F367709

General Info

Members Datasets Scaffolds Average Seq Length
257 193 210 266

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2773857758|2774378910
Length 293
Sequence LSKRAVSPRPRPPDVGLRSSIYKKPAQLRSMIEPGLITADALDAVRSLIEPGVTTLELDAAASSLITARGAVSNFQMVRGYRHTVCASVNEQVVHGIPNDRPLQAGDILSIDAGAEFRGWNGDSAFTVIVPGDAPEELVAPRRRLSEVTEGSLWAGIAALSRASHLSEVGAAIEQYIDAHAPEGGYGILRDYVGHGIGRKMHESPSIFNYAVADRGPEVRPGLAVAIEPMVVIGDQQTFTEDDGWTVSTVDGTAGSHWEHSVAVHDGGIWVLTAHDGGAEKLAPFGVVPKEID

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221553 Microbacterium sp. Root553 Isolate Unclassified
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2643221630 Microbacterium sp. Root322 Isolate Unclassified
7 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
8 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
9 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
10 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
11 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
12 2773857759 Microbacterium sp. 1294 Isolate Unclassified
13 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
14 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
15 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
16 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
17 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
18 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
19 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
20 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
21 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
22 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
23 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
24 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
25 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
26 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
27 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
28 2919069694 Microbacterium sp. 1154 Isolate Unclassified
29 2919395869 Microbacterium resistens 2980 Isolate Unclassified
30 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
31 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
32 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
33 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
34 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
35 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
36 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
37 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
38 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
39 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
40 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
41 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
42 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
43 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
44 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
47 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
179 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
180 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
188 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
189 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
190 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
191 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
192 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
193 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.16
Metatranscriptomes 1.56
Isolates 18.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.78
Bulb 0
Endosphere 6.23
Nodule 0
Rhizoplane 5.45
Rhizosphere 59.92
Stem 0
Stem Tuber 0
Unclassified 27.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001964 3300002738 Bacteria 6068
2 rootH2_10004724 3300003320 Bacteria 3085
3 Ga0006562J51391_1035836 3300003578 Bacteria 4667
