F373428

General Info

Members Datasets Scaffolds Average Seq Length
265 177 218 419

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10043985|Ga0307514_100439853
Length 486
Sequence MDTPGVRDRLVRRGSGWSTPGRSASKMQEESGIVHPTSHGSAIHPGSLTCSRTVATRVRGIPYPDLVTDPSSATASPDARPPADGSAPSTPDAPWPVAILSSKIKGYIDRLGTVWAEGEITQWGVSGGNVYGKLKDLHQDVTLSFNVWSSTRAKFTDEFKQGDRVIALLKPNFWPKGGSLSMQVYELRHVGLGDLLERLERLRRQLAQEGLFDLDRKVRLPFLPGCIGLITGKDSDAEKDVIRNAQLRWPEVRFRVRHAAVQGDRAAADVAAGIRELDADPEVDVIIVARGGGDFQNLLTFSDETLVRTAAACVTPLVSAIGHEADRPLLDEVADLRASTPTDAAKRVVPDVADELARVQQARGRMAMRVTSLVTAEIDRIGHIRSRPALADPGWLVDTRAEELTRWVARGSELMDFRLERAGLQVVELVGQLRALSPKRTLERGYAIAQRADGTVLRTAADATGGERLLLTLVDGTVPTTVDGAR

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221616 Leifsonia sp. Root227 Isolate Unclassified
4 2643221619 Agromyces sp. Root81 Isolate Unclassified
5 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
6 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
7 2643221649 Leifsonia sp. Root4 Isolate Unclassified
8 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
9 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
10 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
11 2808606372 Agromyces sp. 23-23 Isolate Unclassified
12 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
13 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
14 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
15 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
16 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
17 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
18 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
19 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
20 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
21 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
22 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
23 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
24 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
25 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
26 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
27 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
28 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
29 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
30 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
31 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
32 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
33 2928153084 Leifsonia sp. 563 Isolate Unclassified
34 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
35 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
36 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
37 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
38 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
39 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
40 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
41 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
42 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
43 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
44 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
48 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
49 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
50 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
51 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
52 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
111 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
168 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
169 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
174 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
175 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
176 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
177 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.13
Metatranscriptomes 1.13
Isolates 17.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 15.85
Nodule 0
Rhizoplane 5.66
Rhizosphere 60.75
Stem 0
Stem Tuber 0.38
Unclassified 16.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1000661 3300002772 Bacteria 14082
2 JGI25165J46597_1000004 3300003214 Bacteria 667510
3 rootH2_10048803 3300003320 Bacteria 3275
4 rootH1_10002611 3300003323 Bacteria 3595
5 Ga0006562J51391_1015454 3300003578 Bacteria 8081
6 Ga0006562J51391_1015456 3300003578 Bacteria 6550
