F369189

General Info

Members Datasets Scaffolds Average Seq Length
259 184 233 282

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2751185782|2753269118
Length 314
Sequence FLTAVKQAPNFKGVDITLSGKVAIVTGSGRGLGLAYAKALAAAGAKVVVNDVDQDAVDAAVAEIGGDAVGVAAAVGDTESAERLVRAAVDAFGRLDILVTNAGILRDRVLWKMSDDEFDQVVRVHLRGTFTCARAAAVRMREQGEGGRIILISSPAGQRGNFGQTNYAAAKAGIAAMARTWAMELARNEIAVNAVVPVAATAMTRTIPAFAPLIDESERTGEPLPAWVRRDEGLGSVEDVTGLIVFLASDASAGITGQAIGIGGDRLALWAHPQEKTVAFSDGGWSAADIAEGWSSTFKELETYGIPAPHPPAA

Samples

Sample ID Description Type Environment
1 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
2 2643221575 Microbacterium sp. Root61 Isolate Unclassified
3 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
4 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
5 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
6 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
7 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
8 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
9 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
10 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
11 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
12 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
13 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
14 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
15 2891562705 Microbispora tritici MT50 Isolate Unclassified
16 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
17 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
18 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
19 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
20 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
21 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
22 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
182 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
183 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
184 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.58
Metatranscriptomes 0.39
Isolates 10.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.2
Nodule 0.39
Rhizoplane 1.16
Rhizosphere 68.73
Stem 0
Stem Tuber 0.39
Unclassified 18.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005608 3300003203 Bacteria 5811
2 rootH2_10132167 3300003320 Bacteria 2785
3 rootL2_10087152 3300003322 Bacteria 5322
4 rootH1_10011996 3300003323 Bacteria 4217
5 Ga0070658_10000266 3300005327 Bacteria 46035
6 Ga0070682_100020679 3300005337 Bacteria 3876
7 Ga0070682_100081627 3300005337 Bacteria 2094
8 Ga0070660_100057774 3300005339 Bacteria 3007
9 Ga0070660_100160811 3300005339 Bacteria 1810
10 Ga0070668_100000325 3300005347 Bacteria 31383
11 Ga0070668_100071287 3300005347 Bacteria 2706
12 Ga0070659_100034950 3300005366 Bacteria 3911
13 Ga0070667_100045945 3300005367 Bacteria 3673
14 Ga0070667_100056716 3300005367 Bacteria 3310
15 Ga0070710_10001465 3300005437 Bacteria 11109
16 Ga0070679_100392943 3300005530 Bacteria 1333
17 Ga0070684_100024393 3300005535 Bacteria 5074
18 Ga0070684_100065121 3300005535 Bacteria 3198
19 Ga0068853_100086570 3300005539 Bacteria 2748
20 Ga0070672_100021786 3300005543 Bacteria 4694
21 Ga0070665_100000392 3300005548 Bacteria 64775
22 Ga0068855_100653441 3300005563 Bacteria 1129
23 Ga0068859_100255537 3300005617 Bacteria 1843
24 Ga0068861_100040431 3300005719 Bacteria 3488
25 Ga0068870_10013587 3300005840 Bacteria 3831
26 Ga0068858_100168644 3300005842 Bacteria 2063
27 Ga0068860_100001295 3300005843 Bacteria 27189
28 Ga0068860_100383060 3300005843 Bacteria 1389
29 Ga0068862_100096551 3300005844 Bacteria 2580
30 Ga0081455_10011997 3300005937 Bacteria 8671
31 Ga0081539_10000659 3300005985 Bacteria 69319
32 Ga0081539_10001092 3300005985 Bacteria 49318
33 Ga0081539_10002941 3300005985 Bacteria 22410
34 Ga0081539_10014374 3300005985 Bacteria 5860
35 Ga0075365_10058348 3300006038 Bacteria 2569
36 Ga0075365_10275970 3300006038 Bacteria 1182
37 Ga0075368_10003131 3300006042 Bacteria 5489
38 Ga0075363_100003487 3300006048 Bacteria 6696
39 Ga0075363_100006854 3300006048 Bacteria 5207
40 Ga0075363_100075381 3300006048 Bacteria 1838
41 Ga0075363_100250561 3300006048 Bacteria 1019
