F374610

General Info

Members Datasets Scaffolds Average Seq Length
267 151 267 238

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100060294|Ga0070698_1000602943
Length 282
Sequence MKHNAMAIDVRTRIIYGALAIMTIMFSMGKDLMAQTNTSTVVKNIVLVHGGLVDGSGWRGVYEALKKDGYTVTIVQNPTISLAGDVAVTKRAIAAQNGPVILVGHSYGGVVITEVGNDPKVAGLVYVTAFAPDKGESAASLIKNAPQGAPVPPILPPQDGYLFLDKAKFPAAFAADVSPDVASFMADSQVPWGLEALGGAITQPAWRTKPSWYLVSTEDKMIPPDAQRAMSKRAGSTVVEVKGSHAVYVSQPQAVAHFIEQAATGALVAGQEKSAAAVLAAR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
100 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
105 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
150 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 6.74
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10036078 3300005289 Bacteria 946
2 Ga0065704_10186857 3300005289 Bacteria 1209
3 Ga0065707_10215312 3300005295 Bacteria 1247
4 Ga0070670_100017650 3300005331 Bacteria 6124
5 Ga0070670_100030445 3300005331 Bacteria 4648
6 Ga0068869_100033639 3300005334 Unclassified 3620
7 Ga0068869_100479119 3300005334 Bacteria 1036
8 Ga0068869_100525481 3300005334 Unclassified 991
9 Ga0070666_10023619 3300005335 Bacteria 4003
10 Ga0070666_10059890 3300005335 Bacteria 2576
11 Ga0070689_100045500 3300005340 Bacteria 3380
12 Ga0070689_100187202 3300005340 Bacteria 1684
13 Ga0070668_100174883 3300005347 Bacteria 1750
14 Ga0070675_100010663 3300005354 Bacteria 7185
15 Ga0070675_100035760 3300005354 Bacteria 4038
16 Ga0070675_100683184 3300005354 Bacteria 934
17 Ga0070671_100030178 3300005355 Bacteria 4474
18 Ga0070671_100314762 3300005355 Bacteria 1333
19 Ga0070674_100217207 3300005356 Bacteria 1485
20 Ga0070674_100471613 3300005356 Bacteria 1040
21 Ga0070673_100046573 3300005364 Bacteria 3369
22 Ga0070673_100067909 3300005364 Bacteria 2853
23 Ga0070688_100140407 3300005365 Unclassified 1640
24 Ga0070667_100012482 3300005367 Bacteria 7029
25 Ga0070711_100285736 3300005439 Bacteria 1307
26 Ga0070711_100455806 3300005439 Unclassified 1048
27 Ga0070705_100445382 3300005440 Bacteria 970
28 Ga0070694_100279476 3300005444 Bacteria 1272
29 Ga0070708_100019255 3300005445 Bacteria 5732
30 Ga0070708_100444038 3300005445 Bacteria 1224
31 Ga0070678_100085794 3300005456 Bacteria 2400
32 Ga0070706_100000424 3300005467 Bacteria 50891
33 Ga0070706_100030194 3300005467 Bacteria 4992
34 Ga0070707_100006253 3300005468 Bacteria 11083
35 Ga0070707_100377345 3300005468 Bacteria 1377
36 Ga0070698_100060294 3300005471 Bacteria 3828
37 Ga0070698_100182829 3300005471 Bacteria 2034
38 Ga0070698_100253836 3300005471 Bacteria 1691
39 Ga0070699_100004401 3300005518 Bacteria 12454
40 Ga0070699_100016974 3300005518 Bacteria 6250
41 Ga0070699_100111476 3300005518 Bacteria 2402
42 Ga0070697_100004747 3300005536 Bacteria 10415
43 Ga0070697_100064793 3300005536 Bacteria 2985
44 Ga0070697_100118163 3300005536 Bacteria 2215
45 Ga0070697_100135818 3300005536 Bacteria 2065
46 Ga0070672_100045422 3300005543 Unclassified 3397
47 Ga0070672_100125098 3300005543 Bacteria 2108
48 Ga0070672_100223034 3300005543 Bacteria 1581
49 Ga0070695_100186414 3300005545 Bacteria 1473
50 Ga0070696_100244501 3300005546 Unclassified 1355
51 Ga0070696_100255999 3300005546 Bacteria 1325
52 Ga0070664_100011895 3300005564 Bacteria 7063
53 Ga0070702_100302516 3300005615 Bacteria 1107
54 Ga0068859_100000002 3300005617 Bacteria 541370
55 Ga0068859_100016294 3300005617 Bacteria 7467
56 Ga0068864_100090290 3300005618 Bacteria 2701
57 Ga0068861_100537379 3300005719 Bacteria 1063
58 Ga0068863_100009519 3300005841 Bacteria 9477
59 Ga0068858_100015539 3300005842 Bacteria 7160
60 Ga0068860_100074525 3300005843 Bacteria 3227
61 Ga0070717_10538805 3300006028 Bacteria 1057
62 Ga0075432_10045455 3300006058 Bacteria 1541
63 Ga0070716_100333979 3300006173 Bacteria 1067
64 Ga0070712_100057933 3300006175 Bacteria 2723
65 Ga0097621_100038765 3300006237 Bacteria 3824
66 Ga0097621_100188163 3300006237 Bacteria 1787
