F374446

General Info

Members Datasets Scaffolds Average Seq Length
266 224 209 442

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8025530807|8025535008
Length 500
Sequence CFLRASWAGLKVDQSIPRKLSRRRPVPETELSMTTRIPEPALSEASRPSDPRKMRKIAVASVIGTTVEWYDLFVFGTASALVFDKIFFPQLDGTVGTILAFLTFASAYLARMVGAVVFGHFGDRIGRKSMLLTSLMMMGIATFAIGLVPDYNTIGVAAPFLLLALRVVQGLALGGEWGGAVLMTVEHAPADRRGFFGSTVQIGVPIGTLLANGVFLLVAWQTSSAELHSWGWRIPFLLSAVLVCVGIYIRLNIEETSTFQAVREAGAKARIPFVALMRRYWRQVLLGGIATLSTGSTFTLLITSGVNYGTDELGHSESLMLWAVMAACAIAFVLIPFFGHLSDRFGRKPVIYAGVAAEAFLAFPFFWLLDTGSAPLVFVAYALMAAAFSANYGPIATFLAELFGARVRYSGLSVAYMLSGLLGSAATPVITLWLLSLTGNSSSIAWYILAASAASLIALFLLSETRFGSISEDGGEGEGEGDAASVSASVSVTADAEARV