42 Ga0075364_10005972 3300006051 Bacteria 7115
43 Ga0075364_10045383 3300006051 Bacteria 2860
44 Ga0075364_10083756 3300006051 Bacteria 2111
45 Ga0075367_10068236 3300006178 Bacteria 2133
46 Ga0075367_10081816 3300006178 Bacteria 1954
47 Ga0075369_10154853 3300006186 Bacteria 1049
48 Ga0075370_10005065 3300006353 Bacteria 6493
49 Ga0075370_10054783 3300006353 Bacteria 2265
50 Ga0075428_100003289 3300006844 Bacteria 17671
51 Ga0075428_100084753 3300006844 Bacteria 3457
52 Ga0075430_100365224 3300006846 Bacteria 1192
53 Ga0075431_100239096 3300006847 Bacteria 1848
54 Ga0097620_100255520 3300006931 Bacteria 1843
55 Ga0105245_10225016 3300009098 Bacteria 1812
56 Ga0114129_10004691 3300009147 Bacteria 19306
57 Ga0114129_10182942 3300009147 Bacteria 2850
58 Ga0105243_10031844 3300009148 Bacteria 4069
59 Ga0105248_10017858 3300009177 Bacteria 7829
60 Ga0105249_10070710 3300009553 Bacteria 3222
61 Ga0105239_10008082 3300010375 Bacteria 12008
62 Ga0157372_10387597 3300013307 Bacteria 1628
63 Ga0157375_10254861 3300013308 Bacteria 1916
64 Ga0157380_10056608 3300014326 Bacteria 3119
65 Ga0157376_10348277 3300014969 Bacteria 1417
66 Ga0206353_11796372 3300020082 Bacteria 1988
67 Ga0207692_10002150 3300025898 Bacteria 7530
68 Ga0207647_10010926 3300025904 Bacteria 6386
69 Ga0207643_10021246 3300025908 Bacteria 3564
70 Ga0207705_10000001 3300025909 Bacteria 2061880
71 Ga0207657_10046845 3300025919 Bacteria 3785
72 Ga0207700_10242531 3300025928 Bacteria 1537
73 Ga0207644_10125230 3300025931 Bacteria 1961
74 Ga0207690_10012346 3300025932 Bacteria 5110
75 Ga0207690_10088166 3300025932 Bacteria 2185
76 Ga0207709_10049913 3300025935 Bacteria 2556
77 Ga0207670_10286412 3300025936 Bacteria 1286
78 Ga0207691_10025044 3300025940 Bacteria 5607
79 Ga0207689_10398355 3300025942 Bacteria 1147
80 Ga0207661_10124039 3300025944 Bacteria 2204
81 Ga0207661_10430355 3300025944 Bacteria 1200
82 Ga0207667_10086876 3300025949 Bacteria 3236
83 Ga0207667_10359474 3300025949 Bacteria 1485
84 Ga0207712_10042553 3300025961 Bacteria 3128
85 Ga0207668_10000985 3300025972 Bacteria 17116
86 Ga0207668_10073466 3300025972 Bacteria 2451
87 Ga0207658_10063837 3300025986 Bacteria 2761
88 Ga0207677_10164446 3300026023 Bacteria 1728
89 Ga0207703_10057010 3300026035 Bacteria 3183
90 Ga0207678_10061133 3300026067 Bacteria 3240
91 Ga0207675_100006085 3300026118 Bacteria 11481
92 Ga0207675_100134629 3300026118 Bacteria 2344
93 Ga0207683_10415781 3300026121 Bacteria 1238
94 Ga0209813_10005793 3300027866 Bacteria 3020
95 Ga0209813_10011531 3300027866 Bacteria 2313
96 Ga0268266_10000542 3300028379 Bacteria 52683
97 Ga0268266_10391380 3300028379 Bacteria 1313
98 Ga0268266_10447442 3300028379 Bacteria 1228
99 Ga0268265_10046226 3300028380 Bacteria 3253
100 Ga0268264_10001702 3300028381 Bacteria 20262
101 Ga0268264_10012103 3300028381 Bacteria 7103
102 Ga0307511_10112264 3300030521 Bacteria 1728
103 Ga0307511_10211284 3300030521 Bacteria 990
104 Ga0265327_10001401 3300031251 Bacteria 30722
105 Ga0307513_10000003 3300031456 Bacteria 590921
106 Ga0307513_10002116 3300031456 Bacteria 27860
107 Ga0307513_10010160 3300031456 Bacteria 11836
108 Ga0307513_10012373 3300031456 Bacteria 10543
109 Ga0307509_10003331 3300031507 Bacteria 24560
110 Ga0307509_10038034 3300031507 Bacteria 5254
111 Ga0307508_10045026 3300031616 Bacteria 3943
112 Ga0307405_10001235 3300031731 Bacteria 10633
113 Ga0307405_10203339 3300031731 Bacteria 1440
114 Ga0307413_10143394 3300031824 Bacteria 1654
115 Ga0307413_10183319 3300031824 Bacteria 1495
116 Ga0307410_10018510 3300031852 Bacteria 4211
117 Ga0307410_10077066 3300031852 Bacteria 2329
118 Ga0307406_10012874 3300031901 Bacteria 4778
119 Ga0307412_10057599 3300031911 Bacteria 2595
120 Ga0307409_100001384 3300031995 Bacteria 11838
121 Ga0307409_100080506 3300031995 Bacteria 2628
122 Ga0307409_100101285 3300031995 Bacteria 2390
123 Ga0307409_100252577 3300031995 Bacteria 1613
124 Ga0307416_100000437 3300032002 Bacteria 21314
125 Ga0307416_100100209 3300032002 Bacteria 2518
126 Ga0307416_100234927 3300032002 Bacteria 1771
127 Ga0307416_100457101 3300032002 Bacteria 1331
128 Ga0307414_10373873 3300032004 Bacteria 1230
