F375655
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 178 | 256 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0002906|Ga0395905_0002906_852_1940 |
| Length | 362 |
| Sequence | MPTWSFSHRICNSRQFTPKEKSLNSLMLDEARSAPECVAIQMKSDADLYAEASAYLRAADPASVVTVARGSSDHAASFFAYLSALRGGRLVSSLPMSLLTLHHAPLRFNAACAVAISQSGRSPDLCTVMSQFHAGGAATLALINDVSSPLTQSVHHALPLNAGAERSVAATKSFICSVVGGARLLGEWFHDADLLRALHELPQSLHSACLKDWSAAIDVLKDADRVMIIGRGTGLAIAQEAALKLKETCAIQAEAFSSAEVRHGPMALVEPGYPMLVFAPRGPAQPDLLNLARDMRSRGASVLLAASADVGDRQLTLAPTLLSELDPIAAIQSFYPMVEALARARGTDPDRPRHLSKVTSTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 5 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 6 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 9 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 10 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 11 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 39 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 59 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 95 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 96 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 98 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 99 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 100 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 101 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 108 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 111 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 115 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 116 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 117 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 118 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 119 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 120 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 121 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 122 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 123 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 124 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 125 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 126 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 127 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 130 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 131 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 132 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 133 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 134 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 135 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 136 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 137 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 138 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 139 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 151 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 156 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 157 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 158 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 159 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 160 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 162 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 163 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 164 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 169 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 170 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 171 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 172 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 173 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 174 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 175 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 176 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 177 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 178 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.52 |
| Metatranscriptomes | 0 |
| Isolates | 4.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.13 |
| Nodule | 0 |
| Rhizoplane | 1.49 |
| Rhizosphere | 57.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1003717 | 3300002773 | Bacteria | 5109 |
| 2 | JGI25153J46596_10001057 | 3300003215 | Bacteria | 16789 |
| 3 | JGI25153J46596_10004755 | 3300003215 | Bacteria | 7235 |
| 4 | rootH1_10064001 | 3300003316 | Bacteria | 2639 |
| 5 | rootL2_10025756 | 3300003322 | Bacteria | 4016 |
| 6 | Ga0055525_1000222 | 3300003759 | Bacteria | 61500 |
| 7 | Ga0055526_1005017 | 3300003771 | Bacteria | 7744 |
| 8 | Ga0055530_10011803 | 3300003791 | Bacteria | 3102 |
| 9 | Ga0055531_10000513 | 3300003794 | Bacteria | 34951 |
| 10 | Ga0070682_100066693 | 3300005337 | Bacteria | 2290 |
| 11 | Ga0070692_10063324 | 3300005345 | Bacteria | 1953 |
| 12 | Ga0070667_100008719 | 3300005367 | Bacteria | 8406 |
| 13 | Ga0070667_100180260 | 3300005367 | Bacteria | 1868 |
| 14 | Ga0070709_10001056 | 3300005434 | Bacteria | 15203 |
| 15 | Ga0070714_100002565 | 3300005435 | Bacteria | 13384 |
| 16 | Ga0070710_10044630 | 3300005437 | Bacteria | 2460 |
| 17 | Ga0070705_100129532 | 3300005440 | Bacteria | 1643 |