67 Ga0068871_100547156 3300006358 Bacteria 1048
68 Ga0075428_100060996 3300006844 Bacteria 4129
69 Ga0075428_100064908 3300006844 Bacteria 3998
70 Ga0075430_100221413 3300006846 Bacteria 1570
71 Ga0075430_100646018 3300006846 Bacteria 872
72 Ga0075431_100041020 3300006847 Unclassified 4772
73 Ga0075431_100075503 3300006847 Bacteria 3478
74 Ga0075431_100128156 3300006847 Bacteria 2619
75 Ga0075431_100322297 3300006847 Bacteria 1558
76 Ga0075431_100508202 3300006847 Bacteria 1195
77 Ga0075433_10040787 3300006852 Bacteria 4020
78 Ga0075433_10056197 3300006852 Bacteria 3437
79 Ga0075433_10392663 3300006852 Bacteria 1224
80 Ga0075433_10415783 3300006852 Bacteria 1186
81 Ga0075433_10426921 3300006852 Bacteria 1169
82 Ga0075434_100016863 3300006871 Bacteria 7027
83 Ga0075434_100037008 3300006871 Bacteria 4829
84 Ga0075434_100069376 3300006871 Bacteria 3514
85 Ga0075429_100092083 3300006880 Bacteria 2644
86 Ga0075429_100244504 3300006880 Bacteria 1571
87 Ga0075429_100491223 3300006880 Bacteria 1075
88 Ga0068865_100433188 3300006881 Bacteria 1084
89 Ga0097620_100000002 3300006931 Bacteria 541370
90 Ga0097620_100016294 3300006931 Bacteria 7467
91 Ga0075435_100021060 3300007076 Bacteria 5009
92 Ga0075435_100262818 3300007076 Bacteria 1471
93 Ga0075435_100484544 3300007076 Bacteria 1068
94 Ga0099794_10099427 3300007265 Bacteria 1451
95 Ga0111539_10002716 3300009094 Bacteria 23474
96 Ga0111539_10019197 3300009094 Bacteria 8446
97 Ga0111539_10019711 3300009094 Bacteria 8318
98 Ga0111539_10525053 3300009094 Bacteria 1379
99 Ga0111539_10769363 3300009094 Bacteria 1121
100 Ga0105247_10201304 3300009101 Bacteria 1338
101 Ga0114129_10021776 3300009147 Bacteria 9098
102 Ga0114129_10046808 3300009147 Bacteria 6078
103 Ga0114129_10051684 3300009147 Bacteria 5769
104 Ga0114129_10106490 3300009147 Bacteria 3873
105 Ga0114129_10117650 3300009147 Bacteria 3661
106 Ga0114129_10553903 3300009147 Bacteria 1495
107 Ga0114129_10931369 3300009147 Bacteria 1099
108 Ga0105243_10486796 3300009148 Bacteria 1166
109 Ga0105243_10707837 3300009148 Bacteria 982
110 Ga0105248_10021284 3300009177 Bacteria 7187
111 Ga0105248_10188147 3300009177 Bacteria 2326
112 Ga0105237_10432439 3300009545 Bacteria 1322
113 Ga0105249_10409974 3300009553 Bacteria 1387
114 Ga0105249_10551109 3300009553 Bacteria 1204
115 Ga0105249_10788598 3300009553 Bacteria 1014
116 Ga0105246_10081391 3300011119 Bacteria 2308
117 Ga0157374_10180712 3300013296 Bacteria 2060
118 Ga0163162_10059577 3300013306 Bacteria 3850
119 Ga0163162_10470464 3300013306 Bacteria 1388
120 Ga0157375_10013390 3300013308 Bacteria 7296
121 Ga0157375_10307169 3300013308 Bacteria 1750
122 Ga0157375_10646754 3300013308 Bacteria 1214
123 Ga0157380_10826525 3300014326 Bacteria 946
124 Ga0157377_10099115 3300014745 Bacteria 1733
125 Ga0157377_10623058 3300014745 Bacteria 773
126 Ga0157376_10038416 3300014969 Bacteria 3895
127 Ga0157376_10112301 3300014969 Bacteria 2401
128 Ga0163161_10330687 3300017792 Bacteria 1207
129 Ga0224570_100276 3300022730 Bacteria 3862
130 Ga0207682_10158625 3300025893 Bacteria 1024
131 Ga0207688_10006825 3300025901 Bacteria 6212
132 Ga0207688_10082800 3300025901 Bacteria 1834
133 Ga0207680_10019283 3300025903 Bacteria 3645
134 Ga0207699_10218997 3300025906 Bacteria 1298
135 Ga0207645_10170841 3300025907 Bacteria 1425
136 Ga0207684_10000004 3300025910 Bacteria 755956
137 Ga0207684_10081473 3300025910 Bacteria 2754
138 Ga0207684_10263864 3300025910 Bacteria 1486
139 Ga0207693_10001749 3300025915 Bacteria 19062
140 Ga0207646_10073902 3300025922 Bacteria 3045
141 Ga0207646_10137920 3300025922 Bacteria 2196
142 Ga0207681_10264978 3300025923 Bacteria 1347
143 Ga0207650_10021412 3300025925 Bacteria 4569
144 Ga0207650_10028583 3300025925 Bacteria 4000
145 Ga0207650_10032086 3300025925 Unclassified 3799
146 Ga0207650_10140741 3300025925 Bacteria 1896
147 Ga0207659_10006309 3300025926 Bacteria 7256
148 Ga0207659_10164725 3300025926 Unclassified 1744
149 Ga0207687_10267606 3300025927 Bacteria 1365