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231014 Pseudomonas sp. GM48 Isolate Nodule
4 2511231015 Pseudomonas sp. GM49 Isolate Nodule
5 2511231016 Pseudomonas sp. GM50 Isolate Nodule
6 2511231017 Pseudomonas sp. GM55 Isolate Nodule
7 2511231018 Pseudomonas sp. GM60 Isolate Nodule
8 2511231019 Pseudomonas sp. GM67 Isolate Nodule
9 2511231020 Pseudomonas sp. GM74 Isolate Nodule
10 2511231024 Pseudomonas sp. GM84 Isolate Nodule
11 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
12 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
13 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
14 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
15 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
16 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
17 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
18 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
19 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
20 2643221558 Rhizobium sp. Root149 Isolate Unclassified
21 2643221607 Rhizobium sp. Root73 Isolate Unclassified
22 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
23 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
24 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
25 2643221696 Nocardioides sp. Root140 Isolate Unclassified
26 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
27 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
28 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
29 2739367653 Kocuria sp. OV113 Isolate Unclassified
30 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
31 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
32 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
33 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
34 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
35 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
36 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
37 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
38 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
39 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
40 2855730933 Achromobacter sp. HZ28 Isolate Nodule
41 2855767633 Achromobacter sp. HZ34 Isolate Nodule
42 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
43 2857727296 Kocuria sp. R-72562 Isolate Unclassified
44 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
45 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
46 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
47 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
48 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
49 2920879853 Kocuria salina CV6 Isolate Unclassified
50 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
51 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
52 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
53 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
54 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
55 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
56 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
57 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
58 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
59 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
218 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
219 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
220 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
223 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
224 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.57
Metatranscriptomes 0
Isolates 21.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.89
Nodule 7.52
Rhizoplane 3.01
Rhizosphere 62.41
Stem 0
Stem Tuber 0
Unclassified 19.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000030 3300002704 Bacteria 114492
2 JGI25156J39149_1000059 3300002705 Bacteria 86130
3 JGI25154J39366_1000056 3300002738 Bacteria 114494
4 JGI25157J39369_1000123 3300002741 Bacteria 65925
5 Ga0055532_1000059 3300003758 Bacteria 152948
6 Ga0055535_1004336 3300003761 Bacteria 3488
7 Ga0055526_1000444 3300003771 Bacteria 32945
8 Ga0055524_1000031 3300003775 Bacteria 187744
9 Ga0070677_10018354 3300005333 Bacteria 2518
10 Ga0070675_100066601 3300005354 Bacteria 2979
11 Ga0070671_100137141 3300005355 Bacteria 2063
12 Ga0070674_100064403 3300005356 Bacteria 2568
13 Ga0070673_100063684 3300005364 Bacteria 2935
14 Ga0070679_100036691 3300005530 Bacteria 4865
15 Ga0068855_100016481 3300005563 Bacteria 8885
16 Ga0068852_100004286 3300005616 Bacteria 10064
17 Ga0081455_10117463 3300005937 Bacteria 2102
18 Ga0075364_10004656 3300006051 Bacteria 7912
19 Ga0075364_10041343 3300006051 Bacteria 2993
20 Ga0099823_1000047 3300006944 Bacteria 58430
21 Ga0079104_1000193 3300006946 Bacteria 85489
22 Ga0105244_10077484 3300009036 Bacteria 1649
23 Ga0105250_10006070 3300009092 Bacteria 5321
24 Ga0105240_10000344 3300009093 Bacteria 87083
