F366537

General Info

Members Datasets Scaffolds Average Seq Length
256 167 241 258

Family's Representative Sequence

Representative Sequence 3300025250|Ga0209026_1005398|Ga0209026_10053984
Length 283
Sequence MQLPKPTPAITQWLPRPLQGGELYYNMPIYIDQLRREINLPATPKRIISVVPSQTELLFDLGLDEEIIGITKFCIHPTAQFKIKPKIGGTKQLNIQKIKELVPDLIIANKEENERSQIEELMNVCPVWISDIKNLDEALDMIVRVGEITGKAEKAQAIAQQIQINFNAFRPAPTDKKVAYFIWKNPYMVAGADTFINDMLKRCGLTNIFAQNRYPEISEQPLIDADPDLVLLSSEPYPFKQQHIDEFQAMLPNAKVQLVDGEMFSWYGSRLLYATDYFETLLR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541302 Pedobacter sp. CF074 Isolate Unclassified
4 2739367651 Pedobacter sp. OK291 Isolate Unclassified
5 2739367656 Pedobacter sp. CF523 Isolate Unclassified
6 2739367663 Pedobacter sp. YR510 Isolate Unclassified
7 2818991437 Pedobacter terrae 518 Isolate Unclassified
8 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
9 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
10 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
11 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
12 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
13 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
14 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
15 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
16 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0.39
Isolates 5.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.11
Nodule 0
Rhizoplane 0
Rhizosphere 81.64
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_785041 2162886007 Bacteria 34032
2 JGI24740J21852_10021919 3300001979 Bacteria 2207
3 JGI24737J22298_10014806 3300001990 Bacteria 2529
4 JGI24744J21845_10006339 3300002077 Bacteria 2456
5 JGI25162J39368_1000749 3300002737 Bacteria 22177
6 JGI25164J39214_1000901 3300002772 Bacteria 9933
7 JGI25152J39213_1000062 3300002773 Bacteria 72854
8 JGI25152J39213_1001383 3300002773 Bacteria 10533
9 JGI25150J39212_1000001 3300002774 Bacteria 1318726
10 JGI25151J46595_10000001 3300003187 Bacteria 887211
11 JGI25165J46597_1000519 3300003214 Bacteria 36430
12 JGI25153J46596_10000001 3300003215 Bacteria 748985
13 rootH1_10070312 3300003316 Bacteria 13485
14 rootL2_10022103 3300003322 Bacteria 7005
15 rootH1_10126989 3300003323 Bacteria 1327
16 rootH1_10168334 3300003323 Bacteria 2275
17 JGI25160J50197_1002187 3300003354 Bacteria 9203
18 Ga0055536_1000001 3300003781 Bacteria 630663
19 Ga0055530_10002498 3300003791 Bacteria 11773
20 Ga0058863_11945642 3300004799 Bacteria 8118
21 Ga0065714_10064548 3300005288 Bacteria 37532
22 Ga0065704_10000310 3300005289 Bacteria 35517
23 Ga0070658_10013480 3300005327 Bacteria 6560
24 Ga0070658_10072462 3300005327 Bacteria 2823
25 Ga0070658_10209975 3300005327 Bacteria 1645
26 Ga0070676_10000121 3300005328 Bacteria 28951
27 Ga0070683_100025363 3300005329 Bacteria 5323
28 Ga0070680_100003652 3300005336 Bacteria 11496
29 Ga0070680_100007052 3300005336 Bacteria 8566
30 Ga0068868_100464708 3300005338 Bacteria 1103
31 Ga0070660_100049977 3300005339 Bacteria 3216
32 Ga0070660_100102769 3300005339 Bacteria 2266
33 Ga0070660_100200628 3300005339 Bacteria 1618
34 Ga0070673_100002402 3300005364 Bacteria 11395
35 Ga0070659_100046945 3300005366 Bacteria 3386
36 Ga0070663_100008574 3300005455 Bacteria 6296
37 Ga0070678_100002279 3300005456 Bacteria 10444
38 Ga0070662_100000559 3300005457 Bacteria 22595
39 Ga0068867_100003937 3300005459 Bacteria 10457
40 Ga0070679_100065850 3300005530 Bacteria 3611
41 Ga0070679_100078035 3300005530 Unclassified 3301
42 Ga0068853_100013381 3300005539 Bacteria 6697
43 Ga0070672_100066521 3300005543 Bacteria 2854
44 Ga0070665_100000003 3300005548 Bacteria 811857
45 Ga0068855_100009372 3300005563 Bacteria 11823
46 Ga0068855_100166353 3300005563 Bacteria 2500