150 Ga0207700_10678454 3300025928 Bacteria 919
151 Ga0207644_10024831 3300025931 Bacteria 4117
152 Ga0207644_10276287 3300025931 Bacteria 1348
153 Ga0207670_10021211 3300025936 Bacteria 4004
154 Ga0207670_10424314 3300025936 Bacteria 1068
155 Ga0207669_10243785 3300025937 Bacteria 1334
156 Ga0207704_10523293 3300025938 Bacteria 959
157 Ga0207691_10012254 3300025940 Bacteria 8220
158 Ga0207691_10059961 3300025940 Unclassified 3459
159 Ga0207691_10073711 3300025940 Unclassified 3079
160 Ga0207691_10229593 3300025940 Bacteria 1607
161 Ga0207711_10022325 3300025941 Bacteria 5291
162 Ga0207711_10499355 3300025941 Bacteria 1134
163 Ga0207689_10057423 3300025942 Unclassified 3202
164 Ga0207689_10316239 3300025942 Bacteria 1295
165 Ga0207679_10091461 3300025945 Bacteria 2355
166 Ga0207679_10420565 3300025945 Bacteria 1179
167 Ga0207651_10040312 3300025960 Bacteria 3088
168 Ga0207712_10427063 3300025961 Bacteria 1119
169 Ga0207658_10397383 3300025986 Bacteria 1211
170 Ga0207677_10113788 3300026023 Bacteria 2020
171 Ga0207677_10372573 3300026023 Bacteria 1203
172 Ga0207703_10454168 3300026035 Bacteria 1197
173 Ga0207708_10412337 3300026075 Bacteria 1119
174 Ga0207641_10020133 3300026088 Bacteria 5477
175 Ga0207676_10697774 3300026095 Bacteria 983
176 Ga0207675_100449413 3300026118 Bacteria 1277
177 Ga0207683_10020130 3300026121 Bacteria 5704
178 Ga0207683_10219366 3300026121 Bacteria 1733
179 Ga0207428_10034250 3300027907 Bacteria 4164
180 Ga0207428_10099543 3300027907 Bacteria 2248
181 Ga0265354_1005122 3300028016 Bacteria 1341
182 Ga0265356_1000214 3300028017 Bacteria 10889
183 Ga0268265_10064349 3300028380 Unclassified 2825
184 Ga0268264_10007120 3300028381 Bacteria 9375
185 Ga0307515_10193151 3300028794 Bacteria 1938
186 Ga0307515_10367680 3300028794 Bacteria 1076
187 Ga0307512_10007042 3300030522 Bacteria 11219
188 Ga0265762_1002238 3300030760 Bacteria 3499
189 Ga0265770_1002433 3300030878 Bacteria 2525
190 Ga0265760_10013826 3300031090 Bacteria 2311
191 Ga0307513_10000923 3300031456 Bacteria 42460
192 Ga0307513_10060298 3300031456 Bacteria 4022
193 Ga0307514_10139453 3300031649 Bacteria 1651
194 Ga0307510_10022805 3300033180 Bacteria 7262
195 Ga0316214_1011746 3300033545 Bacteria 1193
196 Ga0373923_0051926 3300035111 Bacteria 1722
197 Ga0373962_0097254 3300035242 Bacteria 914
198 Ga0373924_0025648 3300035410 Bacteria 2331
199 Ga0373935_0225837 3300035692 Bacteria 1302
200 Ga0373947_0156251 3300035725 Bacteria 1472
201 Ga0373925_0245798 3300037068 Bacteria 1434
202 Ga0436361_0247637 3300039447 Bacteria 1396
203 Ga0495580_0078824 3300046472 Bacteria 2298
204 Ga0495628_0003912 3300046516 Bacteria 13274
205 Ga0495648_0188090 3300046524 Bacteria 1044
206 Ga0495663_0019214 3300046525 Bacteria 1954
207 Ga0495656_0004213 3300046615 Bacteria 4912
208 Ga0495625_0223483 3300046660 Bacteria 1232
209 Ga0495670_0221194 3300046691 Unclassified 1006
210 Ga0495636_0000170 3300047318 Bacteria 26126
211 Ga0495636_0012901 3300047318 Bacteria 3312
212 Ga0496100_0023021 3300048903 Bacteria 3778
213 Ga0496102_0010698 3300048905 Bacteria 7902
214 Ga0496103_0009326 3300048906 Bacteria 5814
215 Ga0496104_0241036 3300048907 Bacteria 1720
216 Ga0496106_0027838 3300048909 Bacteria 4208
217 Ga0496107_0009251 3300048910 Bacteria 6830
218 Ga0496108_0008319 3300048911 Bacteria 8412
219 Ga0496108_0421682 3300048911 Bacteria 1165
220 Ga0496109_0220494 3300048912 Bacteria 1783
221 Ga0496110_0210708 3300048913 Bacteria 1766
222 Ga0496111_0003854 3300048914 Bacteria 9375
223 Ga0496112_0041923 3300048915 Bacteria 4479
224 Ga0496112_0447364 3300048915 Bacteria 1230
225 Ga0496113_0101854 3300048916 Bacteria 2226
226 Ga0496113_0107711 3300048916 Bacteria 2166
227 Ga0496114_0005131 3300048917 Bacteria 10211
228 Ga0496114_0107829 3300048917 Bacteria 2384
229 Ga0496115_0093992 3300048918 Bacteria 2452
230 nmdc:mga05p37_16039_c1 3300050507 Bacteria 9016
231 nmdc:mga05p37_183314_c1 3300050507 Bacteria 2546