| 18 | Ga0070708_100133485 | 3300005445 | Bacteria | 2299 |
| 19 | Ga0070708_100160327 | 3300005445 | Bacteria | 2096 |
| 20 | Ga0070662_100009371 | 3300005457 | Bacteria | 6399 |
| 21 | Ga0070662_100086508 | 3300005457 | Bacteria | 2344 |
| 22 | Ga0070662_100148132 | 3300005457 | Bacteria | 1825 |
| 23 | Ga0068867_100000083 | 3300005459 | Bacteria | 58784 |
| 24 | Ga0068867_100048785 | 3300005459 | Bacteria | 3116 |
| 25 | Ga0070706_100280846 | 3300005467 | Bacteria | 1554 |
| 26 | Ga0070707_100100654 | 3300005468 | Bacteria | 2800 |
| 27 | Ga0070698_100206605 | 3300005471 | Bacteria | 1899 |
| 28 | Ga0070699_100077303 | 3300005518 | Bacteria | 2897 |
| 29 | Ga0070679_100131520 | 3300005530 | Bacteria | 2483 |
| 30 | Ga0070697_100027990 | 3300005536 | Bacteria | 4511 |
| 31 | Ga0070704_100018299 | 3300005549 | Bacteria | 4477 |
| 32 | Ga0068857_100015430 | 3300005577 | Bacteria | 6671 |
| 33 | Ga0075365_10005572 | 3300006038 | Bacteria | 6805 |
| 34 | Ga0075365_10027973 | 3300006038 | Bacteria | 3591 |
| 35 | Ga0075368_10009936 | 3300006042 | Bacteria | 3432 |
| 36 | Ga0075363_100010376 | 3300006048 | Bacteria | 4420 |
| 37 | Ga0075363_100083347 | 3300006048 | Bacteria | 1752 |
| 38 | Ga0070716_100059268 | 3300006173 | Bacteria | 2206 |
| 39 | Ga0075362_10012181 | 3300006177 | Bacteria | 3410 |
| 40 | Ga0075367_10006653 | 3300006178 | Bacteria | 5860 |
| 41 | Ga0075370_10015296 | 3300006353 | Bacteria | 4105 |
| 42 | Ga0075433_10036728 | 3300006852 | Bacteria | 4222 |
| 43 | Ga0075434_100071949 | 3300006871 | Bacteria | 3450 |
| 44 | Ga0075429_100007851 | 3300006880 | Bacteria | 9269 |
| 45 | Ga0075436_100008551 | 3300006914 | Bacteria | 6997 |
| 46 | Ga0075435_100022703 | 3300007076 | Bacteria | 4842 |
| 47 | Ga0105240_10013307 | 3300009093 | Bacteria | 11309 |
| 48 | Ga0105240_10035441 | 3300009093 | Bacteria | 6430 |
| 49 | Ga0105243_10000919 | 3300009148 | Bacteria | 27591 |
| 50 | Ga0105243_10015671 | 3300009148 | Bacteria | 5731 |
| 51 | Ga0105243_10064536 | 3300009148 | Bacteria | 2939 |
| 52 | Ga0105243_10197919 | 3300009148 | Bacteria | 1760 |
| 53 | Ga0105237_10003357 | 3300009545 | Bacteria | 19066 |
| 54 | Ga0105238_10030082 | 3300009551 | Bacteria | 5527 |
| 55 | Ga0105238_10054287 | 3300009551 | Bacteria | 4024 |
| 56 | Ga0105239_10003475 | 3300010375 | Bacteria | 19275 |
| 57 | Ga0157370_10023081 | 3300013104 | Bacteria | 6184 |
| 58 | Ga0157375_10467457 | 3300013308 | Bacteria | 1427 |
| 59 | Ga0157377_10000104 | 3300014745 | Bacteria | 58794 |
| 60 | Ga0157377_10000546 | 3300014745 | Bacteria | 15869 |
| 61 | Ga0213872_10000045 | 3300021361 | Bacteria | 112229 |
| 62 | Ga0213872_10001196 | 3300021361 | Bacteria | 17590 |
| 63 | Ga0209563_100088 | 3300025230 | Bacteria | 175375 |
| 64 | Ga0207425_1001190 | 3300025245 | Bacteria | 11583 |
| 65 | Ga0209129_1000481 | 3300025258 | Bacteria | 29172 |
| 66 | Ga0209673_1005064 | 3300025273 | Bacteria | 6783 |
| 67 | Ga0209673_1029679 | 3300025273 | Bacteria | 1737 |
| 68 | Ga0209673_1038628 | 3300025273 | Bacteria | 1387 |
| 69 | Ga0209564_1001182 | 3300025295 | Bacteria | 30216 |
| 70 | Ga0209758_1000859 | 3300025297 | Bacteria | 42074 |
| 71 | Ga0209758_1001201 | 3300025297 | Bacteria | 32708 |
| 72 | Ga0209050_1000706 | 3300025298 | Bacteria | 49523 |
| 73 | Ga0209050_1006687 | 3300025298 | Bacteria | 6748 |
| 74 | Ga0209256_1036066 | 3300025299 | Bacteria | 1300 |
| 75 | Ga0209051_1000833 | 3300025303 | Bacteria | 31762 |
| 76 | Ga0209257_1000161 | 3300025304 | Bacteria | 176089 |
| 77 | Ga0209257_1001107 | 3300025304 | Bacteria | 35003 |
| 78 | Ga0209257_1024437 | 3300025304 | Bacteria | 2092 |
| 79 | Ga0207692_10017293 | 3300025898 | Bacteria | 3214 |
| 80 | Ga0207705_10153313 | 3300025909 | Bacteria | 1727 |
| 81 | Ga0207684_10188210 | 3300025910 | Bacteria | 1780 |
| 82 | Ga0207695_10013742 | 3300025913 | Bacteria | 9633 |
| 83 | Ga0207695_10209599 | 3300025913 | Bacteria | 1860 |
| 84 | Ga0207671_10036894 | 3300025914 | Bacteria | 3625 |
| 85 | Ga0207693_10008099 | 3300025915 | Bacteria | 8621 |
| 86 | Ga0207663_10061390 | 3300025916 | Bacteria | 2385 |
| 87 | Ga0207657_10026339 | 3300025919 | Bacteria | 5345 |
| 88 | Ga0207646_10001282 | 3300025922 | Bacteria | 31406 |
| 89 | Ga0207664_10004507 | 3300025929 | Bacteria | 9438 |
| 90 | Ga0207706_10002534 | 3300025933 | Bacteria | 17812 |
| 91 | Ga0207706_10002795 | 3300025933 | Bacteria | 16962 |
| 92 | Ga0207706_10172358 | 3300025933 | Bacteria | 1901 |
| 93 | Ga0207706_10206469 | 3300025933 | Bacteria | 1722 |
| 94 | Ga0207709_10000675 | 3300025935 | Bacteria | 27560 |
| 95 | Ga0207709_10008364 | 3300025935 | Bacteria | 5725 |
| 96 | Ga0207709_10078363 | 3300025935 | Bacteria | 2121 |
| 97 | Ga0207704_10214226 | 3300025938 | Bacteria | 1420 |
| 98 | Ga0207665_10015084 | 3300025939 | Bacteria | 5073 |
| 99 | Ga0207665_10143701 | 3300025939 | Bacteria | 1704 |
| 100 | Ga0207661_10123983 | 3300025944 | Bacteria | 2204 |
| 101 | Ga0207712_10459618 | 3300025961 | Bacteria | 1081 |
| 102 | Ga0207658_10001310 | 3300025986 | Bacteria | 19633 |