7 Ga0055539_1000005 3300003752 Bacteria 609598
8 Ga0055533_1000001 3300003756 Bacteria 1863437
9 Ga0055525_1000121 3300003759 Bacteria 119321
10 Ga0055527_1000001 3300003760 Bacteria 850044
11 Ga0055529_1000019 3300003763 Bacteria 332786
12 Ga0065714_10075674 3300005288 Bacteria 2879
13 Ga0070658_10000178 3300005327 Bacteria 55790
14 Ga0070658_10039058 3300005327 Bacteria 3828
15 Ga0070682_100016474 3300005337 Bacteria 4297
16 Ga0070675_100134531 3300005354 Bacteria 2109
17 Ga0070659_100195200 3300005366 Bacteria 1665
18 Ga0070667_100058252 3300005367 Bacteria 3266
19 Ga0070710_10010741 3300005437 Bacteria 4502
20 Ga0068855_100219670 3300005563 Bacteria 2132
21 Ga0068857_100364386 3300005577 Bacteria 1340
22 Ga0068856_100148600 3300005614 Bacteria 2351
23 Ga0068851_10000009 3300005834 Bacteria 217844
24 Ga0068870_10049710 3300005840 Bacteria 2213
25 Ga0105240_10006340 3300009093 Bacteria 17415
26 Ga0105245_10011427 3300009098 Bacteria 7732
27 Ga0105243_10179968 3300009148 Bacteria 1838
28 Ga0105241_10000461 3300009174 Bacteria 30678
29 Ga0105248_10106718 3300009177 Bacteria 3158
30 Ga0105237_10000898 3300009545 Bacteria 40152
31 Ga0105237_10018038 3300009545 Bacteria 7311
32 Ga0105238_10003366 3300009551 Bacteria 15951
33 Ga0105239_10095115 3300010375 Bacteria 3291
34 Ga0157371_10001185 3300013102 Bacteria 27939
35 Ga0157369_10000844 3300013105 Bacteria 39239
36 Ga0157380_10024116 3300014326 Bacteria 4599
37 Ga0157379_10019356 3300014968 Bacteria 6012
38 Ga0206353_11148754 3300020082 Bacteria 8198
39 Ga0209566_100065 3300025225 Bacteria 190999
40 Ga0209674_100001 3300025226 Bacteria 4013750
41 Ga0209672_100006 3300025228 Bacteria 1004497
42 Ga0209147_100393 3300025229 Bacteria 29982
43 Ga0209563_100001 3300025230 Bacteria 4013775
44 Ga0209563_100317 3300025230 Bacteria 19109
45 Ga0207427_100010 3300025231 Bacteria 648610
46 Ga0209437_100578 3300025233 Bacteria 23500
47 Ga0209677_100001 3300025253 Bacteria 4013787
48 Ga0209677_100356 3300025253 Bacteria 28522
49 Ga0209148_1000015 3300025254 Bacteria 850103
50 Ga0209148_1001382 3300025254 Bacteria 12604
51 Ga0209233_1000001 3300025261 Bacteria 2992747
52 Ga0209455_1000013 3300025272 Bacteria 850103
53 Ga0209455_1000598 3300025272 Bacteria 23103
54 Ga0207656_10000001 3300025321 Bacteria 1323684
55 Ga0207656_10000003 3300025321 Bacteria 771644
56 Ga0207656_10000004 3300025321 Bacteria 632320
57 Ga0207705_10000001 3300025909 Bacteria 2061880
58 Ga0207705_10046938 3300025909 Bacteria 3105
59 Ga0207654_10000003 3300025911 Bacteria 1030378
60 Ga0207695_10003249 3300025913 Bacteria 23124
61 Ga0207671_10000001 3300025914 Bacteria 1318881
62 Ga0207694_10000148 3300025924 Bacteria 72467
63 Ga0207694_10166746 3300025924 Bacteria 1782
64 Ga0207659_10172796 3300025926 Bacteria 1706
65 Ga0207690_10025441 3300025932 Bacteria 3717
66 Ga0207667_10009158 3300025949 Bacteria 11694
67 Ga0207667_10017885 3300025949 Bacteria 7966
68 Ga0207667_10165972 3300025949 Bacteria 2270
69 Ga0207658_10095033 3300025986 Bacteria 2321
70 Ga0207678_10011590 3300026067 Bacteria 7745
71 Ga0207702_10140231 3300026078 Bacteria 2186
72 Ga0207674_10002645 3300026116 Bacteria 22384
73 Ga0207675_100118200 3300026118 Bacteria 2506
74 Ga0207698_10000481 3300026142 Bacteria 23231
75 Ga0307513_10052066 3300031456 Bacteria 4411
76 Ga0307513_10152693 3300031456 Bacteria 2215
77 Ga0307514_10003316 3300031649 Bacteria 15604
78 Ga0307514_10043985 3300031649 Bacteria 3503
79 Ga0307412_10138366 3300031911 Bacteria 1780
80 Ga0395899_0011404 3300037312 Bacteria 6805
81 Ga0395899_0083753 3300037312 Bacteria 2319
82 Ga0395900_0002695 3300037418 Bacteria 19408
83 Ga0395900_0031603 3300037418 Bacteria 5442
84 Ga0395900_0098918 3300037418 Bacteria 2997
85 Ga0395898_0000015 3300037466 Bacteria 439819
86 Ga0395898_0196081 3300037466 Bacteria 1929
87 Ga0451793_1125442 3300041452 Bacteria 2947
88 Ga0451806_696518 3300041462 Bacteria 1455
89 Ga0466965_0000001 3300044683 Bacteria 317826
90 Ga0466961_0149268 3300044693 Bacteria 1460
91 Ga0466970_0002999 3300044765 Bacteria 8188
92 Ga0466970_0016784 3300044765 Bacteria 3778
93 Ga0466970_0022721 3300044765 Bacteria 3272
94 Ga0466970_0027673 3300044765 Bacteria 2975
95 Ga0466970_0076850 3300044765 Bacteria 1799
96 Ga0466957_0052542 3300044842 Bacteria 2481
97 Ga0466960_0001892 3300044901 Bacteria 7697