232 nmdc:mga05p37_431993_c1 3300050507 Bacteria 1530
233 nmdc:mga05p37_562152_c1 3300050507 Bacteria 1296
234 nmdc:mga05p37_576150_c1 3300050507 Bacteria 1276
235 nmdc:mga05p37_940137_c1 3300050507 Bacteria 927
236 nmdc:mga05p37_94321_c1 3300050507 Bacteria 3688
237 nmdc:mga09592_19126_c1 3300050508 Bacteria 5621
238 nmdc:mga09592_246334_c1 3300050508 Bacteria 1549
239 nmdc:mga0qj67_319375_c1 3300050509 Bacteria 1257
240 nmdc:mga0qj67_480136_c1 3300050509 Bacteria 1000
241 nmdc:mga0qj67_715765_c1 3300050509 Bacteria 796
242 nmdc:mga06r32_151066_c1 3300050510 Bacteria 2301
243 nmdc:mga06r32_312002_c1 3300050510 Bacteria 1558
244 nmdc:mga06r32_554106_c1 3300050510 Bacteria 1123
245 nmdc:mga06r32_573216_c1 3300050510 Bacteria 1101
246 nmdc:mga06r32_65298_c1 3300050510 Bacteria 3510
247 nmdc:mga06r32_721367_c1 3300050510 Bacteria 961
248 nmdc:mga08y16_18829_c1 3300050511 Bacteria 7273
249 nmdc:mga08y16_651470_c1 3300050511 Bacteria 1057
250 nmdc:mga08y16_75604_c1 3300050511 Bacteria 3511
251 nmdc:mga08y16_87714_c1 3300050511 Bacteria 3242
252 nmdc:mga0n895_181386_c1 3300050512 Bacteria 2137
253 nmdc:mga0n895_24586_c1 3300050512 Bacteria 5679
254 nmdc:mga0n895_325051_c1 3300050512 Bacteria 1559
255 nmdc:mga0rr50_108250_c1 3300050513 Bacteria 2195
256 nmdc:mga0rr50_16031_c1 3300050513 Bacteria 4964
257 nmdc:mga0rr50_200660_c1 3300050513 Bacteria 1639
258 nmdc:mga0a205_102974_c1 3300050515 Bacteria 2753
259 nmdc:mga0a205_116393_c1 3300050515 Bacteria 2572
260 nmdc:mga0a205_139383_c1 3300050515 Bacteria 2326
261 nmdc:mga0a205_154491_c1 3300050515 Bacteria 2193
262 nmdc:mga0a205_434522_c1 3300050515 Bacteria 1174
263 nmdc:mga0a205_48547_c1 3300050515 Bacteria 4096
264 nmdc:mga0a205_640704_c1 3300050515 Bacteria 914
265 Ga0500593_070538 3300053117 Bacteria 1517
266 Ga0590071_001714 3300059421 Bacteria 5677
267 Ga0590077_011144 3300059426 Bacteria 1854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059421 Ga0590071_001714 Ga0590071_001714_3854_4654 205
2 3300059426 Ga0590077_011144 Ga0590077_011144_763_1563 205
3 3300048915 Ga0496112_0447364 Ga0496112_0447364_438_1214 215
4 3300005340 Ga0070689_100187202 Ga0070689_1001872021 216
5 3300005355 Ga0070671_100314762 Ga0070671_1003147622 216
6 3300005356 Ga0070674_100471613 Ga0070674_1004716132 216
7 3300005440 Ga0070705_100445382 Ga0070705_1004453821 216
8 3300005456 Ga0070678_100085794 Ga0070678_1000857942 216
9 3300005618 Ga0068864_100090290 Ga0068864_1000902902 216
10 3300006175 Ga0070712_100057933 Ga0070712_1000579332 216
11 3300006358 Ga0068871_100547156 Ga0068871_1005471562 216
12 3300009101 Ga0105247_10201304 Ga0105247_102013042 216
13 3300009177 Ga0105248_10188147 Ga0105248_101881472 216
14 3300013306 Ga0163162_10059577 Ga0163162_100595772 216
15 3300013308 Ga0157375_10307169 Ga0157375_103071693 216
16 3300014326 Ga0157380_10826525 Ga0157380_108265252 216
17 3300014745 Ga0157377_10099115 Ga0157377_100991152 216
18 3300014969 Ga0157376_10112301 Ga0157376_101123013 216
19 3300025901 Ga0207688_10006825 Ga0207688_100068255 216
20 3300025915 Ga0207693_10001749 Ga0207693_1000174912 216
21 3300025923 Ga0207681_10264978 Ga0207681_102649782 216
22 3300025931 Ga0207644_10276287 Ga0207644_102762872 216
23 3300025936 Ga0207670_10424314 Ga0207670_104243142 216
24 3300025937 Ga0207669_10243785 Ga0207669_102437852 216
25 3300025941 Ga0207711_10499355 Ga0207711_104993552 216
26 3300026023 Ga0207677_10113788 Ga0207677_101137881 216
27 3300026121 Ga0207683_10020130 Ga0207683_100201304 216
28 3300046525 Ga0495663_0019214 Ga0495663_0019214_567_1337 216
29 3300046615 Ga0495656_0004213 Ga0495656_0004213_2713_3492 216
30 3300047318 Ga0495636_0000170 Ga0495636_0000170_13788_14546 216
31 3300047318 Ga0495636_0012901 Ga0495636_0012901_1396_2175 216
32 3300048903 Ga0496100_0023021 Ga0496100_0023021_1202_1885 216
33 3300048905 Ga0496102_0010698 Ga0496102_0010698_4075_4758 216
34 3300048906 Ga0496103_0009326 Ga0496103_0009326_5105_5788 216