25 Ga0105237_10094953 3300009545 Bacteria 2971
26 Ga0105238_10029843 3300009551 Bacteria 5553
27 Ga0105249_10038139 3300009553 Bacteria 4359
28 Ga0157373_10090839 3300013100 Bacteria 2151
29 Ga0157369_10270228 3300013105 Bacteria 1772
30 Ga0163162_10025174 3300013306 Bacteria 5882
31 Ga0157372_10286195 3300013307 Bacteria 1917
32 Ga0157375_10030689 3300013308 Bacteria 5072
33 Ga0182008_10011185 3300014497 Bacteria 4785
34 Ga0182006_1004018 3300015261 Bacteria 7339
35 Ga0209435_100032 3300025206 Bacteria 153068
36 Ga0209147_100109 3300025229 Bacteria 153068
37 Ga0209437_100261 3300025233 Bacteria 82127
38 Ga0209258_100190 3300025242 Bacteria 126878
39 Ga0209646_1000113 3300025246 Bacteria 153068
40 Ga0209026_1000102 3300025250 Bacteria 153068
41 Ga0209759_1000104 3300025256 Bacteria 153068
42 Ga0209675_1002025 3300025291 Bacteria 10833
43 Ga0209564_1000135 3300025295 Bacteria 188117
44 Ga0209256_1000107 3300025299 Bacteria 186233
45 Ga0207426_1001323 3300025302 Bacteria 21124
46 Ga0207426_1001651 3300025302 Bacteria 17358
47 Ga0207426_1005652 3300025302 Bacteria 5655
48 Ga0209051_1007771 3300025303 Bacteria 5800
49 Ga0207697_10023531 3300025315 Bacteria 2522
50 Ga0207696_1002710 3300025711 Bacteria 8476
51 Ga0207655_1028420 3300025728 Bacteria 2639
52 Ga0207713_1020539 3300025735 Bacteria 3196
53 Ga0207680_10114962 3300025903 Bacteria 1752
54 Ga0207695_10001722 3300025913 Bacteria 34994
55 Ga0207652_10271285 3300025921 Bacteria 1530
56 Ga0207687_10014212 3300025927 Bacteria 5208
57 Ga0207669_10075572 3300025937 Bacteria 2135
58 Ga0207691_10023019 3300025940 Bacteria 5868
59 Ga0207667_10005245 3300025949 Bacteria 15813
60 Ga0207712_10060525 3300025961 Bacteria 2685
61 Ga0207675_100055793 3300026118 Bacteria 3686
62 Ga0207683_10021730 3300026121 Bacteria 5500
63 Ga0207698_10002888 3300026142 Bacteria 10282
64 Ga0209281_1000034 3300027111 Bacteria 382562
65 Ga0209389_1000116 3300027296 Bacteria 71576
66 Ga0307515_10030752 3300028794 Bacteria 8997
67 Ga0307515_10161953 3300028794 Bacteria 2277
68 Ga0265328_10001104 3300031239 Bacteria 12408
69 Ga0265327_10000004 3300031251 Bacteria 803973
70 Ga0307513_10015597 3300031456 Bacteria 9202
71 Ga0307508_10007002 3300031616 Bacteria 10515
72 Ga0307508_10071313 3300031616 Bacteria 3047
73 Ga0307514_10009902 3300031649 Bacteria 7984
74 Ga0307514_10016538 3300031649 Bacteria 6077
75 Ga0307516_10045978 3300031730 Bacteria 4309
76 Ga0307410_10072075 3300031852 Bacteria 2398
77 Ga0307406_10000703 3300031901 Bacteria 18900
78 Ga0307416_100023361 3300032002 Bacteria 4486
79 Ga0307416_100120716 3300032002 Bacteria 2335
80 Ga0307510_10008147 3300033180 Bacteria 12480
81 Ga0395900_0027855 3300037418 Bacteria 5789
82 Ga0395898_0015670 3300037466 Bacteria 7768
83 Ga0395905_0000160 3300037471 Bacteria 111265
84 Ga0395901_0178930 3300038443 Bacteria 2224
85 Ga0436362_0025731 3300039453 Bacteria 5582
86 Ga0436362_0805059 3300039453 Bacteria 2590
87 Ga0466961_0004419 3300044693 Bacteria 8801
88 Ga0466968_0012687 3300044735 Bacteria 3305
89 Ga0466959_0004689 3300045049 Bacteria 9204
90 Ga0466958_0003198 3300045836 Bacteria 8449
91 Ga0495627_000338 3300046453 Bacteria 44224
92 Ga0495591_000016 3300046458 Bacteria 244927
93 Ga0495629_0004461 3300046459 Bacteria 10489
94 Ga0495653_0000074 3300046463 Bacteria 83844
95 Ga0495650_0000950 3300046471 Bacteria 33495
96 Ga0495650_0012484 3300046471 Bacteria 4567
97 Ga0495650_0013491 3300046471 Bacteria 4316
98 Ga0495580_0081353 3300046472 Bacteria 2257
99 Ga0495582_0044831 3300046473 Bacteria 2435
100 Ga0495605_0000244 3300046474 Bacteria 64456
101 Ga0495605_0002546 3300046474 Bacteria 11231
102 Ga0495639_0007212 3300046475 Bacteria 4770
103 Ga0495585_0000469 3300046492 Bacteria 38600
104 Ga0495585_0000792 3300046492 Bacteria 27747
105 Ga0495585_0009370 3300046492 Bacteria 5875
106 Ga0495607_0000031 3300046501 Bacteria 153964
107 Ga0495607_0000448 3300046501 Bacteria 41496
108 Ga0495607_0012898 3300046501 Bacteria 5496
109 Ga0495583_0002279 3300046506 Bacteria 16804
110 Ga0495606_0000191 3300046507 Bacteria 107427
111 Ga0495631_0001821 3300046518 Bacteria 12596
112 Ga0495632_0001006 3300046519 Bacteria 24447
113 Ga0495632_0006935 3300046519 Bacteria 7191
114 Ga0495632_0018115 3300046519 Bacteria 3871
115 Ga0495637_0007230 3300046520 Bacteria 5522
116 Ga0495637_0013946 3300046520 Bacteria 3803
117 Ga0495637_0040323 3300046520 Bacteria 2011
118 Ga0495643_0035514 3300046522 Bacteria 2745
119 Ga0495642_0000842 3300046528 Bacteria 14666
120 Ga0495654_0002091 3300046530 Bacteria 13071
121 Ga0495609_0023821 3300046538 Bacteria 2811
122 Ga0495597_0000128 3300046542 Bacteria 68991
123 Ga0495597_0004805 3300046542 Bacteria 7300
124 Ga0495645_0016329 3300046543 Bacteria 5298
125 Ga0495667_0029571 3300046559 Bacteria 3688
126 Ga0495668_0065596 3300046616 Bacteria 1998
127 Ga0495625_0039607 3300046660 Bacteria 3440
128 Ga0495625_0047020 3300046660 Bacteria 3112