| 103 | Ga0207677_10271385 | 3300026023 | Bacteria | 1388 |
| 104 | Ga0207678_10045301 | 3300026067 | Bacteria | 3804 |
| 105 | Ga0207648_10000243 | 3300026089 | Bacteria | 58746 |
| 106 | Ga0207648_10003157 | 3300026089 | Bacteria | 17364 |
| 107 | Ga0207674_10055677 | 3300026116 | Bacteria | 4020 |
| 108 | Ga0207674_10075962 | 3300026116 | Bacteria | 3369 |
| 109 | Ga0207683_10034605 | 3300026121 | Bacteria | 4391 |
| 110 | Ga0207698_10032612 | 3300026142 | Bacteria | 3776 |
| 111 | Ga0207698_10038392 | 3300026142 | Bacteria | 3538 |
| 112 | Ga0207698_10121095 | 3300026142 | Bacteria | 2215 |
| 113 | Ga0209813_10053953 | 3300027866 | Bacteria | 1265 |
| 114 | Ga0268266_10241065 | 3300028379 | Bacteria | 1669 |
| 115 | Ga0307517_10004774 | 3300028786 | Bacteria | 20694 |
| 116 | Ga0307517_10081549 | 3300028786 | Bacteria | 2756 |
| 117 | Ga0307517_10100404 | 3300028786 | Bacteria | 2286 |
| 118 | Ga0307517_10184892 | 3300028786 | Bacteria | 1336 |
| 119 | Ga0307515_10000093 | 3300028794 | Bacteria | 212053 |
| 120 | Ga0307515_10000110 | 3300028794 | Bacteria | 195560 |
| 121 | Ga0307515_10000521 | 3300028794 | Bacteria | 91558 |
| 122 | Ga0307515_10014947 | 3300028794 | Bacteria | 14342 |
| 123 | Ga0307515_10020162 | 3300028794 | Bacteria | 11919 |
| 124 | Ga0307515_10026895 | 3300028794 | Bacteria | 9868 |
| 125 | Ga0307515_10071573 | 3300028794 | Bacteria | 4697 |
| 126 | Ga0307515_10110938 | 3300028794 | Bacteria | 3205 |
| 127 | Ga0265331_10003373 | 3300031250 | Bacteria | 10353 |
| 128 | Ga0265327_10000020 | 3300031251 | Bacteria | 424552 |
| 129 | Ga0307513_10151172 | 3300031456 | Unclassified | 2230 |
| 130 | Ga0307509_10001461 | 3300031507 | Bacteria | 40003 |
| 131 | Ga0307509_10008460 | 3300031507 | Bacteria | 13108 |
| 132 | Ga0307509_10064531 | 3300031507 | Bacteria | 3851 |
| 133 | Ga0307509_10069865 | 3300031507 | Bacteria | 3669 |
| 134 | Ga0307509_10071888 | 3300031507 | Bacteria | 3606 |
| 135 | Ga0307509_10077041 | 3300031507 | Bacteria | 3457 |
| 136 | Ga0307508_10000150 | 3300031616 | Bacteria | 83110 |
| 137 | Ga0307508_10003770 | 3300031616 | Bacteria | 15140 |
| 138 | Ga0307508_10005377 | 3300031616 | Bacteria | 12191 |
| 139 | Ga0307508_10012427 | 3300031616 | Bacteria | 7784 |
| 140 | Ga0307508_10095975 | 3300031616 | Bacteria | 2556 |
| 141 | Ga0307514_10000780 | 3300031649 | Bacteria | 52828 |
| 142 | Ga0307514_10003863 | 3300031649 | Bacteria | 14082 |
| 143 | Ga0307514_10006326 | 3300031649 | Bacteria | 10346 |
| 144 | Ga0307514_10097720 | 3300031649 | Bacteria | 2118 |
| 145 | Ga0307516_10092122 | 3300031730 | Bacteria | 2858 |
| 146 | Ga0307516_10164842 | 3300031730 | Bacteria | 1962 |
| 147 | Ga0307516_10273970 | 3300031730 | Bacteria | 1372 |
| 148 | Ga0307409_100168679 | 3300031995 | Bacteria | 1924 |
| 149 | Ga0307411_10000368 | 3300032005 | Bacteria | 15274 |
| 150 | Ga0307507_10029743 | 3300033179 | Bacteria | 5783 |
| 151 | Ga0307507_10053118 | 3300033179 | Bacteria | 3875 |
| 152 | Ga0307510_10000360 | 3300033180 | Bacteria | 42908 |
| 153 | Ga0307510_10013533 | 3300033180 | Bacteria | 9677 |
| 154 | Ga0307510_10078519 | 3300033180 | Bacteria | 3227 |
| 155 | Ga0307510_10099867 | 3300033180 | Bacteria | 2698 |
| 156 | Ga0307510_10128302 | 3300033180 | Bacteria | 2218 |
| 157 | Ga0307510_10240009 | 3300033180 | Bacteria | 1307 |
| 158 | Ga0373943_0030701 | 3300035170 | Bacteria | 2545 |
| 159 | Ga0373924_0005011 | 3300035410 | Bacteria | 4662 |
| 160 | Ga0373931_0021283 | 3300035691 | Bacteria | 3253 |
| 161 | Ga0373927_0109513 | 3300035695 | Bacteria | 1799 |
| 162 | Ga0373947_0059601 | 3300035725 | Bacteria | 2314 |
| 163 | Ga0395900_0017145 | 3300037418 | Bacteria | 7392 |
| 164 | Ga0395905_0002635 | 3300037471 | Bacteria | 19696 |
| 165 | Ga0395905_0002906 | 3300037471 | Bacteria | 18693 |
| 166 | Ga0395905_0009501 | 3300037471 | Bacteria | 9503 |
| 167 | Ga0395905_0025365 | 3300037471 | Bacteria | 5590 |
| 168 | Ga0436361_0224989 | 3300039447 | Bacteria | 10880 |
| 169 | Ga0436361_0694787 | 3300039447 | Bacteria | 33732 |
| 170 | Ga0439449_0000524 | 3300042007 | Bacteria | 14275 |
| 171 | Ga0450911_005505 | 3300042115 | Bacteria | 1961 |
| 172 | Ga0450912_001836 | 3300042116 | Bacteria | 1355 |
| 173 | Ga0450919_000919 | 3300042121 | Bacteria | 3812 |
| 174 | Ga0450888_000044 | 3300042126 | Bacteria | 8907 |
| 175 | Ga0450890_001995 | 3300042127 | Bacteria | 2878 |
| 176 | Ga0450891_000948 | 3300042129 | Bacteria | 3027 |
| 177 | Ga0450898_002163 | 3300042134 | Bacteria | 2720 |
| 178 | Ga0450903_004970 | 3300042138 | Bacteria | 2240 |
| 179 | Ga0450889_004449 | 3300042144 | Bacteria | 1386 |
| 180 | Ga0439434_0031687 | 3300042435 | Bacteria | 1608 |
| 181 | Ga0439464_0001135 | 3300042439 | Bacteria | 6168 |
| 182 | Ga0450918_000028 | 3300042531 | Bacteria | 30240 |
| 183 | Ga0451577_0000031 | 3300042876 | Bacteria | 388524 |
| 184 | Ga0466969_0013317 | 3300044656 | Bacteria | 4331 |
| 185 | Ga0466972_0001039 | 3300044658 | Bacteria | 13334 |
| 186 | Ga0466972_0006603 | 3300044658 | Bacteria | 5826 |
| 187 | Ga0466965_0005703 | 3300044683 | Bacteria | 5616 |
