ga0070714_1000025658 319
147 3300005437 Ga0070710_10044630 Ga0070710_100446302 319
148 3300005440 Ga0070705_100129532 Ga0070705_1001295322 319
149 3300005445 Ga0070708_100133485 Ga0070708_1001334852 319
150 3300005457 Ga0070662_100086508 Ga0070662_1000865082 319
151 3300005457 Ga0070662_100148132 Ga0070662_1001481322 319
152 3300005468 Ga0070707_100100654 Ga0070707_1001006542 319
153 3300005471 Ga0070698_100206605 Ga0070698_1002066052 319
154 3300005518 Ga0070699_100077303 Ga0070699_1000773033 319
155 3300005530 Ga0070679_100131520 Ga0070679_1001315201 319
156 3300005536 Ga0070697_100027990 Ga0070697_1000279902 319
157 3300005549 Ga0070704_100018299 Ga0070704_1000182994 319
158 3300006852 Ga0075433_10036728 Ga0075433_100367284 319
159 3300006871 Ga0075434_100071949 Ga0075434_1000719493 319
160 3300006914 Ga0075436_100008551 Ga0075436_1000085512 319
161 3300007076 Ga0075435_100022703 Ga0075435_1000227032 319
162 3300021361 Ga0213872_10000045 Ga0213872_100000457 319
163 3300021361 Ga0213872_10001196 Ga0213872_1000119611 319
164 3300025230 Ga0209563_100088 Ga0209563_100088121 319
165 3300025298 Ga0209050_1006687 Ga0209050_10066876 319
166 3300025304 Ga0209257_1001107 Ga0209257_100110718 319
167 3300025913 Ga0207695_10013742 Ga0207695_100137423 319
168 3300025922 Ga0207646_10001282 Ga0207646_1000128212 319
169 3300025933 Ga0207706_10002534 Ga0207706_1000253413 319
170 3300025935 Ga0207709_10008364 Ga0207709_100083642 319
171 3300025935 Ga0207709_10078363 Ga0207709_100783632 319
172 3300025938 Ga0207704_10214226 Ga0207704_102142262 319
173 3300025939 Ga0207665_10143701 Ga0207665_101437011 319
174 3300025986 Ga0207658_10001310 Ga0207658_1000131015 319
175 3300026089 Ga0207648_10003157 Ga0207648_100031576 319
176 3300026142 Ga0207698_10038392 Ga0207698_100383923 319
177 3300028379 Ga0268266_10241065 Ga0268266_102410652 319
178 3300028786 Ga0307517_10004774 Ga0307517_1000477411 319
179 3300028786 Ga0307517_10081549 Ga0307517_100815493 319
180 3300028794 Ga0307515_10000093 Ga0307515_1000009378 319
181 3300028794 Ga0307515_10000110 Ga0307515_1000011096 319
182 3300028794 Ga0307515_10000521 Ga0307515_1000052173 319
183 3300028794 Ga0307515_10014947 Ga0307515_100149476 319
184 3300028794 Ga0307515_10020162 Ga0307515_1002016212 319
185 3300028794 Ga0307515_10026895 Ga0307515_1002689510 319
186 3300028794 Ga0307515_10071573 Ga0307515_100715734 319
187 3300028794 Ga0307515_10110938 Ga0307515_101109383 319
188 3300031507 Ga0307509_10001461 Ga0307509_1000146112 319
189 3300031507 Ga0307509_10008460 Ga0307509_100084603 319
190 3300031507 Ga0307509_10064531 Ga0307509_100645313 319
191 3300031507 Ga0307509_10069865 Ga0307509_100698652 319
192 3300031507 Ga0307509_10071888 Ga0307509_100718884 319
193 3300031507 Ga0307509_10077041 Ga0307509_100770414 319
194 3300031616 Ga0307508_10000150 Ga0307508_1000015012 319
195 3300031616 Ga0307508_10003770 Ga0307508_100037709 319
196 3300031616 Ga0307508_10012427 Ga0307508_100124278 319
197 3300031616 Ga0307508_10095975 Ga0307508_100959752 319
198 3300031649 Ga0307514_10000780 Ga0307514_100007805 319
199 3300031649 Ga0307514_10003863 Ga0307514_100038636 319
200 3300031649 Ga0307514_10006326 Ga0307514_100063264 319
201 3300031649 Ga0307514_10097720 Ga0307514_100977202 319
202 3300031730 Ga0307516_10164842 Ga0307516_101648422 319
203 3300031995 Ga0307409_100168679 Ga0307409_1001686792 319
204 3300032005 Ga0307411_10000368 Ga0307411_1000036813 319
205 3300033179 Ga0307507_10029743 Ga0307507_100297432 319
206 3300033179 Ga0307507_10053118 Ga0307507_100531182 319
207 3300033180 Ga0307510_10000360 Ga0307510_1000036034 319
208 3300033180 Ga0307510_10013533 Ga0307510_100135333 319
209 3300033180 Ga0307510_10078519 Ga0307510_100785193 319
210 3300033180 Ga0307510_10099867 Ga0307510_100998672 319