129 Ga0495625_0053597 3300046660 Bacteria 2884
130 Ga0495661_0000013 3300046665 Bacteria 259387
131 Ga0495588_0007749 3300046674 Bacteria 4904
132 Ga0495588_0027464 3300046674 Bacteria 2844
133 Ga0495588_0053978 3300046674 Bacteria 2073
134 Ga0495613_0030993 3300046689 Bacteria 3971
135 Ga0495670_0000794 3300046691 Bacteria 15179
136 Ga0495670_0001356 3300046691 Bacteria 11951
137 Ga0495671_0000780 3300046692 Bacteria 22874
138 Ga0495671_0012913 3300046692 Bacteria 4546
139 Ga0495671_0014162 3300046692 Bacteria 4297
140 Ga0495660_0000088 3300046810 Bacteria 98970
141 Ga0495660_0000566 3300046810 Bacteria 29974
142 Ga0495581_0003252 3300047315 Bacteria 9315
143 Ga0495636_0002823 3300047318 Bacteria 6701
144 Ga0495672_0001094 3300047320 Bacteria 27523
145 Ga0495672_0007941 3300047320 Bacteria 7911
146 Ga0495672_0013842 3300047320 Bacteria 5547
147 Ga0495676_0003012 3300047321 Bacteria 15226
148 Ga0495683_0000110 3300047323 Bacteria 83927
149 Ga0495687_000050 3300047443 Bacteria 200856
150 Ga0495673_0002403 3300047469 Bacteria 13199
151 Ga0495673_0022204 3300047469 Bacteria 3115
152 Ga0495681_0000081 3300047470 Bacteria 83631
153 Ga0495593_0089354 3300047673 Bacteria 1587
154 Ga0496102_0033396 3300048905 Bacteria 4623
155 Ga0496103_0025742 3300048906 Bacteria 3558
156 Ga0496104_0058040 3300048907 Bacteria 3663
157 Ga0496106_0000054 3300048909 Bacteria 93869
158 Ga0496110_0038842 3300048913 Bacteria 4143
159 Ga0496111_0100324 3300048914 Bacteria 2126
160 Ga0496114_0003723 3300048917 Bacteria 11744
161 Ga0496115_0031562 3300048918 Bacteria 4175
162 Ga0496116_0016208 3300048919 Bacteria 5845
163 Ga0496116_0026061 3300048919 Bacteria 4284
164 Ga0496116_0060647 3300048919 Bacteria 2453
165 Ga0496119_0012349 3300048922 Bacteria 6946
166 Ga0496121_0003976 3300048924 Bacteria 20389
167 Ga0496121_0011732 3300048924 Bacteria 9669
168 Ga0496121_0037235 3300048924 Bacteria 4324
169 Ga0496121_0061938 3300048924 Bacteria 3067
170 Ga0496122_0000215 3300048925 Bacteria 128810
171 Ga0496122_0000225 3300048925 Bacteria 126304
172 Ga0496123_0000192 3300048926 Bacteria 124096
173 Ga0496124_0086736 3300048927 Bacteria 2561
174 Ga0496125_0000207 3300048928 Bacteria 122897
175 Ga0496125_0000947 3300048928 Bacteria 45544
176 Ga0496125_0003130 3300048928 Bacteria 20549
177 Ga0495682_0000111 3300049460 Bacteria 71459
178 Ga0495682_0001840 3300049460 Bacteria 10653
179 Ga0501031_0000712 3300049568 Bacteria 19893
180 Ga0501032_0001162 3300049569 Bacteria 21118
181 Ga0501033_0000163 3300049570 Bacteria 63913
182 Ga0501034_0000202 3300049571 Bacteria 112985
183 Ga0501034_0000554 3300049571 Bacteria 59304
184 Ga0501036_0000021 3300049572 Bacteria 114136
185 Ga0501037_0001561 3300049573 Bacteria 16713
186 Ga0501038_0000226 3300049574 Bacteria 47831
187 Ga0501039_0012759 3300049575 Bacteria 6422
188 Ga0501043_0000297 3300049579 Bacteria 44905
189 Ga0501046_0000354 3300049580 Bacteria 46165
190 Ga0501047_0000232 3300049581 Bacteria 66245
191 Ga0501048_0000050 3300049582 Bacteria 57921
192 Ga0501067_0001956 3300049583 Bacteria 11350
193 Ga0501068_0000830 3300049584 Bacteria 16073
194 Ga0501070_0006783 3300049586 Bacteria 9742
195 Ga0501071_0058243 3300049587 Bacteria 2793
196 Ga0501072_0009910 3300049588 Bacteria 7245
197 Ga0501073_0000888 3300049589 Bacteria 21425
198 Ga0501074_0000092 3300049590 Bacteria 43073
199 Ga0501079_0007384 3300049741 Bacteria 8316
200 Ga0501083_0010061 3300049744 Bacteria 6667
201 Ga0501035_0000120 3300049822 Bacteria 94532
202 Ga0501044_0000179 3300049823 Bacteria 78633
203 Ga0501045_0022680 3300049824 Bacteria 4495
204 nmdc:mga00v17_639_c1 3300050491 Bacteria 19367
205 Ga0500618_001899 3300053125 Bacteria 8632
206 Ga0500659_0003036 3300053135 Bacteria 9993
207 Ga0500573_0001766 3300053140 Bacteria 10516
208 Ga0500577_0001217 3300053142 Bacteria 6587
209 Ga0501084_0051392 3300054114 Bacteria 3449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10000004 Ga0265327_1000000457 403
2 3300048919 Ga0496116_0016208 Ga0496116_0016208_29_1249 406
3 iso_pu_bacteria 2643221696 2644530968 407
4 iso_pu_bacteria 2537561592 2537899173 408
5 iso_pu_bacteria 2582581865 2585389070 408
6 3300046459 Ga0495629_0004461 Ga0495629_0004461_348_1700 410
7 3300046471 Ga0495650_0000950 Ga0495650_0000950_15920_17272 410
8 3300046472 Ga0495580_0081353 Ga0495580_0081353_242_1594 410
9 3300046473 Ga0495582_0044831 Ga0495582_0044831_671_2023 410
10 3300046475 Ga0495639_0007212 Ga0495639_0007212_1595_2947 410
11 3300046528 Ga0495642_0000842 Ga0495642_0000842_9700_11052 410
12 3300046543 Ga0495645_0016329 Ga0495645_0016329_3614_4966 410
13 3300046559 Ga0495667_0029571 Ga0495667_0029571_671_2023 410
14 3300046689 Ga0495613_0030993 Ga0495613_0030993_2507_3859 410
15 3300047315 Ga0495581_0003252 Ga0495581_0003252_7333_8685 410
16 3300048918 Ga0496115_0031562 Ga0496115_0031562_2551_3903 410