129 Ga0307411_10281269 3300032005 Bacteria 1324
130 Ga0307415_100000239 3300032126 Bacteria 23864
131 Ga0307415_100119497 3300032126 Bacteria 1973
132 Ga0307415_100305297 3300032126 Bacteria 1320
133 Ga0307507_10090589 3300033179 Bacteria 2624
134 Ga0307507_10091216 3300033179 Bacteria 2610
135 Ga0307510_10065258 3300033180 Bacteria 3689
136 Ga0373940_0012126 3300035088 Bacteria 2061
137 Ga0373951_0001251 3300035091 Bacteria 6719
138 Ga0373932_0023320 3300035112 Bacteria 1654
139 Ga0373942_0001651 3300035207 Bacteria 5667
140 Ga0373935_0027454 3300035692 Bacteria 3518
141 Ga0395900_0201708 3300037418 Bacteria 2012
142 Ga0395898_0051572 3300037466 Bacteria 4023
143 Ga0395901_0004276 3300038443 Bacteria 14407
144 Ga0395901_0029934 3300038443 Bacteria 5608
145 Ga0395901_0095415 3300038443 Bacteria 3117
146 Ga0466969_0002229 3300044656 Bacteria 10358
147 Ga0466972_0017673 3300044658 Bacteria 3569
148 Ga0466965_0003098 3300044683 Bacteria 7247
149 Ga0466965_0120049 3300044683 Bacteria 1357
150 Ga0466966_0002797 3300044684 Bacteria 11474
151 Ga0466961_0003752 3300044693 Bacteria 9500
152 Ga0466963_0137802 3300044694 Bacteria 1689
153 Ga0466971_0000209 3300044719 Bacteria 22678
154 Ga0466970_0269000 3300044765 Bacteria 957
155 Ga0466960_0002886 3300044901 Bacteria 6528
156 Ga0466960_0201265 3300044901 Bacteria 1088
157 Ga0466959_0005705 3300045049 Bacteria 8562
158 Ga0466959_0113867 3300045049 Bacteria 1928
159 Ga0466958_0007008 3300045836 Bacteria 6166
160 Ga0466958_0165589 3300045836 Bacteria 1398
161 Ga0466958_0268190 3300045836 Bacteria 1093
162 Ga0466967_0155499 3300045976 Bacteria 2141
163 Ga0466967_0456643 3300045976 Bacteria 1249
164 Ga0495607_0013405 3300046501 Bacteria 5373
165 Ga0495599_0048173 3300046678 Bacteria 2671
166 Ga0495683_0003203 3300047323 Bacteria 9566
167 Ga0496108_0000020 3300048911 Bacteria 226992
168 Ga0496109_0064968 3300048912 Bacteria 3340
169 Ga0496110_0546716 3300048913 Bacteria 1053
170 Ga0496117_0007632 3300048920 Bacteria 10496
171 Ga0496118_0004720 3300048921 Bacteria 15955
172 Ga0496118_0078183 3300048921 Bacteria 2342
173 Ga0496119_0001959 3300048922 Bacteria 23406
174 Ga0496119_0007775 3300048922 Bacteria 9558
175 Ga0496120_0002813 3300048923 Bacteria 16803
176 Ga0496120_0011466 3300048923 Bacteria 6093
177 Ga0496122_0000208 3300048925 Bacteria 131175
178 Ga0496122_0000235 3300048925 Bacteria 124769
179 Ga0496123_0000003 3300048926 Bacteria 866556
180 Ga0496123_0000036 3300048926 Bacteria 265722
181 Ga0496124_0002889 3300048927 Bacteria 21677
182 Ga0496125_0012663 3300048928 Bacteria 8348
183 Ga0496125_0015032 3300048928 Bacteria 7516
184 Ga0496126_0009294 3300048929 Bacteria 10470
185 Ga0496126_0071321 3300048929 Bacteria 3092
186 Ga0501031_0002975 3300049568 Bacteria 10853
187 Ga0501032_0073109 3300049569 Bacteria 2284
188 Ga0501033_0012875 3300049570 Bacteria 6380
189 Ga0501034_0112735 3300049571 Bacteria 2709
190 Ga0501034_0159411 3300049571 Bacteria 2228
191 Ga0501036_0092189 3300049572 Bacteria 2559
192 Ga0501037_0010981 3300049573 Bacteria 6659
193 Ga0501042_0060485 3300049578 Bacteria 2705
194 Ga0501043_0002153 3300049579 Bacteria 16795
195 Ga0501046_0058164 3300049580 Bacteria 3031
196 Ga0501047_0006512 3300049581 Bacteria 10993
197 Ga0501047_0058831 3300049581 Bacteria 3712
198 Ga0501048_0005113 3300049582 Bacteria 9994
199 Ga0501068_0029980 3300049584 Bacteria 3225
200 Ga0501069_0009508 3300049585 Bacteria 5131
201 Ga0501070_0161903 3300049586 Bacteria 1844
202 Ga0501071_0400407 3300049587 Bacteria 1048
203 Ga0501076_0189234 3300049592 Bacteria 1679
204 Ga0501035_0005570 3300049822 Bacteria 11897
205 Ga0501044_0013105 3300049823 Bacteria 8975
206 Ga0501044_0064510 3300049823 Bacteria 3739
207 Ga0501045_0215925 3300049824 Bacteria 1428
208 nmdc:mga03n38_56114_c1 3300050490 Bacteria 1777
209 nmdc:mga03n38_6074_c1 3300050490 Bacteria 4169
210 nmdc:mga00v17_134199_c1 3300050491 Bacteria 1584
211 nmdc:mga00v17_214886_c1 3300050491 Bacteria 1245
212 nmdc:mga00v17_4688_c1 3300050491 Bacteria 7143
213 nmdc:mga0yw44_40767_c1 3300050492 Bacteria 2761
214 nmdc:mga0yw44_84481_c1 3300050492 Bacteria 1996
215 nmdc:mga06z11_2476_c1 3300050494 Bacteria 7062