211 3300033180 Ga0307510_10128302 Ga0307510_101283022 319
212 3300033180 Ga0307510_10240009 Ga0307510_102400092 319
213 3300037471 Ga0395905_0002635 Ga0395905_0002635_16336_17358 319
214 3300037471 Ga0395905_0009501 Ga0395905_0009501_4720_5751 319
215 3300039447 Ga0436361_0224989 Ga0436361_0224989_817_1851 319
216 3300042116 Ga0450912_001836 Ga0450912_001836_187_1209 319
217 3300042126 Ga0450888_000044 Ga0450888_000044_5231_6253 319
218 3300042127 Ga0450890_001995 Ga0450890_001995_1680_2702 319
219 3300042129 Ga0450891_000948 Ga0450891_000948_306_1328 319
220 3300044683 Ga0466965_0005703 Ga0466965_0005703_4007_5032 319
221 3300044684 Ga0466966_0066790 Ga0466966_0066790_396_1421 319
222 3300044693 Ga0466961_0071848 Ga0466961_0071848_332_1357 319
223 3300044694 Ga0466963_0002273 Ga0466963_0002273_2958_3983 319
224 3300044706 Ga0466964_0020755 Ga0466964_0020755_346_1371 319
225 3300044719 Ga0466971_0050975 Ga0466971_0050975_331_1356 319
226 3300044765 Ga0466970_0013279 Ga0466970_0013279_748_1773 319
227 3300045049 Ga0466959_0000197 Ga0466959_0000197_9597_10622 319
228 3300045976 Ga0466967_0082490 Ga0466967_0082490_945_1970 319
229 3300049658 Ga0501211_001515 Ga0501211_001515_444_1466 319
230 3300049704 Ga0501221_000227 Ga0501221_000227_2933_3955 319
231 3300049706 Ga0501229_002005 Ga0501229_002005_900_1922 319
232 3300050512 nmdc:mga0n895_240284_c1 nmdc:mga0n895_240284_c1_507_1529 319
233 3300050514 nmdc:mga08x19_23043_c1 nmdc:mga08x19_23043_c1_2036_3058 319
234 3300050515 nmdc:mga0a205_42228_c1 nmdc:mga0a205_42228_c1_2868_3890 319
235 3300003791 Ga0055530_10011803 Ga0055530_100118033 324
236 3300025298 Ga0209050_1000706 Ga0209050_100070638 324
237 3300045051 Ga0451576_0442951 Ga0451576_0442951_145_1182 324
238 3300002773 JGI25152J39213_1003717 JGI25152J39213_10037175 325
239 3300003215 JGI25153J46596_10001057 JGI25153J46596_100010572 325
240 3300003215 JGI25153J46596_10004755 JGI25153J46596_100047553 325
241 3300003771 Ga0055526_1005017 Ga0055526_10050172 325
242 3300005459 Ga0068867_100000083 Ga0068867_10000008315 325
243 3300025245 Ga0207425_1001190 Ga0207425_10011907 325
244 3300025258 Ga0209129_1000481 Ga0209129_100048125 325
245 3300025273 Ga0209673_1005064 Ga0209673_10050644 325
246 3300025273 Ga0209673_1029679 Ga0209673_10296792 325
247 3300025295 Ga0209564_1001182 Ga0209564_100118225 325
248 3300025297 Ga0209758_1000859 Ga0209758_100085939 325
249 3300025297 Ga0209758_1001201 Ga0209758_100120125 325
250 3300025299 Ga0209256_1036066 Ga0209256_10360662 325
251 3300025935 Ga0207709_10000675 Ga0207709_1000067515 325
252 3300026089 Ga0207648_10000243 Ga0207648_1000024339 325
253 3300026142 Ga0207698_10032612 Ga0207698_100326123 325
254 3300028786 Ga0307517_10100404 Ga0307517_101004042 325
255 3300031730 Ga0307516_10273970 Ga0307516_102739702 325
256 3300037471 Ga0395905_0002906 Ga0395905_0002906_852_1940 325
257 3300044658 Ga0466972_0006603 Ga0466972_0006603_1378_2418 325
258 3300046519 Ga0495632_0009866 Ga0495632_0009866_3049_4089 325
259 3300050493 nmdc:mga0k408_31269_c2 nmdc:mga0k408_31269_c2_527_1567 325
260 3300050494 nmdc:mga06z11_70817_c1 nmdc:mga06z11_70817_c1_762_1802 325
261 3300050496 nmdc:mga07m45_34888_c1 nmdc:mga07m45_34888_c1_243_1289 325
262 3300050496 nmdc:mga07m45_9371_c1 nmdc:mga07m45_9371_c1_3359_4399 325
263 3300053088 Ga0500644_0014861 Ga0500644_0014861_487_1527 325
264 3300053093 Ga0500651_0012909 Ga0500651_0012909_3270_4310 325
265 3300053129 Ga0500628_001689 Ga0500628_001689_2635_3675 325
266 3300053131 Ga0500652_000630 Ga0500652_000630_10083_11123 325
267 3300053133 Ga0500655_010612 Ga0500655_010612_307_1347 325
268 3300053156 Ga0500622_0003559 Ga0500622_0003559_6056_7096 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