47 Ga0068855_100241826 3300005563 Bacteria 2016
48 Ga0068857_100327350 3300005577 Bacteria 1416
49 Ga0068856_100000092 3300005614 Bacteria 84781
50 Ga0068852_100000264 3300005616 Bacteria 35179
51 Ga0068866_10157931 3300005718 Bacteria 1320
52 Ga0068870_10097089 3300005840 Bacteria 1658
53 Ga0068870_10168400 3300005840 Bacteria 1305
54 Ga0097621_100000152 3300006237 Bacteria 42727
55 Ga0068871_100000020 3300006358 Bacteria 84930
56 Ga0075428_100027487 3300006844 Bacteria 6294
57 Ga0075429_100194171 3300006880 Bacteria 1778
58 Ga0068865_100000138 3300006881 Bacteria 38207
59 Ga0105244_10063883 3300009036 Bacteria 1848
60 Ga0105240_10010038 3300009093 Bacteria 13334
61 Ga0105240_10024315 3300009093 Bacteria 7990
62 Ga0105240_10085539 3300009093 Bacteria 3863
63 Ga0105240_10484503 3300009093 Bacteria 1378
64 Ga0105240_10712565 3300009093 Bacteria 1094
65 Ga0111539_10001098 3300009094 Bacteria 35755
66 Ga0105243_10263407 3300009148 Bacteria 1544
67 Ga0105241_10000630 3300009174 Bacteria 26536
68 Ga0105241_10001146 3300009174 Bacteria 20196
69 Ga0105241_10167570 3300009174 Bacteria 1811
70 Ga0105242_10014056 3300009176 Bacteria 6193
71 Ga0105242_10015983 3300009176 Bacteria 5832
72 Ga0105237_10000803 3300009545 Bacteria 42892
73 Ga0105237_10005064 3300009545 Bacteria 14970
74 Ga0105237_10130437 3300009545 Bacteria 2508
75 Ga0105238_10029875 3300009551 Bacteria 5549
76 Ga0105238_10294575 3300009551 Bacteria 1605
77 Ga0105239_10000002 3300010375 Bacteria 610298
78 Ga0105239_10004316 3300010375 Bacteria 17046
79 Ga0105239_10008401 3300010375 Bacteria 11758
80 Ga0105239_10012536 3300010375 Bacteria 9441
81 Ga0105239_10033240 3300010375 Bacteria 5664
82 Ga0105239_10182341 3300010375 Bacteria 2349
83 Ga0105239_10189151 3300010375 Bacteria 2304
84 Ga0105246_10567498 3300011119 Bacteria 975
85 Ga0157373_10001634 3300013100 Bacteria 17114
86 Ga0157373_10014445 3300013100 Bacteria 5788
87 Ga0157373_10090080 3300013100 Bacteria 2160
88 Ga0157371_10000021 3300013102 Bacteria 301017
89 Ga0157371_10001425 3300013102 Bacteria 24842
90 Ga0157371_10002315 3300013102 Bacteria 18316
91 Ga0157371_10007654 3300013102 Bacteria 8706
92 Ga0157371_10037521 3300013102 Bacteria 3467
93 Ga0157371_10283927 3300013102 Bacteria 1196
94 Ga0157370_10000173 3300013104 Bacteria 80263
95 Ga0157370_10002390 3300013104 Bacteria 22640
96 Ga0157370_10002892 3300013104 Bacteria 20477
97 Ga0157370_10008464 3300013104 Bacteria 11096
98 Ga0157370_10020452 3300013104 Bacteria 6612
99 Ga0157370_10173826 3300013104 Bacteria 2002
100 Ga0157370_10216760 3300013104 Bacteria 1774
101 Ga0157369_10000008 3300013105 Bacteria 309315
102 Ga0157369_10003057 3300013105 Bacteria 19979
103 Ga0157374_10000349 3300013296 Bacteria 42687
104 Ga0157374_10013797 3300013296 Bacteria 7058
105 Ga0163162_10000206 3300013306 Bacteria 54701
106 Ga0163162_10003180 3300013306 Bacteria 15704
107 Ga0163162_10202524 3300013306 Bacteria 2114
108 Ga0157372_10000021 3300013307 Bacteria 207801
109 Ga0157372_10022752 3300013307 Bacteria 6785
110 Ga0157372_10233100 3300013307 Bacteria 2135
111 Ga0157375_10004387 3300013308 Bacteria 12251
112 Ga0157380_10265310 3300014326 Bacteria 1562
113 Ga0182008_10001392 3300014497 Bacteria 16330
114 Ga0157377_10015289 3300014745 Bacteria 3922
115 Ga0157376_10021299 3300014969 Bacteria 5034
116 Ga0182006_1000412 3300015261 Bacteria 34522
117 Ga0182006_1000558 3300015261 Bacteria 27941
118 Ga0182006_1003901 3300015261 Bacteria 7472
119 Ga0182007_10000003 3300015262 Bacteria 548244
120 Ga0183373_1001 3300015682 Bacteria 1410374
121 Ga0163161_10000453 3300017792 Bacteria 34026
122 Ga0163161_10001588 3300017792 Bacteria 16763
123 Ga0163161_10006484 3300017792 Bacteria 8103