35 3300048907 Ga0496104_0241036 Ga0496104_0241036_876_1559 216
36 3300048909 Ga0496106_0027838 Ga0496106_0027838_2725_3408 216
37 3300048910 Ga0496107_0009251 Ga0496107_0009251_4076_4759 216
38 3300048911 Ga0496108_0008319 Ga0496108_0008319_3442_4125 216
39 3300048911 Ga0496108_0421682 Ga0496108_0421682_28_807 216
40 3300048912 Ga0496109_0220494 Ga0496109_0220494_356_1039 216
41 3300048913 Ga0496110_0210708 Ga0496110_0210708_1012_1695 216
42 3300048914 Ga0496111_0003854 Ga0496111_0003854_3717_4400 216
43 3300048915 Ga0496112_0041923 Ga0496112_0041923_3330_4013 216
44 3300048916 Ga0496113_0101854 Ga0496113_0101854_130_813 216
45 3300048916 Ga0496113_0107711 Ga0496113_0107711_559_1338 216
46 3300048917 Ga0496114_0005131 Ga0496114_0005131_7379_8062 216
47 3300048918 Ga0496115_0093992 Ga0496115_0093992_1683_2366 216
48 3300025910 Ga0207684_10263864 Ga0207684_102638643 217
49 3300025925 Ga0207650_10032086 Ga0207650_100320865 217
50 3300028794 Ga0307515_10367680 Ga0307515_103676802 218
51 3300030522 Ga0307512_10007042 Ga0307512_100070427 218
52 3300031456 Ga0307513_10060298 Ga0307513_100602982 218
53 3300031649 Ga0307514_10139453 Ga0307514_101394532 218
54 3300046660 Ga0495625_0223483 Ga0495625_0223483_257_946 218
55 3300006028 Ga0070717_10538805 Ga0070717_105388052 219
56 3300039447 Ga0436361_0247637 Ga0436361_0247637_368_1144 219
57 3300005331 Ga0070670_100017650 Ga0070670_1000176505 220
58 3300005334 Ga0068869_100525481 Ga0068869_1005254811 220
59 3300005335 Ga0070666_10023619 Ga0070666_100236192 220
60 3300005340 Ga0070689_100045500 Ga0070689_1000455004 220
61 3300005354 Ga0070675_100010663 Ga0070675_1000106634 220
62 3300005355 Ga0070671_100030178 Ga0070671_1000301784 220
63 3300005364 Ga0070673_100046573 Ga0070673_1000465734 220
64 3300005365 Ga0070688_100140407 Ga0070688_1001404072 220
65 3300005367 Ga0070667_100012482 Ga0070667_1000124824 220
66 3300005543 Ga0070672_100125098 Ga0070672_1001250982 220
67 3300005564 Ga0070664_100011895 Ga0070664_1000118959 220
68 3300005617 Ga0068859_100016294 Ga0068859_1000162948 220
69 3300005841 Ga0068863_100009519 Ga0068863_1000095198 220
70 3300005842 Ga0068858_100015539 Ga0068858_1000155399 220
71 3300005843 Ga0068860_100074525 Ga0068860_1000745251 220
72 3300006237 Ga0097621_100038765 Ga0097621_1000387652 220
73 3300006931 Ga0097620_100016294 Ga0097620_1000162948 220
74 3300009094 Ga0111539_10019197 Ga0111539_100191979 220
75 3300009094 Ga0111539_10769363 Ga0111539_107693631 220
76 3300009148 Ga0105243_10486796 Ga0105243_104867961 220
77 3300009177 Ga0105248_10021284 Ga0105248_100212847 220
78 3300013308 Ga0157375_10013390 Ga0157375_100133907 220
79 3300025903 Ga0207680_10019283 Ga0207680_100192834 220
80 3300025925 Ga0207650_10028583 Ga0207650_100285835 220
81 3300025926 Ga0207659_10006309 Ga0207659_100063099 220
82 3300025931 Ga0207644_10024831 Ga0207644_100248313 220
83 3300025936 Ga0207670_10021211 Ga0207670_100212113 220
84 3300025940 Ga0207691_10059961 Ga0207691_100599611 220
85 3300025941 Ga0207711_10022325 Ga0207711_100223258 220
86 3300025942 Ga0207689_10316239 Ga0207689_103162391 220
87 3300025945 Ga0207679_10091461 Ga0207679_100914612 220
88 3300025945 Ga0207679_10420565 Ga0207679_104205652 220
89 3300025960 Ga0207651_10040312 Ga0207651_100403123 220
90 3300026035 Ga0207703_10454168 Ga0207703_104541682 220
91 3300026088 Ga0207641_10020133 Ga0207641_100201339 220
92 3300026095 Ga0207676_10697774 Ga0207676_106977742 220
93 3300028381 Ga0268264_10007120 Ga0268264_100071208 220
94 3300033180 Ga0307510_10022805 Ga0307510_100228057 220
95 3300046524 Ga0495648_0188090 Ga0495648_0188090_179_874 220
96 3300050511 nmdc:mga08y16_18829_c1 nmdc:mga08y16_18829_c1_6427_7122 220
97 3300050511 nmdc:mga08y16_651470_c1 nmdc:mga08y16_651470_c1_138_866 220
98 3300005471 Ga0070698_100182829 Ga0070698_1001828292 221
99 3300005518 Ga0070699_100111476 Ga0070699_1001114762 221
100 3300006847 Ga0075431_100075503 Ga0075431_1000755033 221