216 nmdc:mga04h51_3103_c1 3300050495 Bacteria 4008
217 nmdc:mga07m45_53704_c1 3300050496 Bacteria 2277
218 nmdc:mga05p37_157643_c1 3300050507 Bacteria 2773
219 nmdc:mga05p37_19717_c1 3300050507 Bacteria 8159
220 nmdc:mga05p37_32345_c1 3300050507 Bacteria 6397
221 nmdc:mga09592_8405_c1 3300050508 Bacteria 8391
222 nmdc:mga0qj67_1532_c2 3300050509 Bacteria 14906
223 nmdc:mga0qj67_364420_c1 3300050509 Bacteria 1168
224 nmdc:mga0qj67_4359_c1 3300050509 Bacteria 10248
225 nmdc:mga06r32_1944_c2 3300050510 Bacteria 14906
226 nmdc:mga06r32_421103_c1 3300050510 Bacteria 1317
227 nmdc:mga06r32_422005_c1 3300050510 Bacteria 1315
228 nmdc:mga0sz30_2642_c1 3300050516 Bacteria 5489
229 Ga0500556_0000163 3300053104 Bacteria 54246
230 Ga0501084_0284369 3300054114 Bacteria 1397
231 Ga0466962_0000067 3300061719 Bacteria 43452
232 Ga0466962_0018436 3300061719 Bacteria 3357
233 Ga0530510_0292807 3300061734 Bacteria 1217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_10143394 Ga0307413_101433942 240
2 3300044901 Ga0466960_0201265 Ga0466960_0201265_38_946 240
3 3300044694 Ga0466963_0137802 Ga0466963_0137802_723_1631 243
4 3300045976 Ga0466967_0456643 Ga0466967_0456643_225_1133 243
5 3300035692 Ga0373935_0027454 Ga0373935_0027454_861_1805 244
6 3300006186 Ga0075369_10154853 Ga0075369_101548531 245
7 3300048921 Ga0496118_0078183 Ga0496118_0078183_1038_1952 245
8 3300048922 Ga0496119_0007775 Ga0496119_0007775_7726_8640 245
9 3300048923 Ga0496120_0002813 Ga0496120_0002813_2002_2916 245
10 3300048925 Ga0496122_0000208 Ga0496122_0000208_35296_36210 245
11 3300048926 Ga0496123_0000003 Ga0496123_0000003_32847_33761 245
12 3300048928 Ga0496125_0012663 Ga0496125_0012663_2962_3876 245
13 3300030521 Ga0307511_10112264 Ga0307511_101122642 247
14 3300033180 Ga0307510_10065258 Ga0307510_100652582 247
15 3300030521 Ga0307511_10211284 Ga0307511_102112841 251
16 3300037466 Ga0395898_0051572 Ga0395898_0051572_2301_3209 252
17 3300038443 Ga0395901_0004276 Ga0395901_0004276_68_976 252
18 3300049584 Ga0501068_0029980 Ga0501068_0029980_112_1035 253
19 3300003320 rootH2_10132167 rootH2_101321672 254
20 3300003323 rootH1_10011996 rootH1_100119964 254
21 3300014969 Ga0157376_10348277 Ga0157376_103482772 254
22 3300033179 Ga0307507_10090589 Ga0307507_100905892 254
23 3300048911 Ga0496108_0000020 Ga0496108_0000020_216305_217240 254
24 3300031456 Ga0307513_10000003 Ga0307513_10000003491 255
25 3300031852 Ga0307410_10018510 Ga0307410_100185103 255
26 3300044765 Ga0466970_0269000 Ga0466970_0269000_24_935 256
27 3300005530 Ga0070679_100392943 Ga0070679_1003929432 257
28 3300031507 Ga0307509_10038034 Ga0307509_100380344 257
29 3300048929 Ga0496126_0071321 Ga0496126_0071321_1995_2906 257
30 3300005985 Ga0081539_10002941 Ga0081539_1000294113 258
31 3300009147 Ga0114129_10182942 Ga0114129_101829422 258
32 3300025942 Ga0207689_10398355 Ga0207689_103983552 258
33 3300031731 Ga0307405_10001235 Ga0307405_100012358 258
34 3300031852 Ga0307410_10077066 Ga0307410_100770662 258
35 3300031911 Ga0307412_10057599 Ga0307412_100575992 258
36 3300031995 Ga0307409_100001384 Ga0307409_1000013846 258
37 3300032002 Ga0307416_100000437 Ga0307416_10000043711 258
38 3300032126 Ga0307415_100000239 Ga0307415_10000023912 258
39 3300032126 Ga0307415_100119497 Ga0307415_1001194972 258
40 3300050507 nmdc:mga05p37_157643_c1 nmdc:mga05p37_157643_c1_1164_2084 258
41 3300006038 Ga0075365_10058348 Ga0075365_100583481 259
42 3300006042 Ga0075368_10003131 Ga0075368_100031312 259
43 3300006048 Ga0075363_100003487 Ga0075363_1000034876 259
44 3300006178 Ga0075367_10081816 Ga0075367_100818161 259
45 3300006353 Ga0075370_10005065 Ga0075370_100050653 259
46 3300027866 Ga0209813_10011531 Ga0209813_100115312 259
47 3300050490 nmdc:mga03n38_56114_c1 nmdc:mga03n38_56114_c1_397_1320 259
48 3300050491 nmdc:mga00v17_214886_c1 nmdc:mga00v17_214886_c1_158_1081 259
49 3300050492 nmdc:mga0yw44_40767_c1 nmdc:mga0yw44_40767_c1_220_1143 259
50 3300050496 nmdc:mga07m45_53704_c1 nmdc:mga07m45_53704_c1_870_1793 259
51 3300005535 Ga0070684_100065121 Ga0070684_1000651212 260
52 3300020082 Ga0206353_11796372 Ga0206353_117963722 260