| 188 | Ga0466966_0066790 | 3300044684 | Bacteria | 2259 |
| 189 | Ga0466961_0047574 | 3300044693 | Bacteria | 2742 |
| 190 | Ga0466961_0071848 | 3300044693 | Bacteria | 2195 |
| 191 | Ga0466961_0174656 | 3300044693 | Bacteria | 1335 |
| 192 | Ga0466963_0002273 | 3300044694 | Bacteria | 10673 |
| 193 | Ga0466964_0020755 | 3300044706 | Bacteria | 2532 |
| 194 | Ga0453684_0008697 | 3300044712 | Bacteria | 18059 |
| 195 | Ga0453684_0030271 | 3300044712 | Bacteria | 7653 |
| 196 | Ga0466971_0050975 | 3300044719 | Bacteria | 1862 |
| 197 | Ga0466970_0013279 | 3300044765 | Bacteria | 4221 |
| 198 | Ga0466959_0000197 | 3300045049 | Bacteria | 39640 |
| 199 | Ga0466959_0043460 | 3300045049 | Bacteria | 3312 |
| 200 | Ga0451576_0065465 | 3300045051 | Bacteria | 3784 |
| 201 | Ga0451576_0318744 | 3300045051 | Bacteria | 1627 |
| 202 | Ga0451576_0442951 | 3300045051 | Bacteria | 1363 |
| 203 | Ga0466967_0082490 | 3300045976 | Bacteria | 2905 |
| 204 | Ga0495592_0000145 | 3300046454 | Bacteria | 62850 |
| 205 | Ga0495632_0009866 | 3300046519 | Bacteria | 5710 |
| 206 | Ga0495632_0027994 | 3300046519 | Bacteria | 2944 |
| 207 | Ga0495645_0013857 | 3300046543 | Bacteria | 5715 |
| 208 | Ga0495625_0035048 | 3300046660 | Bacteria | 3701 |
| 209 | Ga0495624_0048260 | 3300046690 | Bacteria | 2703 |
| 210 | Ga0495649_0016275 | 3300046694 | Bacteria | 4216 |
| 211 | Ga0495660_0050618 | 3300046810 | Bacteria | 2262 |
| 212 | Ga0495687_001992 | 3300047443 | Bacteria | 17348 |
| 213 | Ga0495687_012487 | 3300047443 | Bacteria | 4486 |
| 214 | Ga0495687_013191 | 3300047443 | Bacteria | 4325 |
| 215 | Ga0496102_0077260 | 3300048905 | Bacteria | 3064 |
| 216 | Ga0496103_0075523 | 3300048906 | Bacteria | 2114 |
| 217 | Ga0496107_0188500 | 3300048910 | Bacteria | 1532 |
| 218 | Ga0496112_0362344 | 3300048915 | Bacteria | 1392 |
| 219 | Ga0501047_0112563 | 3300049581 | Bacteria | 2604 |
| 220 | Ga0501211_001515 | 3300049658 | Bacteria | 2488 |
| 221 | Ga0501221_000227 | 3300049704 | Bacteria | 8057 |
| 222 | Ga0501229_002005 | 3300049706 | Bacteria | 2392 |
| 223 | nmdc:mga03683_13182_c1 | 3300050489 | Bacteria | 3036 |
| 224 | nmdc:mga00v17_36808_c1 | 3300050491 | Bacteria | 2919 |
| 225 | nmdc:mga0yw44_32996_c1 | 3300050492 | Bacteria | 3021 |
| 226 | nmdc:mga0k408_146058_c1 | 3300050493 | Bacteria | 1408 |
| 227 | nmdc:mga0k408_29244_c1 | 3300050493 | Bacteria | 3136 |
| 228 | nmdc:mga0k408_31269_c2 | 3300050493 | Bacteria | 2089 |
| 229 | nmdc:mga0k408_4153_c1 | 3300050493 | Bacteria | 7690 |
| 230 | nmdc:mga0k408_6734_c1 | 3300050493 | Bacteria | 6130 |
| 231 | nmdc:mga0k408_7545_c1 | 3300050493 | Bacteria | 5810 |
| 232 | nmdc:mga0k408_7844_c1 | 3300050493 | Bacteria | 5709 |
| 233 | nmdc:mga06z11_70817_c1 | 3300050494 | Bacteria | 1844 |
| 234 | nmdc:mga07m45_11786_c1 | 3300050496 | Bacteria | 4602 |
| 235 | nmdc:mga07m45_16713_c1 | 3300050496 | Bacteria | 3930 |
| 236 | nmdc:mga07m45_3213_c1 | 3300050496 | Bacteria | 7839 |
| 237 | nmdc:mga07m45_34888_c1 | 3300050496 | Bacteria | 2797 |
| 238 | nmdc:mga07m45_6636_c1 | 3300050496 | Bacteria | 3945 |
| 239 | nmdc:mga07m45_6934_c1 | 3300050496 | Bacteria | 5763 |
| 240 | nmdc:mga07m45_8791_c1 | 3300050496 | Bacteria | 5207 |
| 241 | nmdc:mga07m45_9371_c1 | 3300050496 | Bacteria | 5077 |
| 242 | nmdc:mga09592_22946_c1 | 3300050508 | Bacteria | 5149 |
| 243 | nmdc:mga0n895_240284_c1 | 3300050512 | Bacteria | 1838 |
| 244 | nmdc:mga08x19_23043_c1 | 3300050514 | Bacteria | 3861 |
| 245 | nmdc:mga0a205_42228_c1 | 3300050515 | Bacteria | 4393 |
| 246 | Ga0500578_0085248 | 3300053086 | Bacteria | 2007 |
| 247 | Ga0500644_0014861 | 3300053088 | Bacteria | 2206 |
| 248 | Ga0500651_0012909 | 3300053093 | Bacteria | 5075 |
| 249 | Ga0500650_0074056 | 3300053098 | Bacteria | 1592 |
| 250 | Ga0500628_001689 | 3300053129 | Bacteria | 3729 |
| 251 | Ga0500652_000630 | 3300053131 | Bacteria | 12093 |
| 252 | Ga0500655_010612 | 3300053133 | Bacteria | 1664 |
| 253 | Ga0500559_0000107 | 3300053136 | Bacteria | 65560 |
| 254 | Ga0500622_0003559 | 3300053156 | Bacteria | 10296 |
| 255 | Ga0500622_0034687 | 3300053156 | Bacteria | 2642 |
| 256 | Ga0500587_003639 | 3300053739 | Bacteria | 2143 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050496 | nmdc:mga07m45_16713_c1 | nmdc:mga07m45_16713_c1_1554_2588 | 269 |
| 2 | 3300026121 | Ga0207683_10034605 | Ga0207683_100346052 | 277 |
| 3 | 3300039447 | Ga0436361_0694787 | Ga0436361_0694787_18750_19649 | 278 |
| 4 | 3300042134 | Ga0450898_002163 | Ga0450898_002163_1507_2553 | 297 |
| 5 | 3300042435 | Ga0439434_0031687 | Ga0439434_0031687_27_1046 | 299 |
| 6 | 3300049581 | Ga0501047_0112563 | Ga0501047_0112563_241_1239 | 311 |
| 7 | iso_pu_bacteria | 2585428057 | 2587725442 | 311 |
| 8 | iso_pu_bacteria | 2585428058 | 2587737027 | 311 |
| 9 | iso_pu_bacteria | 2588253510 | 2588294317 | 311 |
| 10 | iso_pu_bacteria | 2643221585 | 2643933825 | 311 |
| 11 | iso_pu_bacteria | 2643221592 | 2643968563 | 311 |
| 12 | iso_pu_bacteria | 2643221625 | 2644140645 | 311 |
| 13 | iso_pu_bacteria | 2643221639 | 2644218822 | 311 |