124 Ga0163161_10114349 3300017792 Bacteria 2021
125 Ga0213872_10020246 3300021361 Bacteria 3065
126 Ga0209563_108797 3300025230 Bacteria 1570
127 Ga0207427_100103 3300025231 Bacteria 119618
128 Ga0209437_100085 3300025233 Bacteria 254790
129 Ga0209437_100101 3300025233 Bacteria 226668
130 Ga0207425_1000002 3300025245 Bacteria 1362590
131 Ga0209026_1005398 3300025250 Bacteria 3453
132 Ga0209129_1000002 3300025258 Bacteria 1359086
133 Ga0209129_1011946 3300025258 Bacteria 2035
134 Ga0209233_1000124 3300025261 Bacteria 226743
135 Ga0209676_1000008 3300025292 Bacteria 991778
136 Ga0209025_1000004 3300025294 Bacteria 1361782
137 Ga0209758_1000006 3300025297 Bacteria 1359562
138 Ga0209050_1000045 3300025298 Bacteria 388022
139 Ga0207426_1000009 3300025302 Bacteria 797229
140 Ga0207642_10113905 3300025899 Bacteria 1382
141 Ga0207645_10000131 3300025907 Bacteria 56813
142 Ga0207643_10108189 3300025908 Bacteria 1635
143 Ga0207705_10049317 3300025909 Bacteria 3030
144 Ga0207705_10097257 3300025909 Bacteria 2162
145 Ga0207705_10157586 3300025909 Bacteria 1704
146 Ga0207654_10003102 3300025911 Bacteria 8409
147 Ga0207654_10022780 3300025911 Bacteria 3346
148 Ga0207654_10074280 3300025911 Bacteria 2029
149 Ga0207654_10196814 3300025911 Bacteria 1324
150 Ga0207695_10000189 3300025913 Bacteria 177142
151 Ga0207695_10003136 3300025913 Bacteria 23615
152 Ga0207695_10008178 3300025913 Bacteria 13141
153 Ga0207695_10551178 3300025913 Bacteria 1034
154 Ga0207671_10021517 3300025914 Bacteria 4890
155 Ga0207671_10041286 3300025914 Bacteria 3414
156 Ga0207660_10048233 3300025917 Bacteria 3013
157 Ga0207660_10098107 3300025917 Bacteria 2185
158 Ga0207657_10037147 3300025919 Bacteria 4354
159 Ga0207657_10105136 3300025919 Bacteria 2337
160 Ga0207657_10164321 3300025919 Bacteria 1801
161 Ga0207652_10000271 3300025921 Bacteria 53923
162 Ga0207652_10008194 3300025921 Bacteria 8392
163 Ga0207694_10116389 3300025924 Bacteria 2130
164 Ga0207644_10011827 3300025931 Bacteria 5780
165 Ga0207690_10038811 3300025932 Bacteria 3102
166 Ga0207690_10254540 3300025932 Bacteria 1358
167 Ga0207706_10000126 3300025933 Bacteria 82630
168 Ga0207686_10014443 3300025934 Bacteria 4397
169 Ga0207686_10020520 3300025934 Bacteria 3776
170 Ga0207704_10000109 3300025938 Bacteria 45314
171 Ga0207691_10081153 3300025940 Bacteria 2916
172 Ga0207667_10002067 3300025949 Bacteria 25161
173 Ga0207667_10211799 3300025949 Bacteria 1986
174 Ga0207651_10034378 3300025960 Bacteria 3282
175 Ga0207677_10140020 3300026023 Bacteria 1851
176 Ga0207639_10006033 3300026041 Bacteria 8218
177 Ga0207639_10007595 3300026041 Bacteria 7396
178 Ga0207702_10000451 3300026078 Bacteria 46484
179 Ga0207702_10016247 3300026078 Bacteria 6159
180 Ga0207648_10000155 3300026089 Bacteria 69524
181 Ga0207683_10000968 3300026121 Bacteria 26291
182 Ga0207698_10036779 3300026142 Bacteria 3598
183 Ga0207428_10250108 3300027907 Bacteria 1322
184 Ga0268266_10000052 3300028379 Bacteria 296230
185 Ga0307515_10001310 3300028794 Bacteria 56561
186 Ga0307515_10002920 3300028794 Bacteria 36261
187 Ga0307515_10031935 3300028794 Bacteria 8747
188 Ga0316181_1001436 3300030744 Bacteria 1642
189 Ga0307408_100603419 3300031548 Bacteria 976
190 Ga0307405_10000069 3300031731 Bacteria 47710
191 Ga0307407_10000022 3300031903 Bacteria 120355
192 Ga0307412_10000023 3300031911 Bacteria 237005
193 Ga0307416_100000047 3300032002 Bacteria 120385
194 Ga0307414_10009213 3300032004 Bacteria 5658
195 Ga0307414_10027099 3300032004 Bacteria 3698
196 Ga0307414_10064183 3300032004 Bacteria 2613
197 Ga0307414_10069935 3300032004 Bacteria 2525
198 Ga0307411_10025080 3300032005 Bacteria 3566
199 Ga0307411_10104459 3300032005 Bacteria 2012
200 Ga0395899_0002205 3300037312 Bacteria 15966