53 3300031995 Ga0307409_100252577 Ga0307409_1002525772 260
54 3300032002 Ga0307416_100457101 Ga0307416_1004571012 260
55 3300032126 Ga0307415_100305297 Ga0307415_1003052972 260
56 3300006038 Ga0075365_10275970 Ga0075365_102759701 261
57 3300031901 Ga0307406_10012874 Ga0307406_100128742 261
58 3300025928 Ga0207700_10242531 Ga0207700_102425312 263
59 3300031731 Ga0307405_10203339 Ga0307405_102033391 263
60 3300045049 Ga0466959_0113867 Ga0466959_0113867_586_1494 263
61 3300005985 Ga0081539_10014374 Ga0081539_100143745 264
62 3300006048 Ga0075363_100075381 Ga0075363_1000753811 264
63 3300006051 Ga0075364_10005972 Ga0075364_100059726 264
64 3300006178 Ga0075367_10068236 Ga0075367_100682362 264
65 3300044656 Ga0466969_0002229 Ga0466969_0002229_2581_3504 264
66 3300044684 Ga0466966_0002797 Ga0466966_0002797_5296_6219 264
67 3300044693 Ga0466961_0003752 Ga0466961_0003752_3202_4125 264
68 3300044719 Ga0466971_0000209 Ga0466971_0000209_16857_17780 264
69 3300045049 Ga0466959_0005705 Ga0466959_0005705_6204_7127 264
70 3300045836 Ga0466958_0007008 Ga0466958_0007008_5096_6019 264
71 3300045836 Ga0466958_0165589 Ga0466958_0165589_65_973 264
72 3300049592 Ga0501076_0189234 Ga0501076_0189234_354_1259 264
73 3300049824 Ga0501045_0215925 Ga0501045_0215925_268_1173 264
74 3300050491 nmdc:mga00v17_4688_c1 nmdc:mga00v17_4688_c1_793_1704 264
75 3300050516 nmdc:mga0sz30_2642_c1 nmdc:mga0sz30_2642_c1_2414_3325 264
76 3300061719 Ga0466962_0000067 Ga0466962_0000067_16885_17808 264
77 3300061719 Ga0466962_0018436 Ga0466962_0018436_2369_3277 264
78 3300061734 Ga0530510_0292807 Ga0530510_0292807_184_1089 264
79 3300005985 Ga0081539_10001092 Ga0081539_100010923 265
80 3300006048 Ga0075363_100006854 Ga0075363_1000068544 265
81 3300027866 Ga0209813_10005793 Ga0209813_100057932 265
82 3300035091 Ga0373951_0001251 Ga0373951_0001251_2764_3675 265
83 3300050490 nmdc:mga03n38_6074_c1 nmdc:mga03n38_6074_c1_1509_2432 265
84 3300050494 nmdc:mga06z11_2476_c1 nmdc:mga06z11_2476_c1_4019_4942 265
85 3300050495 nmdc:mga04h51_3103_c1 nmdc:mga04h51_3103_c1_2621_3544 265
86 3300053104 Ga0500556_0000163 Ga0500556_0000163_39752_40663 265
87 3300044683 Ga0466965_0003098 Ga0466965_0003098_2387_3259 266
88 iso_pu_bacteria 2895427314 2895430015 266
89 3300031456 Ga0307513_10010160 Ga0307513_1001016010 267
90 3300005437 Ga0070710_10001465 Ga0070710_100014654 268
91 3300025898 Ga0207692_10002150 Ga0207692_100021509 268
92 3300044658 Ga0466972_0017673 Ga0466972_0017673_2313_3191 268
93 3300044901 Ga0466960_0002886 Ga0466960_0002886_5400_6278 268
94 3300005937 Ga0081455_10011997 Ga0081455_100119975 269
95 3300033179 Ga0307507_10091216 Ga0307507_100912162 269
96 3300035088 Ga0373940_0012126 Ga0373940_0012126_1053_2024 269
97 3300035207 Ga0373942_0001651 Ga0373942_0001651_3932_4903 269
98 3300044683 Ga0466965_0120049 Ga0466965_0120049_10_933 269
99 3300006048 Ga0075363_100250561 Ga0075363_1002505611 270
100 3300006051 Ga0075364_10083756 Ga0075364_100837562 270
101 3300006847 Ga0075431_100239096 Ga0075431_1002390962 270
102 3300028379 Ga0268266_10391380 Ga0268266_103913802 270
103 3300050491 nmdc:mga00v17_134199_c1 nmdc:mga00v17_134199_c1_472_1395 270
104 3300050492 nmdc:mga0yw44_84481_c1 nmdc:mga0yw44_84481_c1_50_973 270
105 3300050510 nmdc:mga06r32_422005_c1 nmdc:mga06r32_422005_c1_235_1140 270
106 3300009147 Ga0114129_10004691 Ga0114129_1000469113 271
107 3300032002 Ga0307416_100234927 Ga0307416_1002349272 271
108 3300049568 Ga0501031_0002975 Ga0501031_0002975_653_1564 271
109 3300049569 Ga0501032_0073109 Ga0501032_0073109_278_1189 271
110 3300049570 Ga0501033_0012875 Ga0501033_0012875_2684_3595 271
111 3300049571 Ga0501034_0159411 Ga0501034_0159411_1148_2059 271
112 3300049572 Ga0501036_0092189 Ga0501036_0092189_1071_1982 271
113 3300049578 Ga0501042_0060485 Ga0501042_0060485_1257_2168 271
114 3300049579 Ga0501043_0002153 Ga0501043_0002153_8388_9299 271
115 3300049582 Ga0501048_0005113 Ga0501048_0005113_5760_6671 271
116 3300049822 Ga0501035_0005570 Ga0501035_0005570_8864_9775 271
117 3300049823 Ga0501044_0013105 Ga0501044_0013105_1986_2897 271
118 3300050507 nmdc:mga05p37_19717_c1 nmdc:mga05p37_19717_c1_4665_5582 271