17 3300009036 Ga0105244_10077484 Ga0105244_100774842 412
18 3300046463 Ga0495653_0000074 Ga0495653_0000074_79907_81187 412
19 3300046616 Ga0495668_0065596 Ga0495668_0065596_381_1724 412
20 3300047320 Ga0495672_0007941 Ga0495672_0007941_2595_3890 412
21 3300047469 Ga0495673_0022204 Ga0495673_0022204_784_2079 412
22 3300048907 Ga0496104_0058040 Ga0496104_0058040_1942_3237 412
23 3300048924 Ga0496121_0003976 Ga0496121_0003976_6211_7506 412
24 3300048927 Ga0496124_0086736 Ga0496124_0086736_1158_2501 412
25 3300049460 Ga0495682_0000111 Ga0495682_0000111_55207_56484 412
26 3300044693 Ga0466961_0004419 Ga0466961_0004419_4773_6092 413
27 3300044735 Ga0466968_0012687 Ga0466968_0012687_1723_3042 413
28 3300045049 Ga0466959_0004689 Ga0466959_0004689_2763_4082 413
29 3300045836 Ga0466958_0003198 Ga0466958_0003198_6680_7999 413
30 3300009092 Ga0105250_10006070 Ga0105250_100060702 414
31 3300025302 Ga0207426_1001323 Ga0207426_10013237 414
32 3300025711 Ga0207696_1002710 Ga0207696_10027105 414
33 3300025302 Ga0207426_1005652 Ga0207426_10056522 415
34 iso_pu_bacteria 2643221550 2643772005 415
35 3300048922 Ga0496119_0012349 Ga0496119_0012349_4011_5405 417
36 iso_pu_bacteria 2891088606 2891091905 417
37 3300006946 Ga0079104_1000193 Ga0079104_100019359 418
38 3300025302 Ga0207426_1001651 Ga0207426_10016513 418
39 3300027111 Ga0209281_1000034 Ga0209281_100003459 418
40 3300046492 Ga0495585_0000792 Ga0495585_0000792_12131_13417 418
41 3300046507 Ga0495606_0000191 Ga0495606_0000191_1444_2742 418
42 3300046520 Ga0495637_0040323 Ga0495637_0040323_209_1507 418
43 3300046665 Ga0495661_0000013 Ga0495661_0000013_70244_71530 418
44 3300048924 Ga0496121_0061938 Ga0496121_0061938_321_1625 418
45 3300009553 Ga0105249_10038139 Ga0105249_100381394 419
46 3300013105 Ga0157369_10270228 Ga0157369_102702281 419
47 3300013306 Ga0163162_10025174 Ga0163162_100251744 419
48 3300013307 Ga0157372_10286195 Ga0157372_102861952 419
49 3300025927 Ga0207687_10014212 Ga0207687_100142124 419
50 3300038443 Ga0395901_0178930 Ga0395901_0178930_237_1577 419
51 iso_pu_bacteria 2866612099 2866614382 419
52 3300025961 Ga0207712_10060525 Ga0207712_100605252 420
53 3300031616 Ga0307508_10071313 Ga0307508_100713132 420
54 3300031901 Ga0307406_10000703 Ga0307406_100007033 420
55 3300032002 Ga0307416_100120716 Ga0307416_1001207162 420
56 3300049571 Ga0501034_0000554 Ga0501034_0000554_37099_38460 420
57 iso_pu_bacteria 2899359706 2899366061 420
58 3300031239 Ga0265328_10001104 Ga0265328_100011045 421
59 3300031616 Ga0307508_10007002 Ga0307508_100070027 421
60 3300031730 Ga0307516_10045978 Ga0307516_100459782 421
61 3300005530 Ga0070679_100036691 Ga0070679_1000366913 422
62 3300005937 Ga0081455_10117463 Ga0081455_101174632 422
63 3300025921 Ga0207652_10271285 Ga0207652_102712851 422
64 3300037418 Ga0395900_0027855 Ga0395900_0027855_3769_5124 422
65 3300037466 Ga0395898_0015670 Ga0395898_0015670_4795_6150 422
66 3300046474 Ga0495605_0000244 Ga0495605_0000244_3117_4433 422
67 3300046810 Ga0495660_0000566 Ga0495660_0000566_13931_15247 422
68 3300049568 Ga0501031_0000712 Ga0501031_0000712_2828_4183 422
69 3300049569 Ga0501032_0001162 Ga0501032_0001162_6706_8061 422
70 3300049570 Ga0501033_0000163 Ga0501033_0000163_31090_32445 422
71 3300049571 Ga0501034_0000202 Ga0501034_0000202_9243_10598 422
72 3300049572 Ga0501036_0000021 Ga0501036_0000021_22614_23969 422
73 3300049573 Ga0501037_0001561 Ga0501037_0001561_11376_12731 422
74 3300049574 Ga0501038_0000226 Ga0501038_0000226_5604_6959 422
75 3300049575 Ga0501039_0012759 Ga0501039_0012759_4515_5870 422
76 3300049579 Ga0501043_0000297 Ga0501043_0000297_11807_13162 422
77 3300049580 Ga0501046_0000354 Ga0501046_0000354_23827_25182 422
78 3300049581 Ga0501047_0000232 Ga0501047_0000232_22335_23690 422
79 3300049582 Ga0501048_0000050 Ga0501048_0000050_9957_11312 422
80 3300049583 Ga0501067_0001956 Ga0501067_0001956_9017_10372 422
81 3300049584 Ga0501068_0000830 Ga0501068_0000830_3492_4847 422
82 3300049586 Ga0501070_0006783 Ga0501070_0006783_2080_3435 422
83 3300049587 Ga0501071_0058243 Ga0501071_0058243_82_1437 422
84 3300049588 Ga0501072_0009910 Ga0501072_0009910_4248_5603 422
85 3300049589 Ga0501073_0000888 Ga0501073_0000888_19204_20559 422
86 3300049590 Ga0501074_0000092 Ga0501074_0000092_22787_24142 422
87 3300049741 Ga0501079_0007384 Ga0501079_0007384_1514_2869 422
88 3300049744 Ga0501083_0010061 Ga0501083_0010061_311_1666 422
89 3300049822 Ga0501035_0000120 Ga0501035_0000120_59302_60657 422
90 3300049823 Ga0501044_0000179 Ga0501044_0000179_67037_68392 422
91 3300049824 Ga0501045_0022680 Ga0501045_0022680_664_2019 422
92 3300054114 Ga0501084_0051392 Ga0501084_0051392_1073_2428 422
93 iso_pu_bacteria 2643221689 2644499658 422
94 iso_pu_bacteria 2791355253 2793280314 422
95 iso_pu_bacteria 2840878972 2840879869 422
96 iso_pu_bacteria 3000017691 3000021228 422
97 iso_pu_bacteria 8018150411 8018153216 422