201 Ga0395899_0050335 3300037312 Bacteria 3093
202 Ga0395899_0104247 3300037312 Bacteria 2044
203 Ga0395900_0010575 3300037418 Bacteria 9436
204 Ga0395898_0075365 3300037466 Bacteria 3259
205 Ga0395898_0673642 3300037466 Unclassified 976
206 Ga0395905_0000769 3300037471 Bacteria 42306
207 Ga0395905_0005066 3300037471 Bacteria 13559
208 Ga0395905_0315306 3300037471 Bacteria 1453
209 Ga0395901_0002005 3300038443 Bacteria 20948
210 Ga0395901_0501042 3300038443 Bacteria 1236
211 Ga0436361_0335649 3300039447 Bacteria 9308
212 Ga0466966_0024657 3300044684 Bacteria 3933
213 Ga0451576_0027753 3300045051 Bacteria 6078
214 Ga0466958_0084210 3300045836 Bacteria 1961
215 Ga0495606_0000002 3300046507 Bacteria 554637
216 Ga0495606_0146962 3300046507 Bacteria 1387
217 Ga0495610_0000066 3300046512 Bacteria 124205
218 Ga0495610_0000463 3300046512 Bacteria 41930
219 Ga0495637_0050219 3300046520 Bacteria 1750
220 Ga0495663_0048393 3300046525 Bacteria 1311
221 Ga0495633_0001770 3300046558 Bacteria 16011
222 Ga0495625_0016686 3300046660 Bacteria 5769
223 Ga0495636_0000047 3300047318 Bacteria 52861
224 Ga0495687_000815 3300047443 Bacteria 33443
225 Ga0495687_001680 3300047443 Bacteria 19763
226 Ga0495686_0001314 3300047472 Bacteria 27885
227 Ga0501033_0045421 3300049570 Bacteria 3269
228 Ga0501034_0059472 3300049571 Bacteria 3838
229 Ga0501034_0074425 3300049571 Bacteria 3404
230 Ga0501241_000198 3300049758 Bacteria 13561
231 Ga0501044_0028857 3300049823 Bacteria 5852
232 Ga0501044_0513513 3300049823 Bacteria 1098
233 nmdc:mga0k408_55_c2 3300050493 Bacteria 31438
234 nmdc:mga09592_145381_c1 3300050508 Bacteria 2044
235 nmdc:mga08y16_28437_c1 3300050511 Bacteria 5894
236 Ga0500608_011302 3300053122 Bacteria 3871
237 Ga0500618_000001 3300053125 Bacteria 538477
238 Ga0500618_005836 3300053125 Bacteria 3692
239 Ga0500564_090824 3300053138 Bacteria 1359
240 Ga0500616_0133939 3300053153 Bacteria 1167
241 Ga0500624_000835 3300053157 Bacteria 6985

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100078035 Ga0070679_1000780353 210
2 3300025921 Ga0207652_10000271 Ga0207652_1000027136 210
3 3300005336 Ga0070680_100007052 Ga0070680_1000070527 216
4 3300005548 Ga0070665_100000003 Ga0070665_100000003544 232
5 3300009093 Ga0105240_10024315 Ga0105240_100243152 232
6 3300025913 Ga0207695_10003136 Ga0207695_100031362 232
7 3300028379 Ga0268266_10000052 Ga0268266_10000052136 232
8 3300013296 Ga0157374_10013797 Ga0157374_100137973 233
9 3300037312 Ga0395899_0050335 Ga0395899_0050335_1574_2362 234
10 3300037418 Ga0395900_0010575 Ga0395900_0010575_1135_1923 234
11 3300037466 Ga0395898_0075365 Ga0395898_0075365_67_855 234
12 3300037471 Ga0395905_0000769 Ga0395905_0000769_32763_33551 234
13 3300038443 Ga0395901_0002005 Ga0395901_0002005_9380_10168 234
14 3300013102 Ga0157371_10002315 Ga0157371_1000231521 236
15 3300013307 Ga0157372_10000021 Ga0157372_10000021152 236
16 3300044684 Ga0466966_0024657 Ga0466966_0024657_490_1287 236
17 3300001979 JGI24740J21852_10021919 JGI24740J21852_100219192 238
18 3300037312 Ga0395899_0002205 Ga0395899_0002205_8746_9543 238
19 3300045051 Ga0451576_0027753 Ga0451576_0027753_3988_4710 238
20 3300013104 Ga0157370_10020452 Ga0157370_1002045210 239
21 3300013105 Ga0157369_10003057 Ga0157369_100030575 239
22 3300045836 Ga0466958_0084210 Ga0466958_0084210_602_1399 239
23 3300001990 JGI24737J22298_10014806 JGI24737J22298_100148061 241
24 3300005339 Ga0070660_100102769 Ga0070660_1001027692 241
25 3300005366 Ga0070659_100046945 Ga0070659_1000469455 241
26 3300005457 Ga0070662_100000559 Ga0070662_10000055913 241
27 3300009093 Ga0105240_10712565 Ga0105240_107125652 241
28 3300009174 Ga0105241_10001146 Ga0105241_100011466 241