101 3300009147 Ga0114129_10021776 Ga0114129_100217762 221
102 3300050507 nmdc:mga05p37_183314_c1 nmdc:mga05p37_183314_c1_1648_2382 221
103 3300050510 nmdc:mga06r32_65298_c1 nmdc:mga06r32_65298_c1_1012_1746 221
104 3300035692 Ga0373935_0225837 Ga0373935_0225837_13_726 222
105 3300005331 Ga0070670_100030445 Ga0070670_1000304454 223
106 3300005536 Ga0070697_100135818 Ga0070697_1001358182 223
107 3300025925 Ga0207650_10021412 Ga0207650_100214123 223
108 3300025925 Ga0207650_10140741 Ga0207650_101407411 223
109 3300028794 Ga0307515_10193151 Ga0307515_101931512 223
110 3300031456 Ga0307513_10000923 Ga0307513_1000092312 223
111 3300005295 Ga0065707_10215312 Ga0065707_102153123 224
112 3300005444 Ga0070694_100279476 Ga0070694_1002794762 224
113 3300005445 Ga0070708_100444038 Ga0070708_1004440381 224
114 3300005543 Ga0070672_100223034 Ga0070672_1002230341 224
115 3300005615 Ga0070702_100302516 Ga0070702_1003025161 224
116 3300006844 Ga0075428_100064908 Ga0075428_1000649084 224
117 3300006847 Ga0075431_100041020 Ga0075431_1000410206 224
118 3300006871 Ga0075434_100069376 Ga0075434_1000693764 224
119 3300006880 Ga0075429_100491223 Ga0075429_1004912232 224
120 3300009094 Ga0111539_10002716 Ga0111539_1000271611 224
121 3300009147 Ga0114129_10931369 Ga0114129_109313691 224
122 3300013308 Ga0157375_10646754 Ga0157375_106467542 224
123 3300025910 Ga0207684_10081473 Ga0207684_100814735 224
124 3300025940 Ga0207691_10229593 Ga0207691_102295932 224
125 3300026023 Ga0207677_10372573 Ga0207677_103725732 224
126 3300027907 Ga0207428_10034250 Ga0207428_100342502 224
127 3300050507 nmdc:mga05p37_576150_c1 nmdc:mga05p37_576150_c1_69_776 224
128 3300050508 nmdc:mga09592_246334_c1 nmdc:mga09592_246334_c1_627_1334 224
129 3300050515 nmdc:mga0a205_154491_c1 nmdc:mga0a205_154491_c1_781_1488 224
130 3300005467 Ga0070706_100030194 Ga0070706_1000301941 225
131 3300005335 Ga0070666_10059890 Ga0070666_100598903 226
132 3300005356 Ga0070674_100217207 Ga0070674_1002172072 226
133 3300005467 Ga0070706_100000424 Ga0070706_10000042413 226
134 3300005468 Ga0070707_100006253 Ga0070707_1000062534 226
135 3300005536 Ga0070697_100064793 Ga0070697_1000647933 226
136 3300005545 Ga0070695_100186414 Ga0070695_1001864142 226
137 3300005546 Ga0070696_100255999 Ga0070696_1002559992 226
138 3300006058 Ga0075432_10045455 Ga0075432_100454552 226
139 3300006852 Ga0075433_10040787 Ga0075433_100407875 226
140 3300006852 Ga0075433_10056197 Ga0075433_100561971 226
141 3300006852 Ga0075433_10392663 Ga0075433_103926632 226
142 3300006871 Ga0075434_100016863 Ga0075434_1000168631 226
143 3300006871 Ga0075434_100037008 Ga0075434_1000370084 226
144 3300006881 Ga0068865_100433188 Ga0068865_1004331881 226
145 3300007076 Ga0075435_100021060 Ga0075435_1000210604 226
146 3300007076 Ga0075435_100484544 Ga0075435_1004845441 226
147 3300009094 Ga0111539_10525053 Ga0111539_105250532 226
148 3300009147 Ga0114129_10106490 Ga0114129_101064903 226
149 3300011119 Ga0105246_10081391 Ga0105246_100813913 226
150 3300025893 Ga0207682_10158625 Ga0207682_101586252 226
151 3300025907 Ga0207645_10170841 Ga0207645_101708411 226
152 3300025910 Ga0207684_10000004 Ga0207684_10000004316 226
153 3300025922 Ga0207646_10073902 Ga0207646_100739022 226
154 3300025922 Ga0207646_10137920 Ga0207646_101379201 226
155 3300025938 Ga0207704_10523293 Ga0207704_105232931 226
156 3300025940 Ga0207691_10012254 Ga0207691_100122543 226
157 3300025986 Ga0207658_10397383 Ga0207658_103973832 226
158 3300026121 Ga0207683_10219366 Ga0207683_102193664 226
159 3300028380 Ga0268265_10064349 Ga0268265_100643493 226
160 3300048917 Ga0496114_0107829 Ga0496114_0107829_1658_2374 226
161 3300050507 nmdc:mga05p37_562152_c1 nmdc:mga05p37_562152_c1_228_941 226
162 3300050509 nmdc:mga0qj67_715765_c1 nmdc:mga0qj67_715765_c1_13_726 226
163 3300050510 nmdc:mga06r32_554106_c1 nmdc:mga06r32_554106_c1_127_843 226
164 3300050511 nmdc:mga08y16_75604_c1 nmdc:mga08y16_75604_c1_2100_2906 226