98 3300048925 Ga0496122_0000215 Ga0496122_0000215_37676_38968 423
99 iso_pu_bacteria 2510917022 2511131483 423
100 iso_pu_bacteria 2511231004 2511258328 423
101 iso_pu_bacteria 2511231014 2511316138 423
102 iso_pu_bacteria 2511231015 2511317849 423
103 iso_pu_bacteria 2511231016 2511329068 423
104 iso_pu_bacteria 2511231017 2511331929 423
105 iso_pu_bacteria 2511231018 2511337871 423
106 iso_pu_bacteria 2511231019 2511347620 423
107 iso_pu_bacteria 2511231020 2511352710 423
108 iso_pu_bacteria 2511231024 2511375232 423
109 iso_pu_bacteria 2513237087 2513590114 423
110 iso_pu_bacteria 2562617112 2563057896 423
111 iso_pu_bacteria 2582581283 2585166338 423
112 iso_pu_bacteria 2582581306 2585267435 423
113 iso_pu_bacteria 2582581315 2585327163 423
114 iso_pu_bacteria 2582581865 2585386503 423
115 iso_pu_bacteria 2582581866 2585393246 423
116 iso_pu_bacteria 2643221558 2643811542 423
117 iso_pu_bacteria 2643221607 2644050529 423
118 iso_pu_bacteria 2643221636 2644205757 423
119 iso_pu_bacteria 2643221686 2644483447 423
120 iso_pu_bacteria 2711768613 2713473402 423
121 iso_pu_bacteria 2738543015 2739258117 423
122 iso_pu_bacteria 2821123053 2821127500 423
123 iso_pu_bacteria 2838736955 2838738024 423
124 iso_pu_bacteria 2841840854 2841841607 423
125 iso_pu_bacteria 2842140634 2842141385 423
126 iso_pu_bacteria 2857531043 2857536487 423
127 iso_pu_bacteria 2908669403 2908670483 423
128 iso_pu_bacteria 3007511990 3007515556 423
129 3300025303 Ga0209051_1007771 Ga0209051_10077714 424
130 3300039453 Ga0436362_0025731 Ga0436362_0025731_535_1872 424
131 3300039453 Ga0436362_0805059 Ga0436362_0805059_1199_2530 424
132 3300046471 Ga0495650_0013491 Ga0495650_0013491_1283_2608 424
133 3300046492 Ga0495585_0000469 Ga0495585_0000469_30673_31998 424
134 3300046506 Ga0495583_0002279 Ga0495583_0002279_6124_7437 424
135 3300046519 Ga0495632_0001006 Ga0495632_0001006_9131_10444 424
136 3300046520 Ga0495637_0013946 Ga0495637_0013946_1175_2488 424
137 3300046692 Ga0495671_0000780 Ga0495671_0000780_6811_8136 424
138 3300047320 Ga0495672_0013842 Ga0495672_0013842_454_1779 424
139 iso_pu_bacteria 2775507049 2776913913 424
140 iso_pu_bacteria 2855730933 2855732264 424
141 iso_pu_bacteria 2855767633 2855768972 424
142 3300026118 Ga0207675_100055793 Ga0207675_1000557932 425
143 3300028794 Ga0307515_10161953 Ga0307515_101619531 425
144 3300031456 Ga0307513_10015597 Ga0307513_100155976 425
145 3300031649 Ga0307514_10009902 Ga0307514_100099024 425
146 3300031649 Ga0307514_10016538 Ga0307514_100165383 425
147 3300033180 Ga0307510_10008147 Ga0307510_100081476 425
148 3300046660 Ga0495625_0039607 Ga0495625_0039607_1163_2524 425
149 3300046660 Ga0495625_0047020 Ga0495625_0047020_116_1477 425
150 3300053140 Ga0500573_0001766 Ga0500573_0001766_3950_5248 425
151 iso_pu_bacteria 2739367653 2739603883 425
152 iso_pu_bacteria 2816332305 2817509614 425
153 iso_pu_bacteria 2857727296 2857729462 425
154 iso_pu_bacteria 643348564 643592383 425
155 3300046453 Ga0495627_000338 Ga0495627_000338_34135_35460 426
156 3300046471 Ga0495650_0012484 Ga0495650_0012484_2385_3710 426
157 3300046518 Ga0495631_0001821 Ga0495631_0001821_753_2078 426
158 3300046519 Ga0495632_0006935 Ga0495632_0006935_3451_4776 426
159 3300046519 Ga0495632_0018115 Ga0495632_0018115_2176_3501 426
160 3300046530 Ga0495654_0002091 Ga0495654_0002091_4692_6017 426
161 3300046674 Ga0495588_0053978 Ga0495588_0053978_318_1688 426
162 3300046692 Ga0495671_0012913 Ga0495671_0012913_1094_2419 426
163 3300047320 Ga0495672_0001094 Ga0495672_0001094_1438_2763 426
164 3300047673 Ga0495593_0089354 Ga0495593_0089354_92_1423 426
165 iso_pu_bacteria 2920879853 2920883585 426
166 iso_pu_bacteria 2945968032 2945968954 426
167 3300003771 Ga0055526_1000444 Ga0055526_10004443 427
168 3300003775 Ga0055524_1000031 Ga0055524_100003192 427
169 3300005333 Ga0070677_10018354 Ga0070677_100183541 427
170 3300005354 Ga0070675_100066601 Ga0070675_1000666012 427
171 3300005355 Ga0070671_100137141 Ga0070671_1001371412 427
172 3300005356 Ga0070674_100064403 Ga0070674_1000644033 427
173 3300005364 Ga0070673_100063684 Ga0070673_1000636841 427
174 3300006051 Ga0075364_10004656 Ga0075364_100046564 427
175 3300006051 Ga0075364_10041343 Ga0075364_100413431 427
176 3300006944 Ga0099823_1000047 Ga0099823_100004750 427
177 3300013308 Ga0157375_10030689 Ga0157375_100306896 427
178 3300025291 Ga0209675_1002025 Ga0209675_10020255 427
179 3300025295 Ga0209564_1000135 Ga0209564_100013599 427
180 3300025299 Ga0209256_1000107 Ga0209256_100010798 427
181 3300025315 Ga0207697_10023531 Ga0207697_100235312 427
182 3300025728 Ga0207655_1028420 Ga0207655_10284202 427
183 3300025735 Ga0207713_1020539 Ga0207713_10205393 427
184 3300025903 Ga0207680_10114962 Ga0207680_101149622 427
185 3300025937 Ga0207669_10075572 Ga0207669_100755721 427
186 3300025940 Ga0207691_10023019 Ga0207691_100230193 427
187 3300026121 Ga0207683_10021730 Ga0207683_100217303 427