29 3300010375 Ga0105239_10189151 Ga0105239_101891513 241
30 3300011119 Ga0105246_10567498 Ga0105246_105674982 241
31 3300013100 Ga0157373_10014445 Ga0157373_100144457 241
32 3300013102 Ga0157371_10283927 Ga0157371_102839272 241
33 3300014745 Ga0157377_10015289 Ga0157377_100152895 241
34 3300025911 Ga0207654_10003102 Ga0207654_100031024 241
35 3300025919 Ga0207657_10105136 Ga0207657_101051364 241
36 3300025932 Ga0207690_10254540 Ga0207690_102545402 241
37 3300025933 Ga0207706_10000126 Ga0207706_1000012676 241
38 3300003323 rootH1_10126989 rootH1_101269892 244
39 3300005563 Ga0068855_100009372 Ga0068855_10000937214 245
40 3300005840 Ga0068870_10097089 Ga0068870_100970892 245
41 3300009093 Ga0105240_10010038 Ga0105240_1001003813 245
42 3300025908 Ga0207643_10108189 Ga0207643_101081891 245
43 3300025913 Ga0207695_10008178 Ga0207695_1000817813 245
44 3300037466 Ga0395898_0673642 Ga0395898_0673642_61_846 245
45 3300038443 Ga0395901_0501042 Ga0395901_0501042_93_878 245
46 3300005327 Ga0070658_10072462 Ga0070658_100724621 246
47 3300005329 Ga0070683_100025363 Ga0070683_1000253633 246
48 3300005339 Ga0070660_100200628 Ga0070660_1002006281 246
49 3300005455 Ga0070663_100008574 Ga0070663_1000085742 246
50 3300013104 Ga0157370_10173826 Ga0157370_101738261 246
51 3300025919 Ga0207657_10164321 Ga0207657_101643212 246
52 3300025949 Ga0207667_10002067 Ga0207667_1000206720 246
53 3300026078 Ga0207702_10016247 Ga0207702_100162475 246
54 3300037312 Ga0395899_0104247 Ga0395899_0104247_1062_1850 246
55 3300025909 Ga0207705_10049317 Ga0207705_100493172 247
56 3300005459 Ga0068867_100003937 Ga0068867_1000039375 249
57 3300005840 Ga0068870_10168400 Ga0068870_101684001 249
58 3300006237 Ga0097621_100000152 Ga0097621_10000015245 249
59 3300006358 Ga0068871_100000020 Ga0068871_10000002080 249
60 3300009551 Ga0105238_10029875 Ga0105238_100298757 249
61 3300014326 Ga0157380_10265310 Ga0157380_102653102 249
62 3300025924 Ga0207694_10116389 Ga0207694_101163893 249
63 3300026089 Ga0207648_10000155 Ga0207648_1000015549 249
64 3300009176 Ga0105242_10014056 Ga0105242_100140565 250
65 3300025934 Ga0207686_10014443 Ga0207686_100144434 250
66 3300010375 Ga0105239_10182341 Ga0105239_101823412 252
67 3300009545 Ga0105237_10005064 Ga0105237_100050645 253
68 3300053122 Ga0500608_011302 Ga0500608_011302_1578_2342 253
69 iso_pu_bacteria 2910245624 2910248612 254
70 3300002077 JGI24744J21845_10006339 JGI24744J21845_100063393 255
71 3300005328 Ga0070676_10000121 Ga0070676_1000012123 255
72 3300005338 Ga0068868_100464708 Ga0068868_1004647082 255
73 3300005364 Ga0070673_100002402 Ga0070673_10000240210 255
74 3300005456 Ga0070678_100002279 Ga0070678_10000227912 255
75 3300005539 Ga0068853_100013381 Ga0068853_1000133812 255
76 3300005543 Ga0070672_100066521 Ga0070672_1000665213 255
77 3300005616 Ga0068852_100000264 Ga0068852_10000026420 255
78 3300005718 Ga0068866_10157931 Ga0068866_101579312 255
79 3300006881 Ga0068865_100000138 Ga0068865_10000013840 255
80 3300009174 Ga0105241_10000630 Ga0105241_100006302 255
81 3300009176 Ga0105242_10015983 Ga0105242_100159837 255
82 3300009545 Ga0105237_10000803 Ga0105237_1000080327 255
83 3300010375 Ga0105239_10008401 Ga0105239_100084016 255
84 3300013296 Ga0157374_10000349 Ga0157374_100003493 255
85 3300025899 Ga0207642_10113905 Ga0207642_101139052 255
86 3300025907 Ga0207645_10000131 Ga0207645_1000013136 255
87 3300025911 Ga0207654_10022780 Ga0207654_100227802 255
88 3300025914 Ga0207671_10041286 Ga0207671_100412863 255
89 3300025934 Ga0207686_10020520 Ga0207686_100205205 255
90 3300025938 Ga0207704_10000109 Ga0207704_1000010934 255
91 3300025940 Ga0207691_10081153 Ga0207691_100811533 255
92 3300025960 Ga0207651_10034378 Ga0207651_100343783 255