| 14 | iso_pu_bacteria | 2643221648 | 2644272835 | 311 |
| 15 | iso_pu_bacteria | 2643221656 | 2644315319 | 311 |
| 16 | 3300005457 | Ga0070662_100009371 | Ga0070662_1000093715 | 313 |
| 17 | 3300042876 | Ga0451577_0000031 | Ga0451577_0000031_327252_328259 | 314 |
| 18 | 3300044712 | Ga0453684_0008697 | Ga0453684_0008697_6708_7715 | 314 |
| 19 | iso_pu_bacteria | 8057160832 | 8057163825 | 314 |
| 20 | 3300003322 | rootL2_10025756 | rootL2_100257563 | 315 |
| 21 | 3300005445 | Ga0070708_100160327 | Ga0070708_1001603272 | 315 |
| 22 | 3300005459 | Ga0068867_100048785 | Ga0068867_1000487852 | 315 |
| 23 | 3300005467 | Ga0070706_100280846 | Ga0070706_1002808462 | 315 |
| 24 | 3300005577 | Ga0068857_100015430 | Ga0068857_1000154305 | 315 |
| 25 | 3300006038 | Ga0075365_10005572 | Ga0075365_100055722 | 315 |
| 26 | 3300006038 | Ga0075365_10027973 | Ga0075365_100279733 | 315 |
| 27 | 3300006042 | Ga0075368_10009936 | Ga0075368_100099362 | 315 |
| 28 | 3300006048 | Ga0075363_100010376 | Ga0075363_1000103763 | 315 |
| 29 | 3300006048 | Ga0075363_100083347 | Ga0075363_1000833472 | 315 |
| 30 | 3300006173 | Ga0070716_100059268 | Ga0070716_1000592682 | 315 |
| 31 | 3300006177 | Ga0075362_10012181 | Ga0075362_100121814 | 315 |
| 32 | 3300006178 | Ga0075367_10006653 | Ga0075367_100066535 | 315 |
| 33 | 3300006353 | Ga0075370_10015296 | Ga0075370_100152963 | 315 |
| 34 | 3300006880 | Ga0075429_100007851 | Ga0075429_1000078517 | 315 |
| 35 | 3300009093 | Ga0105240_10013307 | Ga0105240_100133077 | 315 |
| 36 | 3300009093 | Ga0105240_10035441 | Ga0105240_100354415 | 315 |
| 37 | 3300009148 | Ga0105243_10000919 | Ga0105243_1000091915 | 315 |
| 38 | 3300009148 | Ga0105243_10015671 | Ga0105243_100156715 | 315 |
| 39 | 3300009148 | Ga0105243_10064536 | Ga0105243_100645362 | 315 |
| 40 | 3300009148 | Ga0105243_10197919 | Ga0105243_101979192 | 315 |
| 41 | 3300009545 | Ga0105237_10003357 | Ga0105237_100033578 | 315 |
| 42 | 3300009551 | Ga0105238_10030082 | Ga0105238_100300824 | 315 |
| 43 | 3300009551 | Ga0105238_10054287 | Ga0105238_100542872 | 315 |
| 44 | 3300010375 | Ga0105239_10003475 | Ga0105239_100034755 | 315 |
| 45 | 3300013104 | Ga0157370_10023081 | Ga0157370_100230812 | 315 |
| 46 | 3300013308 | Ga0157375_10467457 | Ga0157375_104674571 | 315 |
| 47 | 3300014745 | Ga0157377_10000104 | Ga0157377_1000010439 | 315 |
| 48 | 3300014745 | Ga0157377_10000546 | Ga0157377_1000054612 | 315 |
| 49 | 3300025304 | Ga0209257_1024437 | Ga0209257_10244372 | 315 |
| 50 | 3300025898 | Ga0207692_10017293 | Ga0207692_100172932 | 315 |
| 51 | 3300025910 | Ga0207684_10188210 | Ga0207684_101882102 | 315 |
| 52 | 3300025913 | Ga0207695_10209599 | Ga0207695_102095992 | 315 |
| 53 | 3300025914 | Ga0207671_10036894 | Ga0207671_100368944 | 315 |
| 54 | 3300025915 | Ga0207693_10008099 | Ga0207693_100080993 | 315 |
| 55 | 3300025916 | Ga0207663_10061390 | Ga0207663_100613902 | 315 |
| 56 | 3300025919 | Ga0207657_10026339 | Ga0207657_100263393 | 315 |
| 57 | 3300025929 | Ga0207664_10004507 | Ga0207664_100045073 | 315 |
| 58 | 3300025933 | Ga0207706_10172358 | Ga0207706_101723582 | 315 |
| 59 | 3300025933 | Ga0207706_10206469 | Ga0207706_102064692 | 315 |
| 60 | 3300025939 | Ga0207665_10015084 | Ga0207665_100150843 | 315 |
| 61 | 3300025944 | Ga0207661_10123983 | Ga0207661_101239832 | 315 |
| 62 | 3300025961 | Ga0207712_10459618 | Ga0207712_104596181 | 315 |
| 63 | 3300026023 | Ga0207677_10271385 | Ga0207677_102713851 | 315 |
| 64 | 3300026067 | Ga0207678_10045301 | Ga0207678_100453013 | 315 |
| 65 | 3300026116 | Ga0207674_10055677 | Ga0207674_100556772 | 315 |
| 66 | 3300026116 | Ga0207674_10075962 | Ga0207674_100759622 | 315 |
| 67 | 3300026142 | Ga0207698_10121095 | Ga0207698_101210952 | 315 |
| 68 | 3300027866 | Ga0209813_10053953 | Ga0209813_100539531 | 315 |
| 69 | 3300028786 | Ga0307517_10184892 | Ga0307517_101848921 | 315 |
| 70 | 3300031250 | Ga0265331_10003373 | Ga0265331_100033732 | 315 |
| 71 | 3300031251 | Ga0265327_10000020 | Ga0265327_10000020334 | 315 |
| 72 | 3300031616 | Ga0307508_10005377 | Ga0307508_100053774 | 315 |
| 73 | 3300031730 | Ga0307516_10092122 | Ga0307516_100921222 | 315 |
| 74 | 3300035170 | Ga0373943_0030701 | Ga0373943_0030701_170_1180 | 315 |
| 75 | 3300035410 | Ga0373924_0005011 | Ga0373924_0005011_1748_2758 | 315 |
| 76 | 3300035691 | Ga0373931_0021283 | Ga0373931_0021283_313_1323 | 315 |
| 77 | 3300035695 | Ga0373927_0109513 | Ga0373927_0109513_356_1366 | 315 |
| 78 | 3300035725 | Ga0373947_0059601 | Ga0373947_0059601_376_1386 | 315 |
| 79 | 3300037418 | Ga0395900_0017145 | Ga0395900_0017145_6276_7286 | 315 |
| 80 | 3300037471 | Ga0395905_0025365 | Ga0395905_0025365_853_1863 | 315 |
| 81 | 3300042007 | Ga0439449_0000524 | Ga0439449_0000524_9205_10215 | 315 |
| 82 | 3300042115 | Ga0450911_005505 | Ga0450911_005505_129_1139 | 315 |
| 83 | 3300042121 | Ga0450919_000919 | Ga0450919_000919_562_1572 | 315 |
| 84 | 3300042531 | Ga0450918_000028 | Ga0450918_000028_7738_8748 | 315 |
| 85 | 3300044656 | Ga0466969_0013317 | Ga0466969_0013317_1972_2982 | 315 |
| 86 | 3300044658 | Ga0466972_0001039 | Ga0466972_0001039_4286_5296 | 315 |