4 Ga0006562J51391_1035837 3300003578 Bacteria 4290
5 Ga0065707_10003866 3300005295 Bacteria 6530
6 Ga0070680_100270202 3300005336 Bacteria 1439
7 Ga0070667_100024993 3300005367 Bacteria 4963
8 Ga0070694_100024118 3300005444 Bacteria 3924
9 Ga0070694_100122909 3300005444 Bacteria 1865
10 Ga0070706_100376046 3300005467 Unclassified 1323
11 Ga0070707_100113818 3300005468 Unclassified 2625
12 Ga0070698_100005143 3300005471 Bacteria 14306
13 Ga0068853_100459678 3300005539 Bacteria 1198
14 Ga0070672_100393708 3300005543 Bacteria 1186
15 Ga0070696_100122350 3300005546 Archaea 1884
16 Ga0070665_100017661 3300005548 Bacteria 7165
17 Ga0068855_100143268 3300005563 Bacteria 2722
18 Ga0070664_100396174 3300005564 Bacteria 1262
19 Ga0068857_100005931 3300005577 Bacteria 10431
20 Ga0068856_100331774 3300005614 Bacteria 1539
21 Ga0068852_100160468 3300005616 Bacteria 2099
22 Ga0068860_100285131 3300005843 Bacteria 1615
23 Ga0075365_10016544 3300006038 Bacteria 4489
24 Ga0075364_10001652 3300006051 Bacteria 12257
25 Ga0075364_10017456 3300006051 Bacteria 4484
26 Ga0075369_10029341 3300006186 Bacteria 2310
27 Ga0075370_10174011 3300006353 Bacteria 1266
28 Ga0075428_100282039 3300006844 Bacteria 1787
29 Ga0075430_100115624 3300006846 Bacteria 2235
30 Ga0075431_100267577 3300006847 Bacteria 1733
31 Ga0075433_10000067 3300006852 Bacteria 45943
32 Ga0075433_10088244 3300006852 Bacteria 2740
33 Ga0105244_10012259 3300009036 Bacteria 5078
34 Ga0105244_10026035 3300009036 Bacteria 3170
35 Ga0105244_10026174 3300009036 Bacteria 3159
36 Ga0105245_10014698 3300009098 Bacteria 6816
37 Ga0105243_10017603 3300009148 Bacteria 5405
38 Ga0105239_10005562 3300010375 Bacteria 14736
39 Ga0157373_10253025 3300013100 Bacteria 1246
40 Ga0157369_10072534 3300013105 Bacteria 3695
41 Ga0171462_1001 3300013250 Bacteria 1135406
42 Ga0157374_10247408 3300013296 Bacteria 1754
43 Ga0157372_10349550 3300013307 Bacteria 1722
44 Ga0157372_10360149 3300013307 Bacteria 1695
45 Ga0157375_10634481 3300013308 Bacteria 1225
46 Ga0157376_10290301 3300014969 Bacteria 1544
47 Ga0209646_1000013 3300025246 Bacteria 565830
48 Ga0209646_1000014 3300025246 Bacteria 550484
49 Ga0207655_1000386 3300025728 Bacteria 61740
50 Ga0207655_1023755 3300025728 Bacteria 3029
51 Ga0207647_10022806 3300025904 Bacteria 4152
52 Ga0207684_10331062 3300025910 Unclassified 1312
53 Ga0207707_10004257 3300025912 Bacteria 12664
54 Ga0207660_10391464 3300025917 Bacteria 1118
55 Ga0207652_10014026 3300025921 Bacteria 6487
56 Ga0207646_10177009 3300025922 Unclassified 1927
57 Ga0207690_10187198 3300025932 Bacteria 1563
58 Ga0207709_10010829 3300025935 Bacteria 5023
59 Ga0207709_10026971 3300025935 Bacteria 3304
60 Ga0207691_10246362 3300025940 Bacteria 1544
61 Ga0207661_10236993 3300025944 Bacteria 1618
62 Ga0207667_10074363 3300025949 Bacteria 3530
63 Ga0207658_10028220 3300025986 Bacteria 3951
64 Ga0207639_10196819 3300026041 Bacteria 1726
65 Ga0207674_10004220 3300026116 Bacteria 17343
66 Ga0209995_1022048 3300027471 Bacteria 1056
67 Ga0209983_1033872 3300027665 Unclassified 1093
68 Ga0209966_1017635 3300027695 Bacteria 1362
69 Ga0268264_10301428 3300028381 Bacteria 1509
70 Ga0265334_10039049 3300028573 Bacteria 1864
71 Ga0265318_10002184 3300028577 Bacteria 10591
72 Ga0265328_10119091 3300031239 Bacteria 984
73 Ga0265320_10018564 3300031240 Bacteria 3825
74 Ga0265329_10118390 3300031242 Bacteria 849
75 Ga0265340_10000407 3300031247 Bacteria 23051
76 Ga0265331_10004195 3300031250 Bacteria 9026
77 Ga0307408_100125409 3300031548 Unclassified 1996
78 Ga0265342_10263293 3300031712 Unclassified 917
79 Ga0316576_10066254 3300031727 Unclassified 2656
80 Ga0316578_10237605 3300031728 Bacteria 1094
81 Ga0307405_10008794 3300031731 Bacteria 5141
82 Ga0307405_10234280 3300031731 Unclassified 1355