119 3300050508 nmdc:mga09592_8405_c1 nmdc:mga09592_8405_c1_2159_3076 271
120 3300050509 nmdc:mga0qj67_1532_c2 nmdc:mga0qj67_1532_c2_5316_6233 271
121 3300050510 nmdc:mga06r32_1944_c2 nmdc:mga06r32_1944_c2_5316_6233 271
122 3300054114 Ga0501084_0284369 Ga0501084_0284369_246_1157 271
123 3300006846 Ga0075430_100365224 Ga0075430_1003652242 272
124 3300049571 Ga0501034_0112735 Ga0501034_0112735_1657_2568 272
125 3300049573 Ga0501037_0010981 Ga0501037_0010981_3232_4143 272
126 3300049580 Ga0501046_0058164 Ga0501046_0058164_1554_2465 272
127 3300049581 Ga0501047_0006512 Ga0501047_0006512_4879_5790 272
128 3300049823 Ga0501044_0064510 Ga0501044_0064510_2411_3322 272
129 3300050509 nmdc:mga0qj67_364420_c1 nmdc:mga0qj67_364420_c1_234_1142 272
130 iso_pu_bacteria 2899370129 2899376516 272
131 3300005347 Ga0070668_100000325 Ga0070668_10000032511 273
132 3300005719 Ga0068861_100040431 Ga0068861_1000404312 273
133 3300005844 Ga0068862_100096551 Ga0068862_1000965511 273
134 3300025972 Ga0207668_10000985 Ga0207668_100009856 273
135 3300026118 Ga0207675_100134629 Ga0207675_1001346292 273
136 3300028380 Ga0268265_10046226 Ga0268265_100462263 273
137 3300049587 Ga0501071_0400407 Ga0501071_0400407_13_954 273
138 iso_pu_bacteria 2915768154 2915769986 273
139 3300005339 Ga0070660_100057774 Ga0070660_1000577743 274
140 3300025904 Ga0207647_10010926 Ga0207647_100109263 274
141 3300025919 Ga0207657_10046845 Ga0207657_100468454 274
142 3300025932 Ga0207690_10088166 Ga0207690_100881663 274
143 3300031824 Ga0307413_10183319 Ga0307413_101833192 274
144 3300031995 Ga0307409_100101285 Ga0307409_1001012853 274
145 3300038443 Ga0395901_0029934 Ga0395901_0029934_2711_3616 274
146 iso_pu_bacteria 2868088558 2868089549 274
147 iso_pu_bacteria 2945968032 2945969485 274
148 3300005347 Ga0070668_100071287 Ga0070668_1000712873 275
149 3300005367 Ga0070667_100045945 Ga0070667_1000459454 275
150 3300005617 Ga0068859_100255537 Ga0068859_1002555372 275
151 3300005842 Ga0068858_100168644 Ga0068858_1001686442 275
152 3300005843 Ga0068860_100383060 Ga0068860_1003830602 275
153 3300006931 Ga0097620_100255520 Ga0097620_1002555202 275
154 3300009098 Ga0105245_10225016 Ga0105245_102250161 275
155 3300013308 Ga0157375_10254861 Ga0157375_102548612 275
156 3300025931 Ga0207644_10125230 Ga0207644_101252302 275
157 3300025944 Ga0207661_10124039 Ga0207661_101240392 275
158 3300025972 Ga0207668_10073466 Ga0207668_100734662 275
159 3300026035 Ga0207703_10057010 Ga0207703_100570102 275
160 3300026121 Ga0207683_10415781 Ga0207683_104157812 275
161 3300028379 Ga0268266_10447442 Ga0268266_104474421 275
162 3300028381 Ga0268264_10012103 Ga0268264_100121034 275
163 3300031507 Ga0307509_10003331 Ga0307509_1000333110 275
164 3300035112 Ga0373932_0023320 Ga0373932_0023320_42_1004 275
165 3300048920 Ga0496117_0007632 Ga0496117_0007632_3799_4728 275
166 3300048921 Ga0496118_0004720 Ga0496118_0004720_14503_15432 275
167 3300048922 Ga0496119_0001959 Ga0496119_0001959_17340_18269 275
168 3300048923 Ga0496120_0011466 Ga0496120_0011466_3473_4402 275
169 3300048925 Ga0496122_0000235 Ga0496122_0000235_110428_111357 275
170 3300048926 Ga0496123_0000036 Ga0496123_0000036_13417_14346 275
171 3300048927 Ga0496124_0002889 Ga0496124_0002889_3784_4713 275
172 3300048928 Ga0496125_0015032 Ga0496125_0015032_792_1721 275
173 3300048929 Ga0496126_0009294 Ga0496126_0009294_2008_2937 275
174 iso_pu_bacteria 2616644941 2616905927 275
175 iso_pu_bacteria 2643221632 2644181029 275
176 iso_pu_bacteria 2751185734 2753072410 275
177 iso_pu_bacteria 2751185782 2753269118 275
178 iso_pu_bacteria 2870721527 2870723212 275
179 iso_pu_bacteria 2897561785 2897564704 275
180 iso_pu_bacteria 8055034563 8055034676 275
181 iso_pu_bacteria 2643221632 2644182466 276
182 iso_pu_bacteria 2891395885 2891402177 276
183 iso_pu_bacteria 8055172936 8055178347 276
184 3300005327 Ga0070658_10000266 Ga0070658_100002665 277
185 3300005339 Ga0070660_100160811 Ga0070660_1001608114 277
186 3300005366 Ga0070659_100034950 Ga0070659_1000349503 277
187 3300025909 Ga0207705_10000001 Ga0207705_10000001606 277
188 3300025932 Ga0207690_10012346 Ga0207690_100123464 277
189 3300025949 Ga0207667_10086876 Ga0207667_100868762 277