98 Ga0466960_0014956 3300044901 Bacteria 3335
99 Ga0466967_0132553 3300045976 Bacteria 2315
100 Ga0495590_0001888 3300046457 Bacteria 8858
101 Ga0495638_0015917 3300046460 Bacteria 5040
102 Ga0495650_0000856 3300046471 Bacteria 36574
103 Ga0495656_0012038 3300046615 Bacteria 3186
104 Ga0495656_0064689 3300046615 Bacteria 1607
105 Ga0495672_0009351 3300047320 Bacteria 7114
106 Ga0495672_0030300 3300047320 Bacteria 3397
107 Ga0496100_0048406 3300048903 Bacteria 2743
108 Ga0496101_0063059 3300048904 Bacteria 2696
109 Ga0496102_0027045 3300048905 Bacteria 5122
110 Ga0496103_0156834 3300048906 Bacteria 1459
111 Ga0496104_0027122 3300048907 Bacteria 5298
112 Ga0496104_0166374 3300048907 Bacteria 2115
113 Ga0496105_0037768 3300048908 Bacteria 3977
114 Ga0496105_0066176 3300048908 Bacteria 2983
115 Ga0496105_0237870 3300048908 Bacteria 1478
116 Ga0496106_0130866 3300048909 Bacteria 1968
117 Ga0496114_0051211 3300048917 Bacteria 3437
118 Ga0496115_0003324 3300048918 Bacteria 11540
119 Ga0496115_0037485 3300048918 Bacteria 3841
120 Ga0496116_0118079 3300048919 Bacteria 1542
121 Ga0496117_0002950 3300048920 Bacteria 20568
122 Ga0496117_0007037 3300048920 Bacteria 11137
123 Ga0496117_0036015 3300048920 Bacteria 3708
124 Ga0496117_0042420 3300048920 Bacteria 3320
125 Ga0496117_0063947 3300048920 Bacteria 2512
126 Ga0496118_0000360 3300048921 Bacteria 77010
127 Ga0496118_0012601 3300048921 Bacteria 8093
128 Ga0496118_0016778 3300048921 Bacteria 6695
129 Ga0496118_0091726 3300048921 Bacteria 2088
130 Ga0496119_0002964 3300048922 Bacteria 18030
131 Ga0496119_0059681 3300048922 Bacteria 2289
132 Ga0496120_0002063 3300048923 Bacteria 21678
133 Ga0496120_0004480 3300048923 Bacteria 11695
134 Ga0496120_0020953 3300048923 Bacteria 4140
135 Ga0496121_0000132 3300048924 Bacteria 167578
136 Ga0496122_0003503 3300048925 Bacteria 20616
137 Ga0496124_0000173 3300048927 Bacteria 129688
138 Ga0496124_0013745 3300048927 Bacteria 7880
139 Ga0496126_0023070 3300048929 Bacteria 6033
140 Ga0496126_0043818 3300048929 Bacteria 4125
141 Ga0501032_0004440 3300049569 Bacteria 10573
142 Ga0501032_0006887 3300049569 Bacteria 8328
143 Ga0501033_0003184 3300049570 Bacteria 13614
144 Ga0501033_0005165 3300049570 Bacteria 10381
145 Ga0501033_0011202 3300049570 Bacteria 6869
146 Ga0501033_0053781 3300049570 Bacteria 2981
147 Ga0501034_0007902 3300049571 Bacteria 11298
148 Ga0501034_0011380 3300049571 Bacteria 9226
149 Ga0501034_0012735 3300049571 Bacteria 8675
150 Ga0501034_0026636 3300049571 Bacteria 5884
151 Ga0501034_0030040 3300049571 Bacteria 5525
152 Ga0501034_0039980 3300049571 Bacteria 4749
153 Ga0501034_0067026 3300049571 Bacteria 3603
154 Ga0501034_0077327 3300049571 Bacteria 3333
155 Ga0501034_0082269 3300049571 Bacteria 3222
156 Ga0501034_0185420 3300049571 Bacteria 2044
157 Ga0501036_0022413 3300049572 Bacteria 5312
158 Ga0501037_0014876 3300049573 Bacteria 5724
159 Ga0501037_0074108 3300049573 Bacteria 2474
160 Ga0501037_0129254 3300049573 Bacteria 1812
161 Ga0501038_0010431 3300049574 Bacteria 8498
162 Ga0501039_0002756 3300049575 Bacteria 13099
163 Ga0501039_0005230 3300049575 Bacteria 9828
164 Ga0501042_0180384 3300049578 Bacteria 1523
165 Ga0501043_0000649 3300049579 Bacteria 30670
166 Ga0501043_0003267 3300049579 Bacteria 13367
167 Ga0501046_0000916 3300049580 Bacteria 28889
168 Ga0501046_0021219 3300049580 Bacteria 5362
169 Ga0501047_0000633 3300049581 Bacteria 36953
170 Ga0501047_0036692 3300049581 Bacteria 4738
171 Ga0501047_0040762 3300049581 Bacteria 4490
172 Ga0501047_0071602 3300049581 Bacteria 3336
173 Ga0501047_0072062 3300049581 Bacteria 3325
174 Ga0501047_0187883 3300049581 Bacteria 1930
175 Ga0501048_0009090 3300049582 Bacteria 7478
176 Ga0501048_0059286 3300049582 Bacteria 2712
177 Ga0501068_0161203 3300049584 Bacteria 1414
178 Ga0501070_0000238 3300049586 Bacteria 51576
179 Ga0501070_0008351 3300049586 Bacteria 8750
180 Ga0501070_0017747 3300049586 Bacteria 5976
181 Ga0501070_0082527 3300049586 Bacteria 2660
182 Ga0501073_0000038 3300049589 Bacteria 86286
183 Ga0501073_0073429 3300049589 Bacteria 2382
184 Ga0501074_0105993 3300049590 Bacteria 2012
185 Ga0501080_0000261 3300049742 Bacteria 39938
186 Ga0501083_0000282 3300049744 Bacteria 32280
187 Ga0501083_0003747 3300049744 Bacteria 10676