83 Ga0307405_10355771 3300031731 Bacteria 1131
84 Ga0307413_10125702 3300031824 Bacteria 1746
85 Ga0307413_10209215 3300031824 Bacteria 1415
86 Ga0307413_10217563 3300031824 Bacteria 1393
87 Ga0307410_10045689 3300031852 Bacteria 2918
88 Ga0307410_10078531 3300031852 Bacteria 2310
89 Ga0307406_10000938 3300031901 Bacteria 16294
90 Ga0307406_10008670 3300031901 Bacteria 5682
91 Ga0307406_10012823 3300031901 Bacteria 4787
92 Ga0307406_10123736 3300031901 Bacteria 1803
93 Ga0307407_10190815 3300031903 Bacteria 1365
94 Ga0307412_10086196 3300031911 Bacteria 2185
95 Ga0307412_10115209 3300031911 Bacteria 1926
96 Ga0307409_100203195 3300031995 Bacteria 1774
97 Ga0307409_100488158 3300031995 Bacteria 1197
98 Ga0307416_100119681 3300032002 Bacteria 2343
99 Ga0307416_100821772 3300032002 Bacteria 1026
100 Ga0307414_10195145 3300032004 Bacteria 1642
101 Ga0307414_10269474 3300032004 Bacteria 1425
102 Ga0307414_10273403 3300032004 Bacteria 1416
103 Ga0307415_100141532 3300032126 Bacteria 1838
104 Ga0307415_100264423 3300032126 Unclassified 1405
105 Ga0316593_10085949 3300032168 Unclassified 1103
106 Ga0316592_1011305 3300033524 Unclassified 1813
107 Ga0316584_0196162 3300036712 Bacteria 1491
108 Ga0395898_0239492 3300037466 Bacteria 1731
109 Ga0451837_0726318 3300041494 Bacteria 1838
110 Ga0451843_1643662 3300041509 Bacteria 868
111 Ga0451577_0026214 3300042876 Bacteria 5279
112 Ga0453683_0013659 3300044673 Bacteria 5291
113 Ga0453683_0355013 3300044673 Bacteria 942
114 Ga0466965_0024047 3300044683 Bacteria 2946
115 Ga0466965_0057640 3300044683 Bacteria 1936
116 Ga0453684_0015585 3300044712 Bacteria 11997
117 Ga0453684_0165870 3300044712 Bacteria 2607
118 Ga0453684_0249116 3300044712 Bacteria 2041
119 Ga0453684_0307216 3300044712 Bacteria 1801
120 Ga0466970_0086936 3300044765 Bacteria 1695
121 Ga0495627_005045 3300046453 Bacteria 5400
122 Ga0495653_0041661 3300046463 Bacteria 3583
123 Ga0495650_0056050 3300046471 Bacteria 1601
124 Ga0495582_0201380 3300046473 Bacteria 1137
125 Ga0495662_0120348 3300046476 Bacteria 1289
126 Ga0495620_0013172 3300046515 Bacteria 4243
127 Ga0495630_0008235 3300046517 Bacteria 7486
128 Ga0495654_0083131 3300046530 Bacteria 1497
129 Ga0495645_0009818 3300046543 Bacteria 6696
130 Ga0495613_0321902 3300046689 Bacteria 1067
131 Ga0495624_0056973 3300046690 Bacteria 2458
132 Ga0495674_0177535 3300047319 Bacteria 1774
133 Ga0495684_0013498 3300047471 Bacteria 6286
134 Ga0495614_0033045 3300048089 Bacteria 2226
135 Ga0496100_0004803 3300048903 Bacteria 7217
136 Ga0496103_0005136 3300048906 Bacteria 7881
137 Ga0496104_0207645 3300048907 Bacteria 1870
138 Ga0496104_0687551 3300048907 Bacteria 931
139 Ga0496105_0062069 3300048908 Bacteria 3084
140 Ga0496105_0250616 3300048908 Bacteria 1434
141 Ga0496107_0001328 3300048910 Bacteria 15168
142 Ga0496108_0032956 3300048911 Bacteria 4304
143 Ga0496108_0170209 3300048911 Bacteria 1885
144 Ga0496109_0192527 3300048912 Bacteria 1916
145 Ga0496110_0015349 3300048913 Bacteria 6373
146 Ga0496112_0325613 3300048915 Bacteria 1481
147 Ga0496113_0016497 3300048916 Bacteria 5103
148 Ga0496114_0066392 3300048917 Bacteria 3024
149 Ga0496117_0000362 3300048920 Bacteria 79224
150 Ga0496117_0006530 3300048920 Bacteria 11750
151 Ga0496117_0027558 3300048920 Bacteria 4424
152 Ga0496117_0152606 3300048920 Bacteria 1365
153 Ga0496118_0002856 3300048921 Bacteria 22535
154 Ga0496118_0091600 3300048921 Bacteria 2090
155 Ga0496119_0009905 3300048922 Bacteria 8094
156 Ga0496119_0010149 3300048922 Bacteria 7953
157 Ga0496119_0039866 3300048922 Bacteria 3014
158 Ga0496119_0050441 3300048922 Bacteria 2565
159 Ga0496119_0152947 3300048922 Bacteria 1234
160 Ga0496120_0012234 3300048923 Bacteria 5849
161 Ga0496120_0016256 3300048923 Bacteria 4868