165 3300050512 nmdc:mga0n895_181386_c1 nmdc:mga0n895_181386_c1_1066_1851 226
166 3300050512 nmdc:mga0n895_24586_c1 nmdc:mga0n895_24586_c1_3787_4554 226
167 3300050512 nmdc:mga0n895_325051_c1 nmdc:mga0n895_325051_c1_146_859 226
168 3300050513 nmdc:mga0rr50_16031_c1 nmdc:mga0rr50_16031_c1_2679_3446 226
169 3300050513 nmdc:mga0rr50_200660_c1 nmdc:mga0rr50_200660_c1_809_1522 226
170 3300050515 nmdc:mga0a205_102974_c1 nmdc:mga0a205_102974_c1_1822_2607 226
171 3300050515 nmdc:mga0a205_116393_c1 nmdc:mga0a205_116393_c1_1239_2006 226
172 3300005445 Ga0070708_100019255 Ga0070708_1000192556 227
173 3300005518 Ga0070699_100004401 Ga0070699_1000044013 227
174 3300006237 Ga0097621_100188163 Ga0097621_1001881631 227
175 3300006847 Ga0075431_100128156 Ga0075431_1001281562 227
176 3300006880 Ga0075429_100092083 Ga0075429_1000920832 227
177 3300009553 Ga0105249_10788598 Ga0105249_107885982 227
178 3300050508 nmdc:mga09592_19126_c1 nmdc:mga09592_19126_c1_3493_4215 227
179 3300050510 nmdc:mga06r32_151066_c1 nmdc:mga06r32_151066_c1_999_1715 227
180 3300050510 nmdc:mga06r32_573216_c1 nmdc:mga06r32_573216_c1_128_850 227
181 3300005289 Ga0065704_10036078 Ga0065704_100360781 228
182 3300005289 Ga0065704_10186857 Ga0065704_101868571 228
183 3300005334 Ga0068869_100033639 Ga0068869_1000336392 228
184 3300005334 Ga0068869_100479119 Ga0068869_1004791191 228
185 3300005347 Ga0070668_100174883 Ga0070668_1001748832 228
186 3300005354 Ga0070675_100035760 Ga0070675_1000357603 228
187 3300005354 Ga0070675_100683184 Ga0070675_1006831841 228
188 3300005364 Ga0070673_100067909 Ga0070673_1000679095 228
189 3300005439 Ga0070711_100285736 Ga0070711_1002857361 228
190 3300005439 Ga0070711_100455806 Ga0070711_1004558061 228
191 3300005468 Ga0070707_100377345 Ga0070707_1003773451 228
192 3300005471 Ga0070698_100060294 Ga0070698_1000602943 228
193 3300005471 Ga0070698_100253836 Ga0070698_1002538362 228
194 3300005518 Ga0070699_100016974 Ga0070699_1000169745 228
195 3300005536 Ga0070697_100004747 Ga0070697_1000047477 228
196 3300005536 Ga0070697_100118163 Ga0070697_1001181633 228
197 3300005543 Ga0070672_100045422 Ga0070672_1000454225 228
198 3300005546 Ga0070696_100244501 Ga0070696_1002445011 228
199 3300005617 Ga0068859_100000002 Ga0068859_100000002307 228
200 3300005719 Ga0068861_100537379 Ga0068861_1005373792 228
201 3300006173 Ga0070716_100333979 Ga0070716_1003339792 228
202 3300006844 Ga0075428_100060996 Ga0075428_1000609962 228
203 3300006846 Ga0075430_100221413 Ga0075430_1002214132 228
204 3300006846 Ga0075430_100646018 Ga0075430_1006460181 228
205 3300006847 Ga0075431_100322297 Ga0075431_1003222972 228
206 3300006847 Ga0075431_100508202 Ga0075431_1005082022 228
207 3300006852 Ga0075433_10415783 Ga0075433_104157832 228
208 3300006852 Ga0075433_10426921 Ga0075433_104269211 228
209 3300006880 Ga0075429_100244504 Ga0075429_1002445042 228
210 3300006931 Ga0097620_100000002 Ga0097620_100000002153 228
211 3300007076 Ga0075435_100262818 Ga0075435_1002628182 228
212 3300007265 Ga0099794_10099427 Ga0099794_100994272 228
213 3300009094 Ga0111539_10019711 Ga0111539_100197115 228
214 3300009147 Ga0114129_10046808 Ga0114129_100468082 228
215 3300009147 Ga0114129_10051684 Ga0114129_100516844 228
216 3300009147 Ga0114129_10117650 Ga0114129_101176504 228
217 3300009147 Ga0114129_10553903 Ga0114129_105539031 228
218 3300009148 Ga0105243_10707837 Ga0105243_107078372 228
219 3300009545 Ga0105237_10432439 Ga0105237_104324391 228
220 3300009553 Ga0105249_10409974 Ga0105249_104099741 228
221 3300009553 Ga0105249_10551109 Ga0105249_105511091 228
222 3300013296 Ga0157374_10180712 Ga0157374_101807123 228
223 3300013306 Ga0163162_10470464 Ga0163162_104704641 228
224 3300014745 Ga0157377_10623058 Ga0157377_106230581 228
225 3300014969 Ga0157376_10038416 Ga0157376_100384163 228
226 3300017792 Ga0163161_10330687 Ga0163161_103306871 228
227 3300022730 Ga0224570_100276 Ga0224570_1002762 228
228 3300025901 Ga0207688_10082800 Ga0207688_100828002 228