188 Ga0501083_0009315 3300049744 Bacteria 6934
189 Ga0501035_0004363 3300049822 Bacteria 13434
190 Ga0501035_0006280 3300049822 Bacteria 11176
191 Ga0501035_0035470 3300049822 Bacteria 4526
192 Ga0501044_0001152 3300049823 Bacteria 31299
193 Ga0501044_0075480 3300049823 Bacteria 3422
194 Ga0501044_0078905 3300049823 Bacteria 3336
195 Ga0501044_0131110 3300049823 Bacteria 2500
196 Ga0501045_0040959 3300049824 Bacteria 3369
197 Ga0500635_0000079 3300053080 Bacteria 63227
198 Ga0500635_0019381 3300053080 Bacteria 2068
199 Ga0500651_0000214 3300053093 Bacteria 36274
200 Ga0500650_0013514 3300053098 Bacteria 3425
201 Ga0500559_0000296 3300053136 Bacteria 38451
202 Ga0500559_0000812 3300053136 Bacteria 20325
203 Ga0500559_0080104 3300053136 Bacteria 1483
204 Ga0500568_0000008 3300053139 Bacteria 281012
205 Ga0500568_0001499 3300053139 Bacteria 14914
206 Ga0500568_0012674 3300053139 Bacteria 3869
207 Ga0500568_0017149 3300053139 Bacteria 3203
208 Ga0500573_0000018 3300053140 Bacteria 177945
209 Ga0500573_0023037 3300053140 Bacteria 3575
210 Ga0500573_0046370 3300053140 Bacteria 2504
211 Ga0500573_0126133 3300053140 Bacteria 1421
212 Ga0500577_0005565 3300053142 Bacteria 3408
213 Ga0500590_018666 3300053148 Bacteria 3590
214 Ga0500616_0000058 3300053153 Bacteria 266276
215 Ga0500616_0000151 3300053153 Bacteria 116796
216 Ga0500616_0000706 3300053153 Bacteria 38765
217 Ga0501084_0080904 3300054114 Bacteria 2724
218 Ga0466962_0046684 3300061719 Bacteria 2070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0132553 Ga0466967_0132553_535_1830 380
2 3300048907 Ga0496104_0166374 Ga0496104_0166374_55_1311 380
3 3300048908 Ga0496105_0066176 Ga0496105_0066176_892_2148 380
4 3300048917 Ga0496114_0051211 Ga0496114_0051211_332_1588 380
5 3300048918 Ga0496115_0037485 Ga0496115_0037485_1477_2733 380
6 3300013102 Ga0157371_10001185 Ga0157371_1000118514 385
7 3300053136 Ga0500559_0000812 Ga0500559_0000812_6737_7975 386
8 3300048920 Ga0496117_0007037 Ga0496117_0007037_7650_8888 389
9 3300053153 Ga0500616_0000058 Ga0500616_0000058_172478_173716 389
10 iso_pu_bacteria 8055037949 8055040765 391
11 3300048924 Ga0496121_0000132 Ga0496121_0000132_161876_163069 393
12 3300046460 Ga0495638_0015917 Ga0495638_0015917_1141_2382 394
13 3300046615 Ga0495656_0064689 Ga0495656_0064689_319_1560 394
14 3300053153 Ga0500616_0000706 Ga0500616_0000706_27162_28388 394
15 iso_pu_bacteria 2964326757 2964328883 395
16 3300044683 Ga0466965_0000001 Ga0466965_0000001_95727_96923 396
17 3300049570 Ga0501033_0005165 Ga0501033_0005165_6318_7514 396
18 3300049571 Ga0501034_0077327 Ga0501034_0077327_1677_2873 396
19 3300049571 Ga0501034_0082269 Ga0501034_0082269_1988_3184 396
20 3300049584 Ga0501068_0161203 Ga0501068_0161203_77_1273 396
21 iso_pu_bacteria 2585428094 2587864361 396
22 iso_pu_bacteria 2643221649 2644280338 396
23 iso_pu_bacteria 2857729791 2857730362 396
24 iso_pu_bacteria 2928121344 2928123578 396
25 3300053139 Ga0500568_0012674 Ga0500568_0012674_1785_3050 397
26 3300003323 rootH1_10002611 rootH1_100026112 398
27 3300049571 Ga0501034_0030040 Ga0501034_0030040_3890_5092 398
28 3300049571 Ga0501034_0067026 Ga0501034_0067026_1965_3182 398
29 3300049574 Ga0501038_0010431 Ga0501038_0010431_3847_5049 398
30 3300049581 Ga0501047_0072062 Ga0501047_0072062_1840_3087 398
31 3300053139 Ga0500568_0001499 Ga0500568_0001499_10184_11386 398
32 iso_pu_bacteria 2643221549 2643769750 398
33 3300048907 Ga0496104_0027122 Ga0496104_0027122_1251_2510 399
34 3300048908 Ga0496105_0237870 Ga0496105_0237870_138_1397 399
35 3300049744 Ga0501083_0000282 Ga0501083_0000282_25731_26948 399
36 3300049744 Ga0501083_0003747 Ga0501083_0003747_8495_9724 399
37 3300048903 Ga0496100_0048406 Ga0496100_0048406_784_2043 400
38 3300048904 Ga0496101_0063059 Ga0496101_0063059_533_1792 400
39 3300048905 Ga0496102_0027045 Ga0496102_0027045_2446_3705 400
40 3300048906 Ga0496103_0156834 Ga0496103_0156834_174_1433 400
41 3300048909 Ga0496106_0130866 Ga0496106_0130866_668_1927 400
42 3300048920 Ga0496117_0063947 Ga0496117_0063947_361_1620 400
43 3300048921 Ga0496118_0091726 Ga0496118_0091726_500_1759 400
44 iso_pu_bacteria 2870622029 2870622688 400
45 iso_pu_bacteria 2939657138 2939658915 400
46 iso_pu_bacteria 2995726249 2995727033 400
47 iso_pu_bacteria 8055034563 8055036806 400
48 3300005367 Ga0070667_100058252 Ga0070667_1000582522 401