188 3300027296 Ga0209389_1000116 Ga0209389_100011662 427
189 3300028794 Ga0307515_10030752 Ga0307515_100307521 427
190 3300032002 Ga0307416_100023361 Ga0307416_1000233615 427
191 3300046458 Ga0495591_000016 Ga0495591_000016_78473_79807 427
192 3300046474 Ga0495605_0002546 Ga0495605_0002546_6855_8189 427
193 3300046492 Ga0495585_0009370 Ga0495585_0009370_3622_4965 427
194 3300046501 Ga0495607_0000031 Ga0495607_0000031_69290_70624 427
195 3300046501 Ga0495607_0000448 Ga0495607_0000448_15900_17234 427
196 3300046501 Ga0495607_0012898 Ga0495607_0012898_964_2292 427
197 3300046520 Ga0495637_0007230 Ga0495637_0007230_511_1845 427
198 3300046522 Ga0495643_0035514 Ga0495643_0035514_356_1744 427
199 3300046538 Ga0495609_0023821 Ga0495609_0023821_1014_2342 427
200 3300046542 Ga0495597_0000128 Ga0495597_0000128_40461_41795 427
201 3300046542 Ga0495597_0004805 Ga0495597_0004805_4688_6067 427
202 3300046660 Ga0495625_0053597 Ga0495625_0053597_1445_2755 427
203 3300046674 Ga0495588_0007749 Ga0495588_0007749_1181_2581 427
204 3300046674 Ga0495588_0027464 Ga0495588_0027464_699_2072 427
205 3300046691 Ga0495670_0000794 Ga0495670_0000794_5640_6983 427
206 3300046691 Ga0495670_0001356 Ga0495670_0001356_6846_8219 427
207 3300046692 Ga0495671_0014162 Ga0495671_0014162_1595_2974 427
208 3300046810 Ga0495660_0000088 Ga0495660_0000088_17940_19274 427
209 3300047318 Ga0495636_0002823 Ga0495636_0002823_2617_3990 427
210 3300047321 Ga0495676_0003012 Ga0495676_0003012_4629_5963 427
211 3300047323 Ga0495683_0000110 Ga0495683_0000110_17462_18796 427
212 3300047443 Ga0495687_000050 Ga0495687_000050_27274_28617 427
213 3300047469 Ga0495673_0002403 Ga0495673_0002403_5982_7325 427
214 3300047470 Ga0495681_0000081 Ga0495681_0000081_7484_8863 427
215 3300048905 Ga0496102_0033396 Ga0496102_0033396_2943_4316 427
216 3300048906 Ga0496103_0025742 Ga0496103_0025742_291_1664 427
217 3300048913 Ga0496110_0038842 Ga0496110_0038842_132_1505 427
218 3300048914 Ga0496111_0100324 Ga0496111_0100324_729_2102 427
219 3300048917 Ga0496114_0003723 Ga0496114_0003723_5173_6498 427
220 3300048928 Ga0496125_0000207 Ga0496125_0000207_115178_116482 427
221 3300048928 Ga0496125_0003130 Ga0496125_0003130_960_2264 427
222 3300049460 Ga0495682_0001840 Ga0495682_0001840_597_2036 427
223 3300050491 nmdc:mga00v17_639_c1 nmdc:mga00v17_639_c1_4174_5478 427
224 3300053125 Ga0500618_001899 Ga0500618_001899_1676_3010 427
225 3300053135 Ga0500659_0003036 Ga0500659_0003036_3513_4844 427
226 3300053142 Ga0500577_0001217 Ga0500577_0001217_3893_5197 427
227 iso_pu_bacteria 2844849076 2844851526 427
228 iso_pu_bacteria 2893684298 2893685034 428
229 iso_pu_bacteria 2946080515 2946083357 428
230 iso_pu_bacteria 2738541308 2738890216 429
231 3300031852 Ga0307410_10072075 Ga0307410_100720752 430
232 iso_pu_bacteria 8025530807 8025535008 430
233 3300048909 Ga0496106_0000054 Ga0496106_0000054_91217_92680 431
234 3300048924 Ga0496121_0011732 Ga0496121_0011732_1547_3010 431
235 iso_pu_bacteria 2818991445 2819594858 431
236 3300048919 Ga0496116_0060647 Ga0496116_0060647_572_1885 432
237 3300002704 JGI25155J39150_1000030 JGI25155J39150_100003054 435
238 3300002705 JGI25156J39149_1000059 JGI25156J39149_100005938 435
239 3300002738 JGI25154J39366_1000056 JGI25154J39366_100005654 435
240 3300002741 JGI25157J39369_1000123 JGI25157J39369_100012324 435
241 3300003758 Ga0055532_1000059 Ga0055532_100005990 435
242 3300003761 Ga0055535_1004336 Ga0055535_10043362 435
243 3300005563 Ga0068855_100016481 Ga0068855_1000164817 435
244 3300005616 Ga0068852_100004286 Ga0068852_1000042863 435
245 3300009093 Ga0105240_10000344 Ga0105240_1000034416 435
246 3300009545 Ga0105237_10094953 Ga0105237_100949532 435
247 3300009551 Ga0105238_10029843 Ga0105238_100298433 435
248 3300013100 Ga0157373_10090839 Ga0157373_100908392 435
249 3300014497 Ga0182008_10011185 Ga0182008_100111853 435
250 3300015261 Ga0182006_1004018 Ga0182006_10040186 435
251 3300025206 Ga0209435_100032 Ga0209435_10003253 435
252 3300025229 Ga0209147_100109 Ga0209147_10010953 435
253 3300025233 Ga0209437_100261 Ga0209437_10026120 435
254 3300025242 Ga0209258_100190 Ga0209258_10019026 435
255 3300025246 Ga0209646_1000113 Ga0209646_100011353 435
256 3300025250 Ga0209026_1000102 Ga0209026_100010253 435
257 3300025256 Ga0209759_1000104 Ga0209759_100010453 435
258 3300025913 Ga0207695_10001722 Ga0207695_1000172212 435
259 3300025949 Ga0207667_10005245 Ga0207667_100052456 435
260 3300026142 Ga0207698_10002888 Ga0207698_100028883 435
261 3300037471 Ga0395905_0000160 Ga0395905_0000160_105999_107330 435
262 3300048919 Ga0496116_0026061 Ga0496116_0026061_670_1986 435
263 3300048924 Ga0496121_0037235 Ga0496121_0037235_570_1886 435
264 3300048925 Ga0496122_0000225 Ga0496122_0000225_80190_81506 435
265 3300048926 Ga0496123_0000192 Ga0496123_0000192_44799_46115 435
266 3300048928 Ga0496125_0000947 Ga0496125_0000947_22203_23510 435