56

179

0.96

PF01380

SIS

SIS domain

219

310

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fj1-assembly2.cif.gz_C crystal structure of putative phosphosugar isomerase (yp_167080.1) from silicibacter pomeroyi dss-3 at 1.75 a resolution 0.9306 9 313
7kqa-assembly1.cif.gz_B crystal structure of glucosamine-6-phosphate deanimase from strenotrophomonas maltophilia 0.9122 8 321
8fdb-assembly1.cif.gz_B crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. 0.8938 8 325
7kqa-assembly1.cif.gz_B crystal structure of glucosamine-6-phosphate deanimase from strenotrophomonas maltophilia 0.8798 8 321
7dnr-assembly1.cif.gz_B crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. coli 0.875 11 313
ID Description Score Start End Superfamily
3fj1C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9135 10 171 3.40.50.10490
3hbaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.901 183 309 3.40.50.10490
3hbaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8827 10 175 3.40.50.10490
3euaH03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.882 188 275 3.40.50.12570
af_Q19699_551_710_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8789 178 325 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A326KCL7-F1-model_v4 deleted 0.9589 8 129
AF-A0A6L8CZQ2-F1-model_v4 deleted 0.9466 12 325
AF-A0A529Y4G8-F1-model_v4 SIS domain-containing protein 0.9442 5 142 GO:0008483
GO:0097367
GO:1901135
AF-A0A4R7WZ33-F1-model_v4 deleted 0.9428 9 325
AF-A0A525I6I2-F1-model_v4 SIS domain-containing protein 0.9421 9 325 GO:0008483
GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
88.81 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map