49 3300025986 Ga0207658_10095033 Ga0207658_100950332 401
50 3300005437 Ga0070710_10010741 Ga0070710_100107414 402
51 3300031456 Ga0307513_10052066 Ga0307513_100520661 402
52 3300041452 Ga0451793_1125442 Ga0451793_1125442_794_2020 402
53 3300053136 Ga0500559_0000296 Ga0500559_0000296_3340_4569 402
54 3300053136 Ga0500559_0080104 Ga0500559_0080104_149_1387 402
55 iso_pu_bacteria 2966921586 2966921775 402
56 3300005288 Ga0065714_10075674 Ga0065714_100756743 404
57 3300037466 Ga0395898_0196081 Ga0395898_0196081_121_1350 404
58 3300053098 Ga0500650_0013514 Ga0500650_0013514_1435_2667 404
59 3300053142 Ga0500577_0005565 Ga0500577_0005565_650_1882 404
60 iso_pu_bacteria 8057345674 8057348273 404
61 3300005327 Ga0070658_10000178 Ga0070658_1000017834 405
62 3300005366 Ga0070659_100195200 Ga0070659_1001952002 405
63 3300005563 Ga0068855_100219670 Ga0068855_1002196702 405
64 3300025909 Ga0207705_10000001 Ga0207705_10000001164 405
65 3300025932 Ga0207690_10025441 Ga0207690_100254412 405
66 3300025949 Ga0207667_10017885 Ga0207667_100178852 405
67 3300025949 Ga0207667_10165972 Ga0207667_101659723 405
68 3300026067 Ga0207678_10011590 Ga0207678_100115906 405
69 3300049573 Ga0501037_0129254 Ga0501037_0129254_334_1614 405
70 3300049581 Ga0501047_0000633 Ga0501047_0000633_4183_5463 405
71 3300049823 Ga0501044_0001152 Ga0501044_0001152_17188_18468 405
72 3300053139 Ga0500568_0000008 Ga0500568_0000008_238208_239425 405
73 3300053140 Ga0500573_0000018 Ga0500573_0000018_34809_36047 405
74 3300053140 Ga0500573_0126133 Ga0500573_0126133_23_1261 405
75 3300053148 Ga0500590_018666 Ga0500590_018666_38_1270 405
76 iso_pu_bacteria 2808606372 2808901435 405
77 3300003320 rootH2_10048803 rootH2_100488031 406
78 3300003760 Ga0055527_1000001 Ga0055527_1000001767 406
79 3300003763 Ga0055529_1000019 Ga0055529_1000019273 406
80 3300005614 Ga0068856_100148600 Ga0068856_1001486002 406
81 3300009093 Ga0105240_10006340 Ga0105240_100063406 406
82 3300009174 Ga0105241_10000461 Ga0105241_1000046122 406
83 3300009545 Ga0105237_10018038 Ga0105237_100180387 406
84 3300025228 Ga0209672_100006 Ga0209672_100006208 406
85 3300025229 Ga0209147_100393 Ga0209147_1003939 406
86 3300025254 Ga0209148_1000015 Ga0209148_100001552 406
87 3300025254 Ga0209148_1001382 Ga0209148_10013828 406
88 3300025272 Ga0209455_1000013 Ga0209455_100001352 406
89 3300025911 Ga0207654_10000003 Ga0207654_10000003799 406
90 3300025913 Ga0207695_10003249 Ga0207695_1000324910 406
91 3300026078 Ga0207702_10140231 Ga0207702_101402312 406
92 3300048929 Ga0496126_0023070 Ga0496126_0023070_3199_4428 406
93 3300048929 Ga0496126_0043818 Ga0496126_0043818_1204_2445 406
94 3300049569 Ga0501032_0006887 Ga0501032_0006887_4356_5639 406
95 3300049570 Ga0501033_0003184 Ga0501033_0003184_7322_8605 406
96 3300049570 Ga0501033_0011202 Ga0501033_0011202_5278_6561 406
97 3300049571 Ga0501034_0012735 Ga0501034_0012735_1625_2908 406
98 3300049571 Ga0501034_0026636 Ga0501034_0026636_54_1337 406
99 3300049572 Ga0501036_0022413 Ga0501036_0022413_3731_5014 406
100 3300049575 Ga0501039_0005230 Ga0501039_0005230_3085_4368 406
101 3300049578 Ga0501042_0180384 Ga0501042_0180384_166_1449 406
102 3300049580 Ga0501046_0021219 Ga0501046_0021219_3778_5061 406
103 3300049581 Ga0501047_0036692 Ga0501047_0036692_1871_3154 406
104 3300049581 Ga0501047_0187883 Ga0501047_0187883_627_1910 406
105 3300049582 Ga0501048_0009090 Ga0501048_0009090_2484_3767 406
106 3300049586 Ga0501070_0082527 Ga0501070_0082527_205_1488 406
107 3300049589 Ga0501073_0000038 Ga0501073_0000038_31559_32791 406
108 3300049590 Ga0501074_0105993 Ga0501074_0105993_169_1452 406
109 3300049822 Ga0501035_0004363 Ga0501035_0004363_1194_2477 406
110 3300049822 Ga0501035_0035470 Ga0501035_0035470_2848_4131 406
111 3300049823 Ga0501044_0075480 Ga0501044_0075480_2088_3371 406
112 3300049823 Ga0501044_0131110 Ga0501044_0131110_140_1423 406
113 3300053140 Ga0500573_0023037 Ga0500573_0023037_784_2082 406
114 iso_pu_bacteria 2643221632 2644182805 406
115 iso_pu_bacteria 8046352972 8046353425 406
116 3300009098 Ga0105245_10011427 Ga0105245_100114277 407
117 3300009177 Ga0105248_10106718 Ga0105248_101067184 407
118 3300014968 Ga0157379_10019356 Ga0157379_100193565 407
119 3300025924 Ga0207694_10166746 Ga0207694_101667461 407
120 3300031456 Ga0307513_10152693 Ga0307513_101526932 407