229 3300025906 Ga0207699_10218997 Ga0207699_102189971 228
230 3300025926 Ga0207659_10164725 Ga0207659_101647253 228
231 3300025927 Ga0207687_10267606 Ga0207687_102676062 228
232 3300025928 Ga0207700_10678454 Ga0207700_106784541 228
233 3300025940 Ga0207691_10073711 Ga0207691_100737113 228
234 3300025942 Ga0207689_10057423 Ga0207689_100574232 228
235 3300025961 Ga0207712_10427063 Ga0207712_104270631 228
236 3300026075 Ga0207708_10412337 Ga0207708_104123372 228
237 3300026118 Ga0207675_100449413 Ga0207675_1004494132 228
238 3300027907 Ga0207428_10099543 Ga0207428_100995431 228
239 3300028016 Ga0265354_1005122 Ga0265354_10051221 228
240 3300028017 Ga0265356_1000214 Ga0265356_10002148 228
241 3300030760 Ga0265762_1002238 Ga0265762_10022382 228
242 3300030878 Ga0265770_1002433 Ga0265770_10024332 228
243 3300031090 Ga0265760_10013826 Ga0265760_100138263 228
244 3300033545 Ga0316214_1011746 Ga0316214_10117462 228
245 3300035111 Ga0373923_0051926 Ga0373923_0051926_187_918 228
246 3300035242 Ga0373962_0097254 Ga0373962_0097254_145_867 228
247 3300035410 Ga0373924_0025648 Ga0373924_0025648_28_759 228
248 3300035725 Ga0373947_0156251 Ga0373947_0156251_28_759 228
249 3300037068 Ga0373925_0245798 Ga0373925_0245798_624_1355 228
250 3300046472 Ga0495580_0078824 Ga0495580_0078824_320_1171 228
251 3300046516 Ga0495628_0003912 Ga0495628_0003912_3212_3931 228
252 3300046691 Ga0495670_0221194 Ga0495670_0221194_88_900 228
253 3300050507 nmdc:mga05p37_16039_c1 nmdc:mga05p37_16039_c1_6364_7092 228
254 3300050507 nmdc:mga05p37_431993_c1 nmdc:mga05p37_431993_c1_420_1268 228
255 3300050507 nmdc:mga05p37_940137_c1 nmdc:mga05p37_940137_c1_87_890 228
256 3300050507 nmdc:mga05p37_94321_c1 nmdc:mga05p37_94321_c1_1668_2387 228
257 3300050509 nmdc:mga0qj67_319375_c1 nmdc:mga0qj67_319375_c1_210_989 228
258 3300050509 nmdc:mga0qj67_480136_c1 nmdc:mga0qj67_480136_c1_145_906 228
259 3300050510 nmdc:mga06r32_312002_c1 nmdc:mga06r32_312002_c1_322_1041 228
260 3300050510 nmdc:mga06r32_721367_c1 nmdc:mga06r32_721367_c1_160_921 228
261 3300050511 nmdc:mga08y16_87714_c1 nmdc:mga08y16_87714_c1_716_1435 228
262 3300050513 nmdc:mga0rr50_108250_c1 nmdc:mga0rr50_108250_c1_979_1839 228
263 3300050515 nmdc:mga0a205_139383_c1 nmdc:mga0a205_139383_c1_1424_2143 228
264 3300050515 nmdc:mga0a205_434522_c1 nmdc:mga0a205_434522_c1_262_1080 228
265 3300050515 nmdc:mga0a205_48547_c1 nmdc:mga0a205_48547_c1_130_849 228
266 3300050515 nmdc:mga0a205_640704_c1 nmdc:mga0a205_640704_c1_17_820 228
267 3300053117 Ga0500593_070538 Ga0500593_070538_51_827 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12695

Abhydrolase_5

Alpha/beta hydrolase family

44

162

0.82

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

45

258

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.8908 13 220
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.889 13 218
5y51-assembly4.cif.gz_D crystal structure of pyth_h230a 0.8858 10 221
5y51-assembly5.cif.gz_E crystal structure of pyth_h230a 0.8836 10 224
5y5r-assembly5.cif.gz_E crystal structure of a novel pyrethroid hydrolase pyth with bif 0.8829 10 224
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9195 12 222 3.40.50.1820
af_A0A0N7KCX9_11_155_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8514 10 111 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8493 12 222 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8334 10 220 3.40.50.1820
af_O23512_10_262_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.821 10 228 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A534JV55-F1-model_v4 Alpha/beta hydrolase 0.9821 9 111 GO:0016787
AF-A0A699XEJ8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9703 9 98
AF-A0A3D5ING0-F1-model_v4 deleted 0.9695 6 91
AF-A0A528HDK7-F1-model_v4 Alpha/beta hydrolase 0.9678 6 107 GO:0016787
AF-A0A2V9SHE4-F1-model_v4 Alpha/beta hydrolase 0.9651 10 134 GO:0016787

Feature Viewer

pLDDT pTM Quality
87.39 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map