162 Ga0496122_0003594 3300048925 Bacteria 20199
163 Ga0496122_0039137 3300048925 Bacteria 3785
164 Ga0496122_0061983 3300048925 Bacteria 2740
165 Ga0496122_0094737 3300048925 Bacteria 2020
166 Ga0496122_0112237 3300048925 Bacteria 1785
167 Ga0496122_0231843 3300048925 Bacteria 1049
168 Ga0496123_0004251 3300048926 Bacteria 15248
169 Ga0496124_0005669 3300048927 Bacteria 13923
170 Ga0496124_0067313 3300048927 Bacteria 2981
171 Ga0496124_0116300 3300048927 Bacteria 2144
172 Ga0496124_0454143 3300048927 Bacteria 873
173 Ga0496125_0002082 3300048928 Bacteria 26957
174 Ga0496125_0005769 3300048928 Bacteria 13604
175 Ga0496125_0023781 3300048928 Bacteria 5649
176 Ga0496125_0040922 3300048928 Bacteria 3968
177 Ga0496125_0119024 3300048928 Bacteria 1889
178 Ga0496125_0131559 3300048928 Bacteria 1760
179 Ga0496126_0002077 3300048929 Bacteria 28059
180 Ga0496126_0076254 3300048929 Bacteria 2974
181 Ga0496126_0142803 3300048929 Bacteria 2059
182 Ga0496126_0154633 3300048929 Bacteria 1963
183 Ga0501034_0002490 3300049571 Bacteria 22119
184 Ga0501038_0050411 3300049574 Bacteria 3596
185 Ga0501038_0086146 3300049574 Bacteria 2640
186 Ga0501039_0066907 3300049575 Bacteria 2790
187 Ga0501047_0155152 3300049581 Bacteria 2163
188 Ga0501047_0156066 3300049581 Bacteria 2156
189 Ga0501070_0008253 3300049586 Bacteria 8804
190 Ga0501202_011775 3300049652 Bacteria 1642
191 Ga0501235_006654 3300049669 Bacteria 2516
192 Ga0501243_012207 3300049675 Bacteria 1354
193 Ga0501221_002221 3300049704 Bacteria 3224
194 Ga0501266_011042 3300049763 Bacteria 1154
195 Ga0501268_010090 3300049765 Bacteria 1463
196 Ga0501212_004837 3300049851 Bacteria 1756
197 nmdc:mga00v17_39730_c1 3300050491 Bacteria 2819
198 nmdc:mga00v17_9411_c1 3300050491 Bacteria 5285
199 nmdc:mga0yw44_277_c1 3300050492 Bacteria 17596
200 nmdc:mga06z11_89906_c1 3300050494 Bacteria 1665
201 nmdc:mga07m45_202964_c1 3300050496 Bacteria 1153
202 nmdc:mga0qj67_424382_c1 3300050509 Bacteria 1072
203 nmdc:mga0a205_278664_c1 3300050515 Bacteria 1548
204 nmdc:mga0a205_81_c1 3300050515 Bacteria 53005
205 Ga0500650_0030528 3300053098 Bacteria 2445
206 Ga0500573_0100012 3300053140 Bacteria 1632
207 Ga0500573_0127488 3300053140 Bacteria 1412
208 Ga0500577_0003340 3300053142 Bacteria 4162
209 Ga0500577_0027692 3300053142 Bacteria 1944
210 Ga0500577_0083049 3300053142 Bacteria 1281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10253025 Ga0157373_102530252 207
2 3300047319 Ga0495674_0177535 Ga0495674_0177535_20_736 228
3 3300005295 Ga0065707_10003866 Ga0065707_100038666 236
4 3300005444 Ga0070694_100024118 Ga0070694_1000241186 236
5 3300005444 Ga0070694_100122909 Ga0070694_1001229092 236
6 3300005467 Ga0070706_100376046 Ga0070706_1003760462 236
7 3300005468 Ga0070707_100113818 Ga0070707_1001138182 236
8 3300005471 Ga0070698_100005143 Ga0070698_10000514310 236
9 3300005563 Ga0068855_100143268 Ga0068855_1001432684 236
10 3300005564 Ga0070664_100396174 Ga0070664_1003961742 236
11 3300005577 Ga0068857_100005931 Ga0068857_1000059316 236
12 3300006844 Ga0075428_100282039 Ga0075428_1002820392 236
13 3300006846 Ga0075430_100115624 Ga0075430_1001156242 236
14 3300006847 Ga0075431_100267577 Ga0075431_1002675772 236
15 3300006852 Ga0075433_10000067 Ga0075433_1000006713 236
16 3300006852 Ga0075433_10088244 Ga0075433_100882442 236
17 3300010375 Ga0105239_10005562 Ga0105239_1000556210 236
18 3300013307 Ga0157372_10349550 Ga0157372_103495502 236
19 3300025910 Ga0207684_10331062 Ga0207684_103310622 236
20 3300025922 Ga0207646_10177009 Ga0207646_101770092 236
21 3300025949 Ga0207667_10074363 Ga0207667_100743634 236
22 3300026041 Ga0207639_10196819 Ga0207639_101968192 236
23 3300026116 Ga0207674_10004220 Ga0207674_1000422023 236
24 3300027471 Ga0209995_1022048 Ga0209995_10220482 236