121 3300031649 Ga0307514_10003316 Ga0307514_100033169 407
122 3300048908 Ga0496105_0037768 Ga0496105_0037768_2335_3591 407
123 3300048918 Ga0496115_0003324 Ga0496115_0003324_1222_2478 407
124 3300048919 Ga0496116_0118079 Ga0496116_0118079_14_1237 407
125 iso_pu_bacteria 2751185788 2753301070 407
126 iso_pu_bacteria 2862993130 2862995174 407
127 iso_pu_bacteria 2919042368 2919045886 407
128 iso_pu_bacteria 2928104781 2928107118 407
129 iso_pu_bacteria 2984551494 2984553240 407
130 3300046457 Ga0495590_0001888 Ga0495590_0001888_231_1466 408
131 3300048923 Ga0496120_0020953 Ga0496120_0020953_1789_3054 408
132 3300048925 Ga0496122_0003503 Ga0496122_0003503_15567_16805 408
133 3300048927 Ga0496124_0013745 Ga0496124_0013745_3912_5219 408
134 3300053139 Ga0500568_0017149 Ga0500568_0017149_674_1915 408
135 iso_pu_bacteria 2852677369 2852678921 408
136 iso_pu_bacteria 2897561785 2897562895 408
137 iso_pu_bacteria 2904430863 2904431030 408
138 iso_pu_bacteria 2904501621 2904503459 408
139 iso_pu_bacteria 2908674828 2908675097 408
140 iso_pu_bacteria 2909074476 2909075578 408
141 iso_pu_bacteria 2919039151 2919039785 408
142 iso_pu_bacteria 2928500415 2928503094 408
143 3300005337 Ga0070682_100016474 Ga0070682_1000164742 409
144 3300013105 Ga0157369_10000844 Ga0157369_1000084416 409
145 3300031649 Ga0307514_10043985 Ga0307514_100439853 409
146 3300044765 Ga0466970_0022721 Ga0466970_0022721_1473_2729 409
147 3300044901 Ga0466960_0001892 Ga0466960_0001892_5375_6631 409
148 3300046471 Ga0495650_0000856 Ga0495650_0000856_12627_14024 409
149 3300053093 Ga0500651_0000214 Ga0500651_0000214_29146_30414 409
150 3300053140 Ga0500573_0046370 Ga0500573_0046370_185_1474 409
151 3300061719 Ga0466962_0046684 Ga0466962_0046684_605_1861 409
152 3300025949 Ga0207667_10009158 Ga0207667_100091587 410
153 3300037418 Ga0395900_0002695 Ga0395900_0002695_11084_12367 410
154 3300046615 Ga0495656_0012038 Ga0495656_0012038_1326_2582 410
155 3300048920 Ga0496117_0002950 Ga0496117_0002950_7934_9328 410
156 3300048921 Ga0496118_0016778 Ga0496118_0016778_3141_4466 410
157 3300048922 Ga0496119_0002964 Ga0496119_0002964_177_1502 410
158 3300048923 Ga0496120_0002063 Ga0496120_0002063_13427_14689 410
159 3300048923 Ga0496120_0004480 Ga0496120_0004480_10255_11580 410
160 3300053080 Ga0500635_0019381 Ga0500635_0019381_698_1972 410
161 iso_pu_bacteria 2919443155 2919446873 410
162 3300048921 Ga0496118_0000360 Ga0496118_0000360_11090_12325 411
163 3300048922 Ga0496119_0059681 Ga0496119_0059681_648_1883 411
164 3300048927 Ga0496124_0000173 Ga0496124_0000173_117352_118587 411
165 3300049570 Ga0501033_0053781 Ga0501033_0053781_256_1539 411
166 iso_pu_bacteria 2857737099 2857738421 411
167 iso_pu_bacteria 2939660829 2939663069 411
168 3300053080 Ga0500635_0000079 Ga0500635_0000079_24316_25554 412
169 iso_pu_bacteria 2966924647 2966925703 412
170 3300047320 Ga0495672_0009351 Ga0495672_0009351_492_1748 413
171 3300047320 Ga0495672_0030300 Ga0495672_0030300_975_2231 413
172 3300048920 Ga0496117_0036015 Ga0496117_0036015_292_1551 413
173 3300049569 Ga0501032_0004440 Ga0501032_0004440_1633_2901 413
174 3300049571 Ga0501034_0007902 Ga0501034_0007902_1684_2952 413
175 3300049571 Ga0501034_0039980 Ga0501034_0039980_1052_2305 413
176 3300049573 Ga0501037_0014876 Ga0501037_0014876_509_1777 413
177 3300049573 Ga0501037_0074108 Ga0501037_0074108_281_1534 413
178 3300049575 Ga0501039_0002756 Ga0501039_0002756_7897_9165 413
179 3300049579 Ga0501043_0000649 Ga0501043_0000649_14579_15832 413
180 3300049579 Ga0501043_0003267 Ga0501043_0003267_7414_8682 413
181 3300049580 Ga0501046_0000916 Ga0501046_0000916_7557_8825 413
182 3300049581 Ga0501047_0040762 Ga0501047_0040762_402_1655 413
183 3300049581 Ga0501047_0071602 Ga0501047_0071602_1842_3110 413
184 3300049582 Ga0501048_0059286 Ga0501048_0059286_292_1560 413
185 3300049586 Ga0501070_0008351 Ga0501070_0008351_3145_4398 413
186 3300049586 Ga0501070_0017747 Ga0501070_0017747_3003_4271 413
187 3300049589 Ga0501073_0073429 Ga0501073_0073429_934_2187 413
188 3300049742 Ga0501080_0000261 Ga0501080_0000261_27085_28338 413
189 3300049744 Ga0501083_0009315 Ga0501083_0009315_5219_6472 413
190 3300049822 Ga0501035_0006280 Ga0501035_0006280_6249_7517 413
191 3300049823 Ga0501044_0078905 Ga0501044_0078905_227_1495 413