190 3300026067 Ga0207678_10061133 Ga0207678_100611334 277
191 iso_pu_bacteria 2643221575 2643886922 277
192 iso_pu_bacteria 2808606447 2809228638 277
193 iso_pu_bacteria 2852632344 2852633990 277
194 iso_pu_bacteria 2990088156 2990089630 277
195 iso_pu_bacteria 8054609563 8054614549 277
196 3300005337 Ga0070682_100081627 Ga0070682_1000816272 278
197 3300005548 Ga0070665_100000392 Ga0070665_10000039243 278
198 3300006844 Ga0075428_100003289 Ga0075428_1000032895 278
199 3300006844 Ga0075428_100084753 Ga0075428_1000847533 278
200 3300028379 Ga0268266_10000542 Ga0268266_1000054225 278
201 3300031456 Ga0307513_10012373 Ga0307513_100123734 278
202 3300031995 Ga0307409_100080506 Ga0307409_1000805062 278
203 3300032002 Ga0307416_100100209 Ga0307416_1001002092 278
204 3300032004 Ga0307414_10373873 Ga0307414_103738732 278
205 3300032005 Ga0307411_10281269 Ga0307411_102812692 278
206 3300037418 Ga0395900_0201708 Ga0395900_0201708_152_1060 278
207 3300038443 Ga0395901_0095415 Ga0395901_0095415_1602_2510 278
208 3300045836 Ga0466958_0268190 Ga0466958_0268190_10_918 278
209 3300045976 Ga0466967_0155499 Ga0466967_0155499_54_962 278
210 3300049581 Ga0501047_0058831 Ga0501047_0058831_355_1272 278
211 3300049585 Ga0501069_0009508 Ga0501069_0009508_2844_3752 278
212 3300049586 Ga0501070_0161903 Ga0501070_0161903_240_1148 278
213 3300050507 nmdc:mga05p37_32345_c1 nmdc:mga05p37_32345_c1_3435_4343 278
214 3300050509 nmdc:mga0qj67_4359_c1 nmdc:mga0qj67_4359_c1_8995_9903 278
215 3300050510 nmdc:mga06r32_421103_c1 nmdc:mga06r32_421103_c1_198_1106 278
216 iso_pu_bacteria 2891554331 2891561665 278
217 iso_pu_bacteria 2895442618 2895445389 278
218 3300003322 rootL2_10087152 rootL2_100871522 279
219 3300031251 Ga0265327_10001401 Ga0265327_1000140120 279
220 3300046678 Ga0495599_0048173 Ga0495599_0048173_364_1287 279
221 iso_pu_bacteria 2891562705 2891567671 279
222 3300005337 Ga0070682_100020679 Ga0070682_1000206794 280
223 3300005535 Ga0070684_100024393 Ga0070684_1000243934 280
224 3300005539 Ga0068853_100086570 Ga0068853_1000865701 280
225 3300005543 Ga0070672_100021786 Ga0070672_1000217865 280
226 3300005563 Ga0068855_100653441 Ga0068855_1006534411 280
227 3300005840 Ga0068870_10013587 Ga0068870_100135874 280
228 3300009148 Ga0105243_10031844 Ga0105243_100318443 280
229 3300009177 Ga0105248_10017858 Ga0105248_100178581 280
230 3300009553 Ga0105249_10070710 Ga0105249_100707102 280
231 3300010375 Ga0105239_10008082 Ga0105239_1000808211 280
232 3300014326 Ga0157380_10056608 Ga0157380_100566084 280
233 3300025908 Ga0207643_10021246 Ga0207643_100212464 280
234 3300025935 Ga0207709_10049913 Ga0207709_100499132 280
235 3300025936 Ga0207670_10286412 Ga0207670_102864122 280
236 3300025940 Ga0207691_10025044 Ga0207691_100250445 280
237 3300025949 Ga0207667_10359474 Ga0207667_103594741 280
238 3300025961 Ga0207712_10042553 Ga0207712_100425534 280
239 3300026023 Ga0207677_10164446 Ga0207677_101644461 280
240 3300026118 Ga0207675_100006085 Ga0207675_1000060857 280
241 3300048912 Ga0496109_0064968 Ga0496109_0064968_1155_2078 280
242 3300048913 Ga0496110_0546716 Ga0496110_0546716_96_1019 280
243 3300013307 Ga0157372_10387597 Ga0157372_103875972 281
244 3300025944 Ga0207661_10430355 Ga0207661_104303551 281
245 3300046501 Ga0495607_0013405 Ga0495607_0013405_297_1211 281
246 3300047323 Ga0495683_0003203 Ga0495683_0003203_1600_2514 281
247 iso_pu_bacteria 2728369276 2729907289 281
248 iso_pu_bacteria 2738541272 2738695616 281
249 iso_pu_bacteria 2738543027 2739326241 281
250 3300031456 Ga0307513_10002116 Ga0307513_100021165 282
251 3300003203 JGI25406J46586_10005608 JGI25406J46586_100056084 283
252 3300005367 Ga0070667_100056716 Ga0070667_1000567163 283
253 3300005843 Ga0068860_100001295 Ga0068860_1000012954 283
254 3300005985 Ga0081539_10000659 Ga0081539_1000065927 283
255 3300006051 Ga0075364_10045383 Ga0075364_100453832 283
256 3300006353 Ga0075370_10054783 Ga0075370_100547832 283
257 3300025986 Ga0207658_10063837 Ga0207658_100638372 283
258 3300028381 Ga0268264_10001702 Ga0268264_100017026 283
259 3300031616 Ga0307508_10045026 Ga0307508_100450263 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