25 3300027665 Ga0209983_1033872 Ga0209983_10338722 236
26 3300027695 Ga0209966_1017635 Ga0209966_10176352 236
27 3300028573 Ga0265334_10039049 Ga0265334_100390492 236
28 3300028577 Ga0265318_10002184 Ga0265318_100021849 236
29 3300031239 Ga0265328_10119091 Ga0265328_101190911 236
30 3300031240 Ga0265320_10018564 Ga0265320_100185643 236
31 3300031242 Ga0265329_10118390 Ga0265329_101183901 236
32 3300031247 Ga0265340_10000407 Ga0265340_100004072 236
33 3300031250 Ga0265331_10004195 Ga0265331_100041952 236
34 3300031548 Ga0307408_100125409 Ga0307408_1001254092 236
35 3300031712 Ga0265342_10263293 Ga0265342_102632932 236
36 3300031727 Ga0316576_10066254 Ga0316576_100662543 236
37 3300031728 Ga0316578_10237605 Ga0316578_102376052 236
38 3300031731 Ga0307405_10008794 Ga0307405_100087944 236
39 3300031731 Ga0307405_10234280 Ga0307405_102342802 236
40 3300031824 Ga0307413_10209215 Ga0307413_102092152 236
41 3300031852 Ga0307410_10045689 Ga0307410_100456893 236
42 3300031852 Ga0307410_10078531 Ga0307410_100785313 236
43 3300031903 Ga0307407_10190815 Ga0307407_101908152 236
44 3300031911 Ga0307412_10115209 Ga0307412_101152091 236
45 3300031995 Ga0307409_100203195 Ga0307409_1002031952 236
46 3300032002 Ga0307416_100119681 Ga0307416_1001196813 236
47 3300032002 Ga0307416_100821772 Ga0307416_1008217722 236
48 3300032004 Ga0307414_10269474 Ga0307414_102694742 236
49 3300032126 Ga0307415_100264423 Ga0307415_1002644232 236
50 3300032168 Ga0316593_10085949 Ga0316593_100859491 236
51 3300033524 Ga0316592_1011305 Ga0316592_10113051 236
52 3300036712 Ga0316584_0196162 Ga0316584_0196162_26_796 236
53 3300042876 Ga0451577_0026214 Ga0451577_0026214_2619_3389 236
54 3300044673 Ga0453683_0355013 Ga0453683_0355013_196_915 236
55 3300044712 Ga0453684_0015585 Ga0453684_0015585_1163_1933 236
56 3300044712 Ga0453684_0165870 Ga0453684_0165870_95_865 236
57 3300044712 Ga0453684_0249116 Ga0453684_0249116_852_1622 236
58 3300044712 Ga0453684_0307216 Ga0453684_0307216_214_1032 236
59 3300049652 Ga0501202_011775 Ga0501202_011775_513_1265 236
60 3300049669 Ga0501235_006654 Ga0501235_006654_681_1433 236
61 3300049675 Ga0501243_012207 Ga0501243_012207_364_1116 236
62 3300049704 Ga0501221_002221 Ga0501221_002221_2116_2868 236
63 3300049763 Ga0501266_011042 Ga0501266_011042_360_1112 236
64 3300049765 Ga0501268_010090 Ga0501268_010090_345_1097 236
65 3300049851 Ga0501212_004837 Ga0501212_004837_377_1129 236
66 3300050509 nmdc:mga0qj67_424382_c1 nmdc:mga0qj67_424382_c1_255_1043 236
67 3300050515 nmdc:mga0a205_278664_c1 nmdc:mga0a205_278664_c1_603_1391 236
68 3300050515 nmdc:mga0a205_81_c1 nmdc:mga0a205_81_c1_7145_7930 236
69 3300005336 Ga0070680_100270202 Ga0070680_1002702022 237
70 3300025912 Ga0207707_10004257 Ga0207707_100042571 237
71 3300025917 Ga0207660_10391464 Ga0207660_103914641 237
72 3300025921 Ga0207652_10014026 Ga0207652_100140266 237
73 3300046530 Ga0495654_0083131 Ga0495654_0083131_64_906 237
74 3300005548 Ga0070665_100017661 Ga0070665_1000176612 238
75 3300048907 Ga0496104_0207645 Ga0496104_0207645_941_1780 239
76 3300048908 Ga0496105_0062069 Ga0496105_0062069_582_1421 239
77 3300048911 Ga0496108_0032956 Ga0496108_0032956_2031_2870 239
78 3300048912 Ga0496109_0192527 Ga0496109_0192527_889_1728 239
79 3300048915 Ga0496112_0325613 Ga0496112_0325613_503_1342 239
80 3300046471 Ga0495650_0056050 Ga0495650_0056050_578_1423 240
81 3300013250 Ga0171462_1001 Ga0171462_1001808 241
82 3300049586 Ga0501070_0008253 Ga0501070_0008253_3552_4394 241
83 3300005367 Ga0070667_100024993 Ga0070667_1000249934 242
84 3300005543 Ga0070672_100393708 Ga0070672_1003937082 242
85 3300005614 Ga0068856_100331774 Ga0068856_1003317742 242
86 3300005616 Ga0068852_100160468 Ga0068852_1001604682 242
87 3300005843 Ga0068860_100285131 Ga0068860_1002851312 242
88 3300009098 Ga0105245_10014698 Ga0105245_100146987 242
89 3300013296 Ga0157374_10247408 Ga0157374_102474082 242
90 3300013307 Ga0157372_10360149 Ga0157372_103601492 242
91 3300013308 Ga0157375_10634481 Ga0157375_106344812 242
92 3300014969 Ga0157376_10290301 Ga0157376_102903012 242
93 3300025932 Ga0207690_10187198 Ga0207690_101871982 242
94 3300025940 Ga0207691_10246362 Ga0207691_102463622 242
95 3300025944 Ga0207661_10236993 Ga0207661_102369933 242
96 3300025986 Ga0207658_10028220 Ga0207658_100282204 242
97 3300028381 Ga0268264_10301428 Ga0268264_103014282 242
98 3300031824 Ga0307413_10217563 Ga0307413_102175632 242
99 3300044683 Ga0466965_0024047 Ga0466965_0024047_727_1569 242
100 3300046463 Ga0495653_0041661 Ga0495653_0041661_2428_3225 242
101 3300046473 Ga0495582_0201380 Ga0495582_0201380_131_928 242
102 3300046476 Ga0495662_0120348 Ga0495662_0120348_459_1256 242
103 3300046515 Ga0495620_0013172 Ga0495620_0013172_602_1447 242
104 3300046517 Ga0495630_0008235 Ga0495630_0008235_5327_6124 242
105 3300046689 Ga0495613_0321902 Ga0495613_0321902_222_1019 242
106 3300046690 Ga0495624_0056973 Ga0495624_0056973_1358_2155 242
107 3300047471 Ga0495684_0013498 Ga0495684_0013498_1519_2316 242
108 3300048089 Ga0495614_0033045 Ga0495614_0033045_1030_1827 242
109 3300049581 Ga0501047_0156066 Ga0501047_0156066_1111_1908 242
110 3300050491 nmdc:mga00v17_9411_c1 nmdc:mga00v17_9411_c1_15_743 242
111 3300050494 nmdc:mga06z11_89906_c1 nmdc:mga06z11_89906_c1_153_998 242
112 3300044673 Ga0453683_0013659 Ga0453683_0013659_1869_2660 243
113 3300049581 Ga0501047_0155152 Ga0501047_0155152_95_871 244
114 3300005546 Ga0070696_100122350 Ga0070696_1001223502 245
115 3300031824 Ga0307413_10125702 Ga0307413_101257022 245
116 3300048920 Ga0496117_0006530 Ga0496117_0006530_10900_11739 245
117 3300048921 Ga0496118_0091600 Ga0496118_0091600_822_1661 245
118 3300048925 Ga0496122_0112237 Ga0496122_0112237_820_1659 245
119 3300048927 Ga0496124_0454143 Ga0496124_0454143_12_752 246
120 3300009036 Ga0105244_10026035 Ga0105244_100260353 247
121 3300009036 Ga0105244_10026174 Ga0105244_100261743 247
122 3300009148 Ga0105243_10017603 Ga0105243_100176034 247
123 3300025728 Ga0207655_1000386 Ga0207655_100038618 247
124 3300025728 Ga0207655_1023755 Ga0207655_10237552 247
125 3300025935 Ga0207709_10010829 Ga0207709_100108293 247
126 3300003578 Ga0006562J51391_1035836 Ga0006562J51391_10358363 249
127 3300003578 Ga0006562J51391_1035837 Ga0006562J51391_10358373 249
128 3300041509 Ga0451843_1643662 Ga0451843_1643662_15_848 249
129 3300048917 Ga0496114_0066392 Ga0496114_0066392_208_1041 249
130 3300048922 Ga0496119_0010149 Ga0496119_0010149_4885_5727 250
131 3300049575 Ga0501039_0066907 Ga0501039_0066907_408_1250 250
132 3300048921 Ga0496118_0002856 Ga0496118_0002856_12948_13796 251
133 3300031731 Ga0307405_10355771 Ga0307405_103557712 252
134 3300032126 Ga0307415_100141532 Ga0307415_1001415322 253
135 3300009036 Ga0105244_10012259 Ga0105244_100122593 254
136 3300025246 Ga0209646_1000013 Ga0209646_1000013283 254
137 3300025246 Ga0209646_1000014 Ga0209646_100001476 254
138 3300048920 Ga0496117_0000362 Ga0496117_0000362_34079_34921 254
139 3300048920 Ga0496117_0152606 Ga0496117_0152606_472_1314 254
140 3300048922 Ga0496119_0009905 Ga0496119_0009905_4673_5515 254
141 3300048922 Ga0496119_0039866 Ga0496119_0039866_1560_2399 254
142 3300048922 Ga0496119_0050441 Ga0496119_0050441_988_1830 254
143 3300048923 Ga0496120_0012234 Ga0496120_0012234_3621_4463 254
144 3300048923 Ga0496120_0016256 Ga0496120_0016256_1399_2241 254
145 3300048925 Ga0496122_0003594 Ga0496122_0003594_11608_12450 254
146 3300048926 Ga0496123_0004251 Ga0496123_0004251_6922_7764 254
147 3300048927 Ga0496124_0005669 Ga0496124_0005669_12731_13573 254
148 3300048928 Ga0496125_0005769 Ga0496125_0005769_6812_7654 254
149 3300048929 Ga0496126_0002077 Ga0496126_0002077_12491_13333 254
150 3300053098 Ga0500650_0030528 Ga0500650_0030528_236_1066 260
151 3300053142 Ga0500577_0003340 Ga0500577_0003340_1482_2312 260
152 3300053142 Ga0500577_0083049 Ga0500577_0083049_215_1045 260
153 iso_pu_bacteria 2870622029 2870622195 260
154 iso_pu_bacteria 2939657138 2939659443 260
155 3300005539 Ga0068853_100459678 Ga0068853_1004596781 261
156 3300006038 Ga0075365_10016544 Ga0075365_100165443 261
157 3300006051 Ga0075364_10001652 Ga0075364_1000165211 261
158 3300006186 Ga0075369_10029341 Ga0075369_100293412 261
159 3300013105 Ga0157369_10072534 Ga0157369_100725344 261
160 3300025904 Ga0207647_10022806 Ga0207647_100228063 261
161 3300031901 Ga0307406_10000938 Ga0307406_100009387 261
162 3300037466 Ga0395898_0239492 Ga0395898_0239492_783_1634 261
163 3300041494 Ga0451837_0726318 Ga0451837_0726318_545_1378 261
164 3300046543 Ga0495645_0009818 Ga0495645_0009818_1122_1955 261
165 3300048903 Ga0496100_0004803 Ga0496100_0004803_991_1830 261
166 3300048906 Ga0496103_0005136 Ga0496103_0005136_5786_6625 261
167 3300048907 Ga0496104_0687551 Ga0496104_0687551_120_905 261
168 3300048908 Ga0496105_0250616 Ga0496105_0250616_501_1340 261
169 3300048910 Ga0496107_0001328 Ga0496107_0001328_812_1651 261
170 3300048911 Ga0496108_0170209 Ga0496108_0170209_329_1168 261
171 3300048913 Ga0496110_0015349 Ga0496110_0015349_4880_5719 261
172 3300048916 Ga0496113_0016497 Ga0496113_0016497_834_1673 261
173 3300048928 Ga0496125_0002082 Ga0496125_0002082_18786_19571 261
174 3300050492 nmdc:mga0yw44_277_c1 nmdc:mga0yw44_277_c1_11992_12822 261
175 3300053140 Ga0500573_0127488 Ga0500573_0127488_316_1155 261
176 iso_pu_bacteria 2585428157 2588107964 261
177 iso_pu_bacteria 2643221575 2643888113 261
178 iso_pu_bacteria 2773857759 2774381997 261
179 iso_pu_bacteria 2808606368 2808884781 261
180 iso_pu_bacteria 2808606447 2809226263 261
181 iso_pu_bacteria 2811994872 2812322100 261
182 iso_pu_bacteria 2852632344 2852632522 261
183 iso_pu_bacteria 2857720070 2857722739 261
184 iso_pu_bacteria 2928090899 2928093841 261
185 iso_pu_bacteria 2977251589 2977252158 261
186 iso_pu_bacteria 2984580707 2984582472 261
187 iso_pu_bacteria 2821268502 2821269012 262
188 3300044683 Ga0466965_0057640 Ga0466965_0057640_120_959 263
189 3300048927 Ga0496124_0116300 Ga0496124_0116300_1030_1821 263
190 iso_pu_bacteria 2773857758 2774378910 263
191 iso_pu_bacteria 2808606306 2808628758 263
192 iso_pu_bacteria 2833709550 2833709902 263
193 iso_pu_bacteria 2904509784 2904510372 263
194 iso_pu_bacteria 2908678064 2908678410 263
195 iso_pu_bacteria 2919069694 2919070734 263
196 iso_pu_bacteria 2974294766 2974294856 263
197 iso_pu_bacteria 2974324384 2974325344 263
198 iso_pu_bacteria 2977228692 2977230306 263
199 iso_pu_bacteria 2977236895 2977239110 263
200 iso_pu_bacteria 2977264416 2977265524 263
201 iso_pu_bacteria 2984542743 2984543105 263
202 3300031995 Ga0307409_100488158 Ga0307409_1004881582 264
203 3300053140 Ga0500573_0100012 Ga0500573_0100012_213_1058 264
204 3300053142 Ga0500577_0027692 Ga0500577_0027692_972_1817 264
205 iso_pu_bacteria 2757320536 2758224786 264
206 iso_pu_bacteria 8016254467 8016255111 264
207 iso_pu_bacteria 8045830549 8045832204 264
208 iso_pu_bacteria 2773857763 2774400756 266
209 iso_pu_bacteria 2919395869 2919397203 266
210 iso_pu_bacteria 8004212874 8004213343 266
211 3300003320 rootH2_10004724 rootH2_100047244 267
212 3300025935 Ga0207709_10026971 Ga0207709_100269712 267
213 3300031901 Ga0307406_10012823 Ga0307406_100128237 267
214 3300031901 Ga0307406_10123736 Ga0307406_101237362 267
215 3300031911 Ga0307412_10086196 Ga0307412_100861963 267
216 3300032004 Ga0307414_10195145 Ga0307414_101951452 267
217 3300032004 Ga0307414_10273403 Ga0307414_102734031 267
218 3300044765 Ga0466970_0086936 Ga0466970_0086936_15_863 267
219 3300048920 Ga0496117_0027558 Ga0496117_0027558_452_1300 267
220 3300048922 Ga0496119_0152947 Ga0496119_0152947_411_1214 267
221 3300048925 Ga0496122_0094737 Ga0496122_0094737_1060_1908 267
222 3300048925 Ga0496122_0231843 Ga0496122_0231843_30_878 267
223 3300048928 Ga0496125_0023781 Ga0496125_0023781_908_1756 267
224 3300048928 Ga0496125_0040922 Ga0496125_0040922_2008_2856 267
225 3300048929 Ga0496126_0076254 Ga0496126_0076254_985_1833 267
226 3300048929 Ga0496126_0154633 Ga0496126_0154633_879_1727 267
227 3300049571 Ga0501034_0002490 Ga0501034_0002490_10921_11769 267
228 3300049574 Ga0501038_0050411 Ga0501038_0050411_1246_2094 267
229 3300049574 Ga0501038_0086146 Ga0501038_0086146_932_1786 267
230 iso_pu_bacteria 2643221546 2643753729 267
231 iso_pu_bacteria 2643221553 2643786368 267
232 iso_pu_bacteria 2643221724 2644681068 267
233 iso_pu_bacteria 2728369380 2730230499 267
234 iso_pu_bacteria 2747842429 2747952137 267
235 iso_pu_bacteria 2852646457 2852647568 267
236 iso_pu_bacteria 2945968032 2945968734 267
237 iso_pu_bacteria 2946033335 2946036591 267
238 iso_pu_bacteria 2946041624 2946045176 267
239 3300002738 JGI25154J39366_1001964 JGI25154J39366_10019645 268
240 3300006051 Ga0075364_10017456 Ga0075364_100174564 268
241 3300006353 Ga0075370_10174011 Ga0075370_101740112 268
242 3300031901 Ga0307406_10008670 Ga0307406_100086705 268
243 3300046453 Ga0495627_005045 Ga0495627_005045_3312_4163 268
244 3300048925 Ga0496122_0039137 Ga0496122_0039137_1191_2042 268
245 3300048925 Ga0496122_0061983 Ga0496122_0061983_23_874 268
246 3300048927 Ga0496124_0067313 Ga0496124_0067313_135_986 268
247 3300048928 Ga0496125_0119024 Ga0496125_0119024_310_1161 268
248 3300048928 Ga0496125_0131559 Ga0496125_0131559_858_1709 268
249 3300048929 Ga0496126_0142803 Ga0496126_0142803_311_1162 268
250 3300050491 nmdc:mga00v17_39730_c1 nmdc:mga00v17_39730_c1_66_917 268
251 3300050496 nmdc:mga07m45_202964_c1 nmdc:mga07m45_202964_c1_223_1074 268
252 iso_pu_bacteria 2643221542 2643732566 268
253 iso_pu_bacteria 2643221630 2644171366 268
254 iso_pu_bacteria 2852663356 2852664098 268
255 iso_pu_bacteria 2857723135 2857725818 268
256 iso_pu_bacteria 2946080515 2946084056 268
257 iso_pu_bacteria 8004182704 8004184537 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

29

266

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yxf-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105l mutant) in complex with methionine 0.9618 2 248
5yoi-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105t mutant) in complex with methionine 0.9617 2 248
5yoh-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine 0.9617 2 248
5ypj-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105n mutant). 0.9615 2 248
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9588 1 247
ID Description Score Start End Superfamily
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9642 2 248 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.961 2 248 3.90.230.10
4iecA01 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.96 1 247 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9588 1 247 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9585 1 248 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A8B0KP50-F1-model_v4 deleted 1.001 1 267
AF-A0A7X6IQT0-F1-model_v4 deleted 1 1 133
AF-A0A8B0KP50-F1-model_v4 deleted 0.9975 1 267
AF-A0A4Q2JSS7-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9963 1 267 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A3L7J4G3-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9955 2 267 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
97.57 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map