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

56

273

0.88

PF00083

Sugar_tr

Sugar (and other) transporter

274

472

0.84

PF07690

MFS_1

Major Facilitator Superfamily

62

426

0.78

PF07690

MFS_1

Major Facilitator Superfamily

289

488

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7spt-assembly1.cif.gz_A crystal structure of exofacial state human glucose transporter glut3 0.8223 23 431
6m20-assembly3.cif.gz_C crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose 0.7839 17 431
8sc3-assembly1.cif.gz_A human oct1 bound to fenoterol in inward-open conformation 0.7832 56 429
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.7818 21 426
7spt-assembly1.cif.gz_A crystal structure of exofacial state human glucose transporter glut3 0.7808 23 431
ID Description Score Start End Superfamily
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9758 25 237 1.20.1250.20
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9633 24 232 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9581 25 237 1.20.1250.20
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9457 24 232 1.20.1250.20
af_P76350_250_438_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9438 250 432 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4R6HJK8-F1-model_v4 deleted 0.9878 21 432
AF-A0A2V3Y2W3-F1-model_v4 deleted 0.9839 21 234
AF-A0A1I5FJ44-F1-model_v4 Metabolite-proton symporter 0.9838 20 430 GO:0005886
GO:0022857
AF-A0A4S3PJV7-F1-model_v4 MFS transporter 0.9831 21 431 GO:0005886
GO:0022857
AF-A0A328X9G5-F1-model_v4 deleted 0.9822 17 430

Feature Viewer

pLDDT pTM Quality
86.96 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map