21

211

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

27

264

0.91

PF08659

KR

KR domain

21

196

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ig2-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum in complex with nad 0.9308 10 170
3o38-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from mycobacterium smegmatis 0.9191 10 227
5ovk-assembly1.cif.gz_C crystal structure maba bound to nadph from m. smegmatis 0.9173 41 228
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9155 8 228
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9135 6 162
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.951 69 162 3.40.50.720
af_Q54HW7_18_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9405 41 164 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9401 10 235 3.40.50.720
5ig2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9352 10 165 3.40.50.720
af_A0A0R0IEI4_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9235 26 226 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2J1DVF9-F1-model_v4 Short-chain dehydrogenase 0.9539 2 136 GO:0006633
GO:0016616
GO:0048038
AF-U4KRH9-F1-model_v4 Putative acetoin dehydrogenase BudC (EC 1.1.1.303) 0.9506 9 162 GO:0052587
AF-A0A5C7XHG4-F1-model_v4 SDR family oxidoreductase 0.9502 10 162 GO:0016491
AF-A0A7C4SFP5-F1-model_v4 SDR family oxidoreductase 0.9421 1 166 GO:0016616
GO:0030497
AF-A0A7V8KPU2-F1-model_v4 deleted 0.9409 10 162

Feature Viewer

pLDDT pTM Quality
92.87 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map