| 87 | 3300044693 | Ga0466961_0047574 | Ga0466961_0047574_659_1669 | 315 |
| 88 | 3300044693 | Ga0466961_0174656 | Ga0466961_0174656_222_1232 | 315 |
| 89 | 3300044712 | Ga0453684_0030271 | Ga0453684_0030271_5944_6963 | 315 |
| 90 | 3300045049 | Ga0466959_0043460 | Ga0466959_0043460_2173_3183 | 315 |
| 91 | 3300045051 | Ga0451576_0318744 | Ga0451576_0318744_484_1494 | 315 |
| 92 | 3300046454 | Ga0495592_0000145 | Ga0495592_0000145_48986_49996 | 315 |
| 93 | 3300046519 | Ga0495632_0027994 | Ga0495632_0027994_917_1936 | 315 |
| 94 | 3300046543 | Ga0495645_0013857 | Ga0495645_0013857_4480_5490 | 315 |
| 95 | 3300046660 | Ga0495625_0035048 | Ga0495625_0035048_1758_2768 | 315 |
| 96 | 3300046690 | Ga0495624_0048260 | Ga0495624_0048260_1439_2449 | 315 |
| 97 | 3300046694 | Ga0495649_0016275 | Ga0495649_0016275_2821_3840 | 315 |
| 98 | 3300046810 | Ga0495660_0050618 | Ga0495660_0050618_105_1124 | 315 |
| 99 | 3300047443 | Ga0495687_001992 | Ga0495687_001992_13397_14407 | 315 |
| 100 | 3300047443 | Ga0495687_012487 | Ga0495687_012487_3108_4127 | 315 |
| 101 | 3300047443 | Ga0495687_013191 | Ga0495687_013191_2956_3966 | 315 |
| 102 | 3300048905 | Ga0496102_0077260 | Ga0496102_0077260_606_1616 | 315 |
| 103 | 3300048906 | Ga0496103_0075523 | Ga0496103_0075523_791_1801 | 315 |
| 104 | 3300048910 | Ga0496107_0188500 | Ga0496107_0188500_418_1428 | 315 |
| 105 | 3300048915 | Ga0496112_0362344 | Ga0496112_0362344_42_1052 | 315 |
| 106 | 3300050489 | nmdc:mga03683_13182_c1 | nmdc:mga03683_13182_c1_1937_2947 | 315 |
| 107 | 3300050491 | nmdc:mga00v17_36808_c1 | nmdc:mga00v17_36808_c1_1018_2028 | 315 |
| 108 | 3300050492 | nmdc:mga0yw44_32996_c1 | nmdc:mga0yw44_32996_c1_122_1132 | 315 |
| 109 | 3300050493 | nmdc:mga0k408_146058_c1 | nmdc:mga0k408_146058_c1_193_1203 | 315 |
| 110 | 3300050493 | nmdc:mga0k408_29244_c1 | nmdc:mga0k408_29244_c1_806_1816 | 315 |
| 111 | 3300050493 | nmdc:mga0k408_4153_c1 | nmdc:mga0k408_4153_c1_3723_4733 | 315 |
| 112 | 3300050493 | nmdc:mga0k408_6734_c1 | nmdc:mga0k408_6734_c1_1867_2877 | 315 |
| 113 | 3300050493 | nmdc:mga0k408_7545_c1 | nmdc:mga0k408_7545_c1_2956_3966 | 315 |
| 114 | 3300050493 | nmdc:mga0k408_7844_c1 | nmdc:mga0k408_7844_c1_2147_3157 | 315 |
| 115 | 3300050496 | nmdc:mga07m45_11786_c1 | nmdc:mga07m45_11786_c1_1361_2371 | 315 |
| 116 | 3300050496 | nmdc:mga07m45_3213_c1 | nmdc:mga07m45_3213_c1_2428_3438 | 315 |
| 117 | 3300050496 | nmdc:mga07m45_6636_c1 | nmdc:mga07m45_6636_c1_632_1642 | 315 |
| 118 | 3300050496 | nmdc:mga07m45_6934_c1 | nmdc:mga07m45_6934_c1_2961_3971 | 315 |
| 119 | 3300050496 | nmdc:mga07m45_8791_c1 | nmdc:mga07m45_8791_c1_2961_3971 | 315 |
| 120 | 3300050508 | nmdc:mga09592_22946_c1 | nmdc:mga09592_22946_c1_2702_3712 | 315 |
| 121 | 3300053086 | Ga0500578_0085248 | Ga0500578_0085248_284_1294 | 315 |
| 122 | 3300053098 | Ga0500650_0074056 | Ga0500650_0074056_275_1285 | 315 |
| 123 | 3300053136 | Ga0500559_0000107 | Ga0500559_0000107_55266_56276 | 315 |
| 124 | 3300053156 | Ga0500622_0034687 | Ga0500622_0034687_875_1885 | 315 |
| 125 | 3300053739 | Ga0500587_003639 | Ga0500587_003639_961_1971 | 315 |
| 126 | iso_pu_bacteria | 2643221544 | 2643746732 | 315 |
| 127 | iso_pu_bacteria | 3007866637 | 3007867657 | 315 |
| 128 | 3300025273 | Ga0209673_1038628 | Ga0209673_10386281 | 317 |
| 129 | 3300025303 | Ga0209051_1000833 | Ga0209051_100083325 | 317 |
| 130 | 3300025304 | Ga0209257_1000161 | Ga0209257_10001615 | 317 |
| 131 | 3300025909 | Ga0207705_10153313 | Ga0207705_101533132 | 317 |
| 132 | 3300042138 | Ga0450903_004970 | Ga0450903_004970_139_1158 | 317 |
| 133 | 3300042144 | Ga0450889_004449 | Ga0450889_004449_77_1096 | 317 |
| 134 | 3300042439 | Ga0439464_0001135 | Ga0439464_0001135_3773_4792 | 317 |
| 135 | 3300045051 | Ga0451576_0065465 | Ga0451576_0065465_1067_2086 | 317 |
| 136 | 3300025933 | Ga0207706_10002795 | Ga0207706_100027953 | 318 |
| 137 | 3300031456 | Ga0307513_10151172 | Ga0307513_101511722 | 318 |
| 138 | 3300003316 | rootH1_10064001 | rootH1_100640012 | 319 |
| 139 | 3300003759 | Ga0055525_1000222 | Ga0055525_100022211 | 319 |
| 140 | 3300003794 | Ga0055531_10000513 | Ga0055531_1000051318 | 319 |
| 141 | 3300005337 | Ga0070682_100066693 | Ga0070682_1000666932 | 319 |
| 142 | 3300005345 | Ga0070692_10063324 | Ga0070692_100633241 | 319 |
| 143 | 3300005367 | Ga0070667_100008719 | Ga0070667_1000087192 | 319 |
| 144 | 3300005367 | Ga0070667_100180260 | Ga0070667_1001802602 | 319 |
| 145 | 3300005434 | Ga0070709_10001056 | Ga0070709_100010564 | 319 |
| 146 | 3300005435 | Ga0070714_100002565 | Ga0070714_1000025658 | 319 |
| 147 | 3300005437 | Ga0070710_10044630 | Ga0070710_100446302 | 319 |
| 148 | 3300005440 | Ga0070705_100129532 | Ga0070705_1001295322 | 319 |
| 149 | 3300005445 | Ga0070708_100133485 | Ga0070708_1001334852 | 319 |
| 150 | 3300005457 | Ga0070662_100086508 | Ga0070662_1000865082 | 319 |
| 151 | 3300005457 | Ga0070662_100148132 | Ga0070662_1001481322 | 319 |
| 152 | 3300005468 | Ga0070707_100100654 | Ga0070707_1001006542 | 319 |
| 153 | 3300005471 | Ga0070698_100206605 | Ga0070698_1002066052 | 319 |