192 3300049824 Ga0501045_0040959 Ga0501045_0040959_957_2225 413
193 3300054114 Ga0501084_0080904 Ga0501084_0080904_110_1363 413
194 iso_pu_bacteria 2643221619 2644114413 413
195 iso_pu_bacteria 8056037122 8056039819 413
196 3300005327 Ga0070658_10039058 Ga0070658_100390585 414
197 3300005834 Ga0068851_10000009 Ga0068851_1000000919 414
198 3300009545 Ga0105237_10000898 Ga0105237_100008988 414
199 3300009551 Ga0105238_10003366 Ga0105238_1000336610 414
200 3300010375 Ga0105239_10095115 Ga0105239_100951152 414
201 3300025321 Ga0207656_10000001 Ga0207656_10000001510 414
202 3300025321 Ga0207656_10000003 Ga0207656_10000003616 414
203 3300025321 Ga0207656_10000004 Ga0207656_10000004473 414
204 3300025909 Ga0207705_10046938 Ga0207705_100469382 414
205 3300025914 Ga0207671_10000001 Ga0207671_10000001508 414
206 3300025924 Ga0207694_10000148 Ga0207694_1000014850 414
207 3300026116 Ga0207674_10002645 Ga0207674_100026452 414
208 3300026142 Ga0207698_10000481 Ga0207698_1000048122 414
209 3300031911 Ga0307412_10138366 Ga0307412_101383662 414
210 3300041462 Ga0451806_696518 Ga0451806_696518_117_1382 414
211 iso_pu_bacteria 2721755702 2723641487 414
212 iso_pu_bacteria 2935409751 2935410907 414
213 3300044765 Ga0466970_0002999 Ga0466970_0002999_2074_3324 415
214 3300049571 Ga0501034_0011380 Ga0501034_0011380_4544_5836 415
215 3300049571 Ga0501034_0185420 Ga0501034_0185420_612_1910 415
216 3300053153 Ga0500616_0000151 Ga0500616_0000151_29697_30962 415
217 3300005354 Ga0070675_100134531 Ga0070675_1001345312 416
218 3300005840 Ga0068870_10049710 Ga0068870_100497102 416
219 3300014326 Ga0157380_10024116 Ga0157380_100241162 416
220 3300025230 Ga0209563_100317 Ga0209563_10031710 416
221 3300009148 Ga0105243_10179968 Ga0105243_101799681 417
222 3300025926 Ga0207659_10172796 Ga0207659_101727962 417
223 3300026118 Ga0207675_100118200 Ga0207675_1001182003 417
224 3300037312 Ga0395899_0083753 Ga0395899_0083753_754_2085 417
225 3300037418 Ga0395900_0031603 Ga0395900_0031603_3346_4677 417
226 3300037466 Ga0395898_0000015 Ga0395898_0000015_330118_331449 417
227 iso_pu_bacteria 2643221635 2644198206 418
228 iso_pu_bacteria 2895660088 2895663611 418
229 3300044693 Ga0466961_0149268 Ga0466961_0149268_158_1420 420
230 3300025272 Ga0209455_1000598 Ga0209455_10005989 421
231 3300005577 Ga0068857_100364386 Ga0068857_1003643861 422
232 3300044765 Ga0466970_0027673 Ga0466970_0027673_994_2406 422
233 3300037418 Ga0395900_0098918 Ga0395900_0098918_864_2204 423
234 iso_pu_bacteria 2643221669 2644382931 423
235 3300020082 Ga0206353_11148754 Ga0206353_111487548 424
236 3300025253 Ga0209677_100356 Ga0209677_10035613 424
237 3300044765 Ga0466970_0076850 Ga0466970_0076850_316_1746 424
238 iso_pu_bacteria 2643221616 2644096872 425
239 3300049586 Ga0501070_0000238 Ga0501070_0000238_14589_15935 426
240 iso_pu_bacteria 2844852863 2844855939 426
241 iso_pu_bacteria 2919055335 2919058909 426
242 iso_pu_bacteria 2928153084 2928156779 426
243 3300048920 Ga0496117_0042420 Ga0496117_0042420_1668_2975 427
244 3300048921 Ga0496118_0012601 Ga0496118_0012601_3762_5069 427
245 iso_pu_bacteria 2884763398 2884765917 427
246 3300003752 Ga0055539_1000005 Ga0055539_1000005214 428
247 3300003756 Ga0055533_1000001 Ga0055533_10000011283 428
248 3300003759 Ga0055525_1000121 Ga0055525_1000121114 428
249 3300025225 Ga0209566_100065 Ga0209566_100065134 428
250 3300025226 Ga0209674_100001 Ga0209674_1000011282 428
251 3300025230 Ga0209563_100001 Ga0209563_1000011282 428
252 3300025253 Ga0209677_100001 Ga0209677_1000011282 428
253 3300037312 Ga0395899_0011404 Ga0395899_0011404_4210_5574 428
254 3300044765 Ga0466970_0016784 Ga0466970_0016784_2350_3732 429
255 3300003578 Ga0006562J51391_1015454 Ga0006562J51391_10154548 430
256 3300003578 Ga0006562J51391_1015456 Ga0006562J51391_10154562 430
257 iso_pu_bacteria 2844841374 2844842928 430
258 3300002772 JGI25164J39214_1000661 JGI25164J39214_10006616 431
259 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004224 431
260 3300025231 Ga0207427_100010 Ga0207427_100010356 431
261 3300025233 Ga0209437_100578 Ga0209437_1005785 431
262 3300025261 Ga0209233_1000001 Ga0209233_10000011593 431
263 3300044842 Ga0466957_0052542 Ga0466957_0052542_653_2062 431
264 3300044901 Ga0466960_0014956 Ga0466960_0014956_1483_2892 431
265 iso_pu_bacteria 2919523602 2919525022 431