93 3300026023 Ga0207677_10140020 Ga0207677_101400202 255
94 3300026041 Ga0207639_10007595 Ga0207639_100075959 255
95 3300026121 Ga0207683_10000968 Ga0207683_1000096829 255
96 3300026142 Ga0207698_10036779 Ga0207698_100367793 255
97 3300032004 Ga0307414_10064183 Ga0307414_100641832 255
98 3300005327 Ga0070658_10209975 Ga0070658_102099752 256
99 3300005336 Ga0070680_100003652 Ga0070680_1000036529 256
100 3300005339 Ga0070660_100049977 Ga0070660_1000499773 256
101 3300005577 Ga0068857_100327350 Ga0068857_1003273502 256
102 3300025917 Ga0207660_10048233 Ga0207660_100482333 256
103 3300025919 Ga0207657_10037147 Ga0207657_100371475 256
104 3300025932 Ga0207690_10038811 Ga0207690_100388114 256
105 iso_pu_bacteria 2932082852 2932083451 256
106 3300013102 Ga0157371_10037521 Ga0157371_100375214 257
107 3300013307 Ga0157372_10022752 Ga0157372_100227526 257
108 3300025250 Ga0209026_1005398 Ga0209026_10053984 257
109 3300037471 Ga0395905_0005066 Ga0395905_0005066_2160_2936 257
110 3300005327 Ga0070658_10013480 Ga0070658_100134803 258
111 3300013102 Ga0157371_10007654 Ga0157371_100076549 258
112 3300013104 Ga0157370_10000173 Ga0157370_1000017314 258
113 3300013307 Ga0157372_10233100 Ga0157372_102331002 258
114 3300025909 Ga0207705_10157586 Ga0207705_101575863 258
115 3300037471 Ga0395905_0315306 Ga0395905_0315306_121_903 258
116 3300006844 Ga0075428_100027487 Ga0075428_1000274875 259
117 3300006880 Ga0075429_100194171 Ga0075429_1001941712 259
118 3300009094 Ga0111539_10001098 Ga0111539_1000109822 259
119 3300013306 Ga0163162_10003180 Ga0163162_1000318012 259
120 3300027907 Ga0207428_10250108 Ga0207428_102501081 259
121 3300046507 Ga0495606_0000002 Ga0495606_0000002_309457_310236 259
122 3300050508 nmdc:mga09592_145381_c1 nmdc:mga09592_145381_c1_605_1390 259
123 3300050511 nmdc:mga08y16_28437_c1 nmdc:mga08y16_28437_c1_2546_3331 259
124 3300053125 Ga0500618_000001 Ga0500618_000001_100654_101433 259
125 3300053125 Ga0500618_005836 Ga0500618_005836_2789_3568 259
126 3300002737 JGI25162J39368_1000749 JGI25162J39368_100074914 260
127 3300002772 JGI25164J39214_1000901 JGI25164J39214_10009013 260
128 3300003214 JGI25165J46597_1000519 JGI25165J46597_100051916 260
129 3300003316 rootH1_10070312 rootH1_1007031211 260
130 3300004799 Ga0058863_11945642 Ga0058863_119456424 260
131 3300005530 Ga0070679_100065850 Ga0070679_1000658504 260
132 3300005563 Ga0068855_100166353 Ga0068855_1001663532 260
133 3300005614 Ga0068856_100000092 Ga0068856_10000009237 260
134 3300009093 Ga0105240_10085539 Ga0105240_100855392 260
135 3300009093 Ga0105240_10484503 Ga0105240_104845032 260
136 3300009148 Ga0105243_10263407 Ga0105243_102634072 260
137 3300009174 Ga0105241_10167570 Ga0105241_101675703 260
138 3300009545 Ga0105237_10130437 Ga0105237_101304373 260
139 3300009551 Ga0105238_10294575 Ga0105238_102945752 260
140 3300010375 Ga0105239_10000002 Ga0105239_10000002497 260
141 3300010375 Ga0105239_10004316 Ga0105239_1000431617 260
142 3300010375 Ga0105239_10012536 Ga0105239_100125368 260
143 3300010375 Ga0105239_10033240 Ga0105239_100332402 260
144 3300013306 Ga0163162_10202524 Ga0163162_102025242 260
145 3300013308 Ga0157375_10004387 Ga0157375_100043878 260
146 3300014969 Ga0157376_10021299 Ga0157376_100212995 260
147 3300017792 Ga0163161_10006484 Ga0163161_100064845 260
148 3300021361 Ga0213872_10020246 Ga0213872_100202461 260
149 3300025230 Ga0209563_108797 Ga0209563_1087973 260
150 3300025231 Ga0207427_100103 Ga0207427_10010366 260
151 3300025233 Ga0209437_100085 Ga0209437_100085109 260
152 3300025233 Ga0209437_100101 Ga0209437_10010187 260
153 3300025258 Ga0209129_1011946 Ga0209129_10119462 260
154 3300025261 Ga0209233_1000124 Ga0209233_1000124149 260
155 3300025909 Ga0207705_10097257 Ga0207705_100972573 260