| 154 | 3300005518 | Ga0070699_100077303 | Ga0070699_1000773033 | 319 |
| 155 | 3300005530 | Ga0070679_100131520 | Ga0070679_1001315201 | 319 |
| 156 | 3300005536 | Ga0070697_100027990 | Ga0070697_1000279902 | 319 |
| 157 | 3300005549 | Ga0070704_100018299 | Ga0070704_1000182994 | 319 |
| 158 | 3300006852 | Ga0075433_10036728 | Ga0075433_100367284 | 319 |
| 159 | 3300006871 | Ga0075434_100071949 | Ga0075434_1000719493 | 319 |
| 160 | 3300006914 | Ga0075436_100008551 | Ga0075436_1000085512 | 319 |
| 161 | 3300007076 | Ga0075435_100022703 | Ga0075435_1000227032 | 319 |
| 162 | 3300021361 | Ga0213872_10000045 | Ga0213872_100000457 | 319 |
| 163 | 3300021361 | Ga0213872_10001196 | Ga0213872_1000119611 | 319 |
| 164 | 3300025230 | Ga0209563_100088 | Ga0209563_100088121 | 319 |
| 165 | 3300025298 | Ga0209050_1006687 | Ga0209050_10066876 | 319 |
| 166 | 3300025304 | Ga0209257_1001107 | Ga0209257_100110718 | 319 |
| 167 | 3300025913 | Ga0207695_10013742 | Ga0207695_100137423 | 319 |
| 168 | 3300025922 | Ga0207646_10001282 | Ga0207646_1000128212 | 319 |
| 169 | 3300025933 | Ga0207706_10002534 | Ga0207706_1000253413 | 319 |
| 170 | 3300025935 | Ga0207709_10008364 | Ga0207709_100083642 | 319 |
| 171 | 3300025935 | Ga0207709_10078363 | Ga0207709_100783632 | 319 |
| 172 | 3300025938 | Ga0207704_10214226 | Ga0207704_102142262 | 319 |
| 173 | 3300025939 | Ga0207665_10143701 | Ga0207665_101437011 | 319 |
| 174 | 3300025986 | Ga0207658_10001310 | Ga0207658_1000131015 | 319 |
| 175 | 3300026089 | Ga0207648_10003157 | Ga0207648_100031576 | 319 |
| 176 | 3300026142 | Ga0207698_10038392 | Ga0207698_100383923 | 319 |
| 177 | 3300028379 | Ga0268266_10241065 | Ga0268266_102410652 | 319 |
| 178 | 3300028786 | Ga0307517_10004774 | Ga0307517_1000477411 | 319 |
| 179 | 3300028786 | Ga0307517_10081549 | Ga0307517_100815493 | 319 |
| 180 | 3300028794 | Ga0307515_10000093 | Ga0307515_1000009378 | 319 |
| 181 | 3300028794 | Ga0307515_10000110 | Ga0307515_1000011096 | 319 |
| 182 | 3300028794 | Ga0307515_10000521 | Ga0307515_1000052173 | 319 |
| 183 | 3300028794 | Ga0307515_10014947 | Ga0307515_100149476 | 319 |
| 184 | 3300028794 | Ga0307515_10020162 | Ga0307515_1002016212 | 319 |
| 185 | 3300028794 | Ga0307515_10026895 | Ga0307515_1002689510 | 319 |
| 186 | 3300028794 | Ga0307515_10071573 | Ga0307515_100715734 | 319 |
| 187 | 3300028794 | Ga0307515_10110938 | Ga0307515_101109383 | 319 |
| 188 | 3300031507 | Ga0307509_10001461 | Ga0307509_1000146112 | 319 |
| 189 | 3300031507 | Ga0307509_10008460 | Ga0307509_100084603 | 319 |
| 190 | 3300031507 | Ga0307509_10064531 | Ga0307509_100645313 | 319 |
| 191 | 3300031507 | Ga0307509_10069865 | Ga0307509_100698652 | 319 |
| 192 | 3300031507 | Ga0307509_10071888 | Ga0307509_100718884 | 319 |
| 193 | 3300031507 | Ga0307509_10077041 | Ga0307509_100770414 | 319 |
| 194 | 3300031616 | Ga0307508_10000150 | Ga0307508_1000015012 | 319 |
| 195 | 3300031616 | Ga0307508_10003770 | Ga0307508_100037709 | 319 |
| 196 | 3300031616 | Ga0307508_10012427 | Ga0307508_100124278 | 319 |
| 197 | 3300031616 | Ga0307508_10095975 | Ga0307508_100959752 | 319 |
| 198 | 3300031649 | Ga0307514_10000780 | Ga0307514_100007805 | 319 |
| 199 | 3300031649 | Ga0307514_10003863 | Ga0307514_100038636 | 319 |
| 200 | 3300031649 | Ga0307514_10006326 | Ga0307514_100063264 | 319 |
| 201 | 3300031649 | Ga0307514_10097720 | Ga0307514_100977202 | 319 |
| 202 | 3300031730 | Ga0307516_10164842 | Ga0307516_101648422 | 319 |
| 203 | 3300031995 | Ga0307409_100168679 | Ga0307409_1001686792 | 319 |
| 204 | 3300032005 | Ga0307411_10000368 | Ga0307411_1000036813 | 319 |
| 205 | 3300033179 | Ga0307507_10029743 | Ga0307507_100297432 | 319 |
| 206 | 3300033179 | Ga0307507_10053118 | Ga0307507_100531182 | 319 |
| 207 | 3300033180 | Ga0307510_10000360 | Ga0307510_1000036034 | 319 |
| 208 | 3300033180 | Ga0307510_10013533 | Ga0307510_100135333 | 319 |
| 209 | 3300033180 | Ga0307510_10078519 | Ga0307510_100785193 | 319 |
| 210 | 3300033180 | Ga0307510_10099867 | Ga0307510_100998672 | 319 |
| 211 | 3300033180 | Ga0307510_10128302 | Ga0307510_101283022 | 319 |
| 212 | 3300033180 | Ga0307510_10240009 | Ga0307510_102400092 | 319 |
| 213 | 3300037471 | Ga0395905_0002635 | Ga0395905_0002635_16336_17358 | 319 |
| 214 | 3300037471 | Ga0395905_0009501 | Ga0395905_0009501_4720_5751 | 319 |
| 215 | 3300039447 | Ga0436361_0224989 | Ga0436361_0224989_817_1851 | 319 |
| 216 | 3300042116 | Ga0450912_001836 | Ga0450912_001836_187_1209 | 319 |
| 217 | 3300042126 | Ga0450888_000044 | Ga0450888_000044_5231_6253 | 319 |
| 218 | 3300042127 | Ga0450890_001995 | Ga0450890_001995_1680_2702 | 319 |
| 219 | 3300042129 | Ga0450891_000948 | Ga0450891_000948_306_1328 | 319 |
| 220 | 3300044683 | Ga0466965_0005703 | Ga0466965_0005703_4007_5032 | 319 |
| 221 | 3300044684 | Ga0466966_0066790 | Ga0466966_0066790_396_1421 | 319 |
| 222 | 3300044693 | Ga0466961_0071848 | Ga0466961_0071848_332_1357 | 319 |
| 223 | 3300044694 | Ga0466963_0002273 | Ga0466963_0002273_2958_3983 | 319 |
| 224 | 3300044706 | Ga0466964_0020755 | Ga0466964_0020755_346_1371 | 319 |