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02601

Exonuc_VII_L

Exonuclease VII, large subunit

211

415

0.96

PF13742

tRNA_anti_2

OB-fold nucleic acid binding domain

95

188

0.91

PF02601

Exonuc_VII_L

Exonuclease VII, large subunit

391

481

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u4z-assembly1.cif.gz_A crystal structure of the tetrahymena telomerase processivity factor teb1 ob-b 0.8337 38 109
3u58-assembly4.cif.gz_D crystal structure of the tetrahymena telomerase processivity factor teb1 ab 0.8299 38 109
1z9f-assembly1.cif.gz_A crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution 0.8168 38 117
4jbk-assembly2.cif.gz_B-2 molecular basis for abrogation of activation of pro-inflammatory cytokines 0.8158 38 109
5gro-assembly1.cif.gz_B crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori 0.814 38 117
ID Description Score Start End Superfamily
af_P9WF31_10_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9246 21 114 2.40.50.140
af_P9WF31_10_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8976 21 114 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8811 21 114 2.40.50.140
af_Q8LFJ8_38_167_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8794 38 116 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8725 21 114 2.40.50.140
ID Description Score Start End GO Terms
AF-Q71IW7-F1-model_v4 Exodeoxyribonuclease VII large subunit (EC 3.1.11.6) 0.981 135 278 GO:0006308
GO:0008855
GO:0009318
AF-A0A6L5EKV6-F1-model_v4 Exodeoxyribonuclease VII large subunit 0.9516 167 268 GO:0006308
GO:0008855
GO:0009318
AF-T1AAC6-F1-model_v4 Exonuclease VII, large subunit (EC 3.1.11.6) 0.9415 125 289 GO:0006308
GO:0008855
GO:0009318
AF-A0A6L5EKV6-F1-model_v4 Exodeoxyribonuclease VII large subunit 0.9339 167 268 GO:0006308
GO:0008855
GO:0009318
AF-A0A5Q0UKQ2-F1-model_v4 Exonuclease VII large subunit (EC 3.1.11.6) 0.9165 172 266 GO:0006308
GO:0008855
GO:0009318

Feature Viewer

pLDDT pTM Quality
86.8 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map