156 3300025911 Ga0207654_10074280 Ga0207654_100742802 260
157 3300025911 Ga0207654_10196814 Ga0207654_101968141 260
158 3300025913 Ga0207695_10000189 Ga0207695_1000018992 260
159 3300025913 Ga0207695_10551178 Ga0207695_105511781 260
160 3300025914 Ga0207671_10021517 Ga0207671_100215174 260
161 3300025917 Ga0207660_10098107 Ga0207660_100981072 260
162 3300025921 Ga0207652_10008194 Ga0207652_100081943 260
163 3300025931 Ga0207644_10011827 Ga0207644_100118271 260
164 3300025949 Ga0207667_10211799 Ga0207667_102117992 260
165 3300026041 Ga0207639_10006033 Ga0207639_100060336 260
166 3300026078 Ga0207702_10000451 Ga0207702_100004513 260
167 3300028794 Ga0307515_10001310 Ga0307515_1000131036 260
168 3300028794 Ga0307515_10002920 Ga0307515_1000292023 260
169 3300039447 Ga0436361_0335649 Ga0436361_0335649_2559_3344 260
170 3300046507 Ga0495606_0146962 Ga0495606_0146962_588_1376 260
171 3300046558 Ga0495633_0001770 Ga0495633_0001770_9365_10159 260
172 3300046660 Ga0495625_0016686 Ga0495625_0016686_2557_3342 260
173 3300047318 Ga0495636_0000047 Ga0495636_0000047_42692_43483 260
174 3300047443 Ga0495687_000815 Ga0495687_000815_21732_22529 260
175 3300047443 Ga0495687_001680 Ga0495687_001680_10550_11335 260
176 3300047472 Ga0495686_0001314 Ga0495686_0001314_2328_3116 260
177 3300050493 nmdc:mga0k408_55_c2 nmdc:mga0k408_55_c2_27257_28051 260
178 3300053138 Ga0500564_090824 Ga0500564_090824_303_1091 260
179 3300053153 Ga0500616_0133939 Ga0500616_0133939_134_934 260
180 3300053157 Ga0500624_000835 Ga0500624_000835_3614_4396 260
181 3300003354 JGI25160J50197_1002187 JGI25160J50197_10021875 261
182 3300025302 Ga0207426_1000009 Ga0207426_1000009396 261
183 iso_pu_bacteria 2585427687 2586210962 261
184 iso_pu_bacteria 2738541302 2738855661 261
185 iso_pu_bacteria 2739367651 2739590543 261
186 iso_pu_bacteria 2739367656 2739617221 261
187 iso_pu_bacteria 2739367663 2739647480 261
188 iso_pu_bacteria 2818991437 2819549264 261
189 iso_pu_bacteria 2842722452 2842724853 261
190 iso_pu_bacteria 2842909656 2842913127 261
191 iso_pu_bacteria 2849281842 2849284660 261
192 iso_pu_bacteria 2857627736 2857630190 261
193 iso_pu_bacteria 2904445276 2904449337 261
194 iso_pu_bacteria 2945997725 2946001839 261
195 iso_pu_bacteria 2954016120 2954018675 261
196 3300049570 Ga0501033_0045421 Ga0501033_0045421_1978_2775 262
197 3300049571 Ga0501034_0059472 Ga0501034_0059472_414_1211 262
198 3300049571 Ga0501034_0074425 Ga0501034_0074425_32_829 262
199 3300049823 Ga0501044_0028857 Ga0501044_0028857_2450_3247 262
200 3300049823 Ga0501044_0513513 Ga0501044_0513513_265_1086 262
201 3300032004 Ga0307414_10069935 Ga0307414_100699352 263
202 3300032005 Ga0307411_10025080 Ga0307411_100250803 263
203 3300003322 rootL2_10022103 rootL2_100221036 264
204 3300003323 rootH1_10168334 rootH1_101683342 264
205 3300049758 Ga0501241_000198 Ga0501241_000198_2958_3770 264
206 2162886007 SwRhRL2b_contig_785041 SwRhRL2b_0073.00004290 265
207 3300002773 JGI25152J39213_1000062 JGI25152J39213_100006252 265
208 3300002773 JGI25152J39213_1001383 JGI25152J39213_10013834 265
209 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001671 265
210 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001134 265
211 3300003215 JGI25153J46596_10000001 JGI25153J46596_1000000123 265
212 3300003781 Ga0055536_1000001 Ga0055536_1000001145 265
213 3300003791 Ga0055530_10002498 Ga0055530_100024988 265
214 3300005288 Ga0065714_10064548 Ga0065714_1006454826 265
215 3300005289 Ga0065704_10000310 Ga0065704_100003105 265
216 3300005563 Ga0068855_100241826 Ga0068855_1002418264 265
217 3300009036 Ga0105244_10063883 Ga0105244_100638832 265
218 3300013100 Ga0157373_10001634 Ga0157373_100016342 265
219 3300013100 Ga0157373_10090080 Ga0157373_100900802 265
220 3300013102 Ga0157371_10000021 Ga0157371_10000021219 265
221 3300013102 Ga0157371_10001425 Ga0157371_100014253 265
222 3300013104 Ga0157370_10002390 Ga0157370_1000239012 265
223 3300013104 Ga0157370_10002892 Ga0157370_1000289214 265
224 3300013104 Ga0157370_10008464 Ga0157370_100084646 265
225 3300013104 Ga0157370_10216760 Ga0157370_102167602 265
226 3300013105 Ga0157369_10000008 Ga0157369_10000008136 265
227 3300013306 Ga0163162_10000206 Ga0163162_1000020639 265
228 3300014497 Ga0182008_10001392 Ga0182008_100013927 265
229 3300015261 Ga0182006_1000412 Ga0182006_100041221 265
230 3300015261 Ga0182006_1000558 Ga0182006_100055816 265
231 3300015261 Ga0182006_1003901 Ga0182006_10039014 265
232 3300015262 Ga0182007_10000003 Ga0182007_10000003127 265
233 3300015682 Ga0183373_1001 Ga0183373_1001847 265
234 3300017792 Ga0163161_10000453 Ga0163161_1000045318 265
235 3300017792 Ga0163161_10001588 Ga0163161_100015889 265
236 3300017792 Ga0163161_10114349 Ga0163161_101143493 265
237 3300025245 Ga0207425_1000002 Ga0207425_1000002506 265
238 3300025258 Ga0209129_1000002 Ga0209129_1000002506 265
239 3300025292 Ga0209676_1000008 Ga0209676_1000008714 265
240 3300025294 Ga0209025_1000004 Ga0209025_1000004685 265
241 3300025297 Ga0209758_1000006 Ga0209758_1000006685 265
242 3300025298 Ga0209050_1000045 Ga0209050_100004571 265
243 3300028794 Ga0307515_10031935 Ga0307515_100319352 265
244 3300030744 Ga0316181_1001436 Ga0316181_10014362 265
245 3300031548 Ga0307408_100603419 Ga0307408_1006034191 265
246 3300031731 Ga0307405_10000069 Ga0307405_100000694 265
247 3300031903 Ga0307407_10000022 Ga0307407_1000002265 265
248 3300031911 Ga0307412_10000023 Ga0307412_1000002383 265
249 3300032002 Ga0307416_100000047 Ga0307416_10000004765 265
250 3300032004 Ga0307414_10009213 Ga0307414_100092134 265
251 3300032004 Ga0307414_10027099 Ga0307414_100270992 265
252 3300032005 Ga0307411_10104459 Ga0307411_101044592 265
253 3300046512 Ga0495610_0000066 Ga0495610_0000066_28372_29169 265
254 3300046512 Ga0495610_0000463 Ga0495610_0000463_24760_25557 265
255 3300046520 Ga0495637_0050219 Ga0495637_0050219_38_835 265
256 3300046525 Ga0495663_0048393 Ga0495663_0048393_340_1143 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01497

Peripla_BP_2

Periplasmic binding protein

47

251

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m34-assembly2.cif.gz_B structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.8845 21 262
5m2q-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli 0.8799 20 265
5m34-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.8762 20 265
5m3b-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli 0.8759 21 265
5m2q-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli 0.8728 20 265
ID Description Score Start End Superfamily
3pshA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9 3 135 3.40.50.1980
5yscA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8974 18 135 3.40.50.1980
2rg7D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8947 20 135 3.40.50.1980
3gfvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8857 1 146 3.40.50.1980
af_Q2G0F6_19_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8848 20 135 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A3C1ZZL0-F1-model_v4 Cobalamin-binding protein 0.9941 1 135
AF-A0A3C0IQU3-F1-model_v4 Cobalamin-binding protein 0.99 21 131
AF-A0A519MHR4-F1-model_v4 Cobalamin-binding protein 0.9899 1 146
AF-A0A7Y7CIA5-F1-model_v4 ABC transporter substrate-binding protein 0.9878 3 121
AF-A0A520CHY8-F1-model_v4 Cobalamin-binding protein 0.9877 1 145

Feature Viewer

pLDDT pTM Quality
95.6 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map