| 225 | 3300044719 | Ga0466971_0050975 | Ga0466971_0050975_331_1356 | 319 |
| 226 | 3300044765 | Ga0466970_0013279 | Ga0466970_0013279_748_1773 | 319 |
| 227 | 3300045049 | Ga0466959_0000197 | Ga0466959_0000197_9597_10622 | 319 |
| 228 | 3300045976 | Ga0466967_0082490 | Ga0466967_0082490_945_1970 | 319 |
| 229 | 3300049658 | Ga0501211_001515 | Ga0501211_001515_444_1466 | 319 |
| 230 | 3300049704 | Ga0501221_000227 | Ga0501221_000227_2933_3955 | 319 |
| 231 | 3300049706 | Ga0501229_002005 | Ga0501229_002005_900_1922 | 319 |
| 232 | 3300050512 | nmdc:mga0n895_240284_c1 | nmdc:mga0n895_240284_c1_507_1529 | 319 |
| 233 | 3300050514 | nmdc:mga08x19_23043_c1 | nmdc:mga08x19_23043_c1_2036_3058 | 319 |
| 234 | 3300050515 | nmdc:mga0a205_42228_c1 | nmdc:mga0a205_42228_c1_2868_3890 | 319 |
| 235 | 3300003791 | Ga0055530_10011803 | Ga0055530_100118033 | 324 |
| 236 | 3300025298 | Ga0209050_1000706 | Ga0209050_100070638 | 324 |
| 237 | 3300045051 | Ga0451576_0442951 | Ga0451576_0442951_145_1182 | 324 |
| 238 | 3300002773 | JGI25152J39213_1003717 | JGI25152J39213_10037175 | 325 |
| 239 | 3300003215 | JGI25153J46596_10001057 | JGI25153J46596_100010572 | 325 |
| 240 | 3300003215 | JGI25153J46596_10004755 | JGI25153J46596_100047553 | 325 |
| 241 | 3300003771 | Ga0055526_1005017 | Ga0055526_10050172 | 325 |
| 242 | 3300005459 | Ga0068867_100000083 | Ga0068867_10000008315 | 325 |
| 243 | 3300025245 | Ga0207425_1001190 | Ga0207425_10011907 | 325 |
| 244 | 3300025258 | Ga0209129_1000481 | Ga0209129_100048125 | 325 |
| 245 | 3300025273 | Ga0209673_1005064 | Ga0209673_10050644 | 325 |
| 246 | 3300025273 | Ga0209673_1029679 | Ga0209673_10296792 | 325 |
| 247 | 3300025295 | Ga0209564_1001182 | Ga0209564_100118225 | 325 |
| 248 | 3300025297 | Ga0209758_1000859 | Ga0209758_100085939 | 325 |
| 249 | 3300025297 | Ga0209758_1001201 | Ga0209758_100120125 | 325 |
| 250 | 3300025299 | Ga0209256_1036066 | Ga0209256_10360662 | 325 |
| 251 | 3300025935 | Ga0207709_10000675 | Ga0207709_1000067515 | 325 |
| 252 | 3300026089 | Ga0207648_10000243 | Ga0207648_1000024339 | 325 |
| 253 | 3300026142 | Ga0207698_10032612 | Ga0207698_100326123 | 325 |
| 254 | 3300028786 | Ga0307517_10100404 | Ga0307517_101004042 | 325 |
| 255 | 3300031730 | Ga0307516_10273970 | Ga0307516_102739702 | 325 |
| 256 | 3300037471 | Ga0395905_0002906 | Ga0395905_0002906_852_1940 | 325 |
| 257 | 3300044658 | Ga0466972_0006603 | Ga0466972_0006603_1378_2418 | 325 |
| 258 | 3300046519 | Ga0495632_0009866 | Ga0495632_0009866_3049_4089 | 325 |
| 259 | 3300050493 | nmdc:mga0k408_31269_c2 | nmdc:mga0k408_31269_c2_527_1567 | 325 |
| 260 | 3300050494 | nmdc:mga06z11_70817_c1 | nmdc:mga06z11_70817_c1_762_1802 | 325 |
| 261 | 3300050496 | nmdc:mga07m45_34888_c1 | nmdc:mga07m45_34888_c1_243_1289 | 325 |
| 262 | 3300050496 | nmdc:mga07m45_9371_c1 | nmdc:mga07m45_9371_c1_3359_4399 | 325 |
| 263 | 3300053088 | Ga0500644_0014861 | Ga0500644_0014861_487_1527 | 325 |
| 264 | 3300053093 | Ga0500651_0012909 | Ga0500651_0012909_3270_4310 | 325 |
| 265 | 3300053129 | Ga0500628_001689 | Ga0500628_001689_2635_3675 | 325 |
| 266 | 3300053131 | Ga0500652_000630 | Ga0500652_000630_10083_11123 | 325 |
| 267 | 3300053133 | Ga0500655_010612 | Ga0500655_010612_307_1347 | 325 |
| 268 | 3300053156 | Ga0500622_0003559 | Ga0500622_0003559_6056_7096 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fj1-assembly2.cif.gz_C | crystal structure of putative phosphosugar isomerase (yp_167080.1) from silicibacter pomeroyi dss-3 at 1.75 a resolution | 0.9306 | 9 | 313 |
| 7kqa-assembly1.cif.gz_B | crystal structure of glucosamine-6-phosphate deanimase from strenotrophomonas maltophilia | 0.9122 | 8 | 321 |
| 8fdb-assembly1.cif.gz_B | crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. | 0.8938 | 8 | 325 |
| 7kqa-assembly1.cif.gz_B | crystal structure of glucosamine-6-phosphate deanimase from strenotrophomonas maltophilia | 0.8798 | 8 | 321 |
| 7dnr-assembly1.cif.gz_B | crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. coli | 0.875 | 11 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fj1C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.9135 | 10 | 171 | 3.40.50.10490 |
| 3hbaB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.901 | 183 | 309 | 3.40.50.10490 |
| 3hbaB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8827 | 10 | 175 | 3.40.50.10490 |
| 3euaH03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.882 | 188 | 275 | 3.40.50.12570 |
| af_Q19699_551_710_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8789 | 178 | 325 | 3.40.50.10490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A326KCL7-F1-model_v4 | deleted | 0.9589 | 8 | 129 |
|
| AF-A0A6L8CZQ2-F1-model_v4 | deleted | 0.9466 | 12 | 325 |
|
| AF-A0A529Y4G8-F1-model_v4 | SIS domain-containing protein | 0.9442 | 5 | 142 |
GO:0008483
GO:0097367 GO:1901135 |
| AF-A0A4R7WZ33-F1-model_v4 | deleted | 0.9428 | 9 | 325 |
|
| AF-A0A525I6I2-F1-model_v4 | SIS domain-containing protein | 0.9421 | 9 | 325 |
GO:0008483
GO:0097367 GO:1901135 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar