F366537
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 256 | 167 | 241 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300025250|Ga0209026_1005398|Ga0209026_10053984 |
| Length | 283 |
| Sequence | MQLPKPTPAITQWLPRPLQGGELYYNMPIYIDQLRREINLPATPKRIISVVPSQTELLFDLGLDEEIIGITKFCIHPTAQFKIKPKIGGTKQLNIQKIKELVPDLIIANKEENERSQIEELMNVCPVWISDIKNLDEALDMIVRVGEITGKAEKAQAIAQQIQINFNAFRPAPTDKKVAYFIWKNPYMVAGADTFINDMLKRCGLTNIFAQNRYPEISEQPLIDADPDLVLLSSEPYPFKQQHIDEFQAMLPNAKVQLVDGEMFSWYGSRLLYATDYFETLLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 4 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 5 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 6 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 7 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 8 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 9 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 10 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 11 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 12 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 13 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 14 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 15 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 16 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 21 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 23 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 24 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 25 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 30 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 34 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 90 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 144 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 159 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 161 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 164 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 165 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 166 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 167 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.75 |
| Metatranscriptomes | 0.39 |
| Isolates | 5.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.11 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 81.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_785041 | 2162886007 | Bacteria | 34032 |
| 2 | JGI24740J21852_10021919 | 3300001979 | Bacteria | 2207 |
| 3 | JGI24737J22298_10014806 | 3300001990 | Bacteria | 2529 |
| 4 | JGI24744J21845_10006339 | 3300002077 | Bacteria | 2456 |
| 5 | JGI25162J39368_1000749 | 3300002737 | Bacteria | 22177 |
| 6 | JGI25164J39214_1000901 | 3300002772 | Bacteria | 9933 |
| 7 | JGI25152J39213_1000062 | 3300002773 | Bacteria | 72854 |
| 8 | JGI25152J39213_1001383 | 3300002773 | Bacteria | 10533 |
| 9 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 10 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 11 | JGI25165J46597_1000519 | 3300003214 | Bacteria | 36430 |
| 12 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 13 | rootH1_10070312 | 3300003316 | Bacteria | 13485 |
| 14 | rootL2_10022103 | 3300003322 | Bacteria | 7005 |
| 15 | rootH1_10126989 | 3300003323 | Bacteria | 1327 |
| 16 | rootH1_10168334 | 3300003323 | Bacteria | 2275 |
| 17 | JGI25160J50197_1002187 | 3300003354 | Bacteria | 9203 |
| 18 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 19 | Ga0055530_10002498 | 3300003791 | Bacteria | 11773 |
| 20 | Ga0058863_11945642 | 3300004799 | Bacteria | 8118 |
| 21 | Ga0065714_10064548 | 3300005288 | Bacteria | 37532 |
| 22 | Ga0065704_10000310 | 3300005289 | Bacteria | 35517 |
| 23 | Ga0070658_10013480 | 3300005327 | Bacteria | 6560 |
| 24 | Ga0070658_10072462 | 3300005327 | Bacteria | 2823 |
| 25 | Ga0070658_10209975 | 3300005327 | Bacteria | 1645 |
| 26 | Ga0070676_10000121 | 3300005328 | Bacteria | 28951 |
| 27 | Ga0070683_100025363 | 3300005329 | Bacteria | 5323 |
| 28 | Ga0070680_100003652 | 3300005336 | Bacteria | 11496 |
| 29 | Ga0070680_100007052 | 3300005336 | Bacteria | 8566 |
| 30 | Ga0068868_100464708 | 3300005338 | Bacteria | 1103 |
| 31 | Ga0070660_100049977 | 3300005339 | Bacteria | 3216 |
| 32 | Ga0070660_100102769 | 3300005339 | Bacteria | 2266 |
| 33 | Ga0070660_100200628 | 3300005339 | Bacteria | 1618 |
| 34 | Ga0070673_100002402 | 3300005364 | Bacteria | 11395 |
| 35 | Ga0070659_100046945 | 3300005366 | Bacteria | 3386 |
| 36 | Ga0070663_100008574 | 3300005455 | Bacteria | 6296 |
| 37 | Ga0070678_100002279 | 3300005456 | Bacteria | 10444 |
| 38 | Ga0070662_100000559 | 3300005457 | Bacteria | 22595 |
| 39 | Ga0068867_100003937 | 3300005459 | Bacteria | 10457 |
| 40 | Ga0070679_100065850 | 3300005530 | Bacteria | 3611 |
| 41 | Ga0070679_100078035 | 3300005530 | Unclassified | 3301 |
| 42 | Ga0068853_100013381 | 3300005539 | Bacteria | 6697 |
| 43 | Ga0070672_100066521 | 3300005543 | Bacteria | 2854 |
| 44 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 45 | Ga0068855_100009372 | 3300005563 | Bacteria | 11823 |
| 46 | Ga0068855_100166353 | 3300005563 | Bacteria | 2500 |
| 47 | Ga0068855_100241826 | 3300005563 | Bacteria | 2016 |
| 48 | Ga0068857_100327350 | 3300005577 | Bacteria | 1416 |
| 49 | Ga0068856_100000092 | 3300005614 | Bacteria | 84781 |
| 50 | Ga0068852_100000264 | 3300005616 | Bacteria | 35179 |
| 51 | Ga0068866_10157931 | 3300005718 | Bacteria | 1320 |
| 52 | Ga0068870_10097089 | 3300005840 | Bacteria | 1658 |
| 53 | Ga0068870_10168400 | 3300005840 | Bacteria | 1305 |
| 54 | Ga0097621_100000152 | 3300006237 | Bacteria | 42727 |
| 55 | Ga0068871_100000020 | 3300006358 | Bacteria | 84930 |
| 56 | Ga0075428_100027487 | 3300006844 | Bacteria | 6294 |
| 57 | Ga0075429_100194171 | 3300006880 | Bacteria | 1778 |
| 58 | Ga0068865_100000138 | 3300006881 | Bacteria | 38207 |
| 59 | Ga0105244_10063883 | 3300009036 | Bacteria | 1848 |
| 60 | Ga0105240_10010038 | 3300009093 | Bacteria | 13334 |
| 61 | Ga0105240_10024315 | 3300009093 | Bacteria | 7990 |
| 62 | Ga0105240_10085539 | 3300009093 | Bacteria | 3863 |
| 63 | Ga0105240_10484503 | 3300009093 | Bacteria | 1378 |
| 64 | Ga0105240_10712565 | 3300009093 | Bacteria | 1094 |
| 65 | Ga0111539_10001098 | 3300009094 | Bacteria | 35755 |
| 66 | Ga0105243_10263407 | 3300009148 | Bacteria | 1544 |
| 67 | Ga0105241_10000630 | 3300009174 | Bacteria | 26536 |
| 68 | Ga0105241_10001146 | 3300009174 | Bacteria | 20196 |
| 69 | Ga0105241_10167570 | 3300009174 | Bacteria | 1811 |
| 70 | Ga0105242_10014056 | 3300009176 | Bacteria | 6193 |
| 71 | Ga0105242_10015983 | 3300009176 | Bacteria | 5832 |
| 72 | Ga0105237_10000803 | 3300009545 | Bacteria | 42892 |
| 73 | Ga0105237_10005064 | 3300009545 | Bacteria | 14970 |
| 74 | Ga0105237_10130437 | 3300009545 | Bacteria | 2508 |
| 75 | Ga0105238_10029875 | 3300009551 | Bacteria | 5549 |
| 76 | Ga0105238_10294575 | 3300009551 | Bacteria | 1605 |
| 77 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 78 | Ga0105239_10004316 | 3300010375 | Bacteria | 17046 |
| 79 | Ga0105239_10008401 | 3300010375 | Bacteria | 11758 |
| 80 | Ga0105239_10012536 | 3300010375 | Bacteria | 9441 |
| 81 | Ga0105239_10033240 | 3300010375 | Bacteria | 5664 |
| 82 | Ga0105239_10182341 | 3300010375 | Bacteria | 2349 |
| 83 | Ga0105239_10189151 | 3300010375 | Bacteria | 2304 |
| 84 | Ga0105246_10567498 | 3300011119 | Bacteria | 975 |
| 85 | Ga0157373_10001634 | 3300013100 | Bacteria | 17114 |
| 86 | Ga0157373_10014445 | 3300013100 | Bacteria | 5788 |
| 87 | Ga0157373_10090080 | 3300013100 | Bacteria | 2160 |
| 88 | Ga0157371_10000021 | 3300013102 | Bacteria | 301017 |
| 89 | Ga0157371_10001425 | 3300013102 | Bacteria | 24842 |
| 90 | Ga0157371_10002315 | 3300013102 | Bacteria | 18316 |
| 91 | Ga0157371_10007654 | 3300013102 | Bacteria | 8706 |
| 92 | Ga0157371_10037521 | 3300013102 | Bacteria | 3467 |
| 93 | Ga0157371_10283927 | 3300013102 | Bacteria | 1196 |
| 94 | Ga0157370_10000173 | 3300013104 | Bacteria | 80263 |
| 95 | Ga0157370_10002390 | 3300013104 | Bacteria | 22640 |
| 96 | Ga0157370_10002892 | 3300013104 | Bacteria | 20477 |
| 97 | Ga0157370_10008464 | 3300013104 | Bacteria | 11096 |
| 98 | Ga0157370_10020452 | 3300013104 | Bacteria | 6612 |
| 99 | Ga0157370_10173826 | 3300013104 | Bacteria | 2002 |
| 100 | Ga0157370_10216760 | 3300013104 | Bacteria | 1774 |
| 101 | Ga0157369_10000008 | 3300013105 | Bacteria | 309315 |
| 102 | Ga0157369_10003057 | 3300013105 | Bacteria | 19979 |
| 103 | Ga0157374_10000349 | 3300013296 | Bacteria | 42687 |
| 104 | Ga0157374_10013797 | 3300013296 | Bacteria | 7058 |
| 105 | Ga0163162_10000206 | 3300013306 | Bacteria | 54701 |
| 106 | Ga0163162_10003180 | 3300013306 | Bacteria | 15704 |
| 107 | Ga0163162_10202524 | 3300013306 | Bacteria | 2114 |
| 108 | Ga0157372_10000021 | 3300013307 | Bacteria | 207801 |
| 109 | Ga0157372_10022752 | 3300013307 | Bacteria | 6785 |
| 110 | Ga0157372_10233100 | 3300013307 | Bacteria | 2135 |
| 111 | Ga0157375_10004387 | 3300013308 | Bacteria | 12251 |
| 112 | Ga0157380_10265310 | 3300014326 | Bacteria | 1562 |
| 113 | Ga0182008_10001392 | 3300014497 | Bacteria | 16330 |
| 114 | Ga0157377_10015289 | 3300014745 | Bacteria | 3922 |
| 115 | Ga0157376_10021299 | 3300014969 | Bacteria | 5034 |
| 116 | Ga0182006_1000412 | 3300015261 | Bacteria | 34522 |
| 117 | Ga0182006_1000558 | 3300015261 | Bacteria | 27941 |
| 118 | Ga0182006_1003901 | 3300015261 | Bacteria | 7472 |
| 119 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 120 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 121 | Ga0163161_10000453 | 3300017792 | Bacteria | 34026 |
| 122 | Ga0163161_10001588 | 3300017792 | Bacteria | 16763 |
| 123 | Ga0163161_10006484 | 3300017792 | Bacteria | 8103 |
| 124 | Ga0163161_10114349 | 3300017792 | Bacteria | 2021 |
| 125 | Ga0213872_10020246 | 3300021361 | Bacteria | 3065 |
| 126 | Ga0209563_108797 | 3300025230 | Bacteria | 1570 |
| 127 | Ga0207427_100103 | 3300025231 | Bacteria | 119618 |
| 128 | Ga0209437_100085 | 3300025233 | Bacteria | 254790 |
| 129 | Ga0209437_100101 | 3300025233 | Bacteria | 226668 |
| 130 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 131 | Ga0209026_1005398 | 3300025250 | Bacteria | 3453 |
| 132 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 133 | Ga0209129_1011946 | 3300025258 | Bacteria | 2035 |
| 134 | Ga0209233_1000124 | 3300025261 | Bacteria | 226743 |
| 135 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 136 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 137 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 138 | Ga0209050_1000045 | 3300025298 | Bacteria | 388022 |
| 139 | Ga0207426_1000009 | 3300025302 | Bacteria | 797229 |
| 140 | Ga0207642_10113905 | 3300025899 | Bacteria | 1382 |
| 141 | Ga0207645_10000131 | 3300025907 | Bacteria | 56813 |
| 142 | Ga0207643_10108189 | 3300025908 | Bacteria | 1635 |
| 143 | Ga0207705_10049317 | 3300025909 | Bacteria | 3030 |
| 144 | Ga0207705_10097257 | 3300025909 | Bacteria | 2162 |
| 145 | Ga0207705_10157586 | 3300025909 | Bacteria | 1704 |
| 146 | Ga0207654_10003102 | 3300025911 | Bacteria | 8409 |
| 147 | Ga0207654_10022780 | 3300025911 | Bacteria | 3346 |
| 148 | Ga0207654_10074280 | 3300025911 | Bacteria | 2029 |
| 149 | Ga0207654_10196814 | 3300025911 | Bacteria | 1324 |
| 150 | Ga0207695_10000189 | 3300025913 | Bacteria | 177142 |
| 151 | Ga0207695_10003136 | 3300025913 | Bacteria | 23615 |
| 152 | Ga0207695_10008178 | 3300025913 | Bacteria | 13141 |
| 153 | Ga0207695_10551178 | 3300025913 | Bacteria | 1034 |
| 154 | Ga0207671_10021517 | 3300025914 | Bacteria | 4890 |
| 155 | Ga0207671_10041286 | 3300025914 | Bacteria | 3414 |
| 156 | Ga0207660_10048233 | 3300025917 | Bacteria | 3013 |
| 157 | Ga0207660_10098107 | 3300025917 | Bacteria | 2185 |
| 158 | Ga0207657_10037147 | 3300025919 | Bacteria | 4354 |
| 159 | Ga0207657_10105136 | 3300025919 | Bacteria | 2337 |
| 160 | Ga0207657_10164321 | 3300025919 | Bacteria | 1801 |
| 161 | Ga0207652_10000271 | 3300025921 | Bacteria | 53923 |
| 162 | Ga0207652_10008194 | 3300025921 | Bacteria | 8392 |
| 163 | Ga0207694_10116389 | 3300025924 | Bacteria | 2130 |
| 164 | Ga0207644_10011827 | 3300025931 | Bacteria | 5780 |
| 165 | Ga0207690_10038811 | 3300025932 | Bacteria | 3102 |
| 166 | Ga0207690_10254540 | 3300025932 | Bacteria | 1358 |
| 167 | Ga0207706_10000126 | 3300025933 | Bacteria | 82630 |
| 168 | Ga0207686_10014443 | 3300025934 | Bacteria | 4397 |
| 169 | Ga0207686_10020520 | 3300025934 | Bacteria | 3776 |
| 170 | Ga0207704_10000109 | 3300025938 | Bacteria | 45314 |
| 171 | Ga0207691_10081153 | 3300025940 | Bacteria | 2916 |
| 172 | Ga0207667_10002067 | 3300025949 | Bacteria | 25161 |
| 173 | Ga0207667_10211799 | 3300025949 | Bacteria | 1986 |
| 174 | Ga0207651_10034378 | 3300025960 | Bacteria | 3282 |
| 175 | Ga0207677_10140020 | 3300026023 | Bacteria | 1851 |
| 176 | Ga0207639_10006033 | 3300026041 | Bacteria | 8218 |
| 177 | Ga0207639_10007595 | 3300026041 | Bacteria | 7396 |
| 178 | Ga0207702_10000451 | 3300026078 | Bacteria | 46484 |
| 179 | Ga0207702_10016247 | 3300026078 | Bacteria | 6159 |
| 180 | Ga0207648_10000155 | 3300026089 | Bacteria | 69524 |
| 181 | Ga0207683_10000968 | 3300026121 | Bacteria | 26291 |
| 182 | Ga0207698_10036779 | 3300026142 | Bacteria | 3598 |
| 183 | Ga0207428_10250108 | 3300027907 | Bacteria | 1322 |
| 184 | Ga0268266_10000052 | 3300028379 | Bacteria | 296230 |
| 185 | Ga0307515_10001310 | 3300028794 | Bacteria | 56561 |
| 186 | Ga0307515_10002920 | 3300028794 | Bacteria | 36261 |
| 187 | Ga0307515_10031935 | 3300028794 | Bacteria | 8747 |
| 188 | Ga0316181_1001436 | 3300030744 | Bacteria | 1642 |
| 189 | Ga0307408_100603419 | 3300031548 | Bacteria | 976 |
| 190 | Ga0307405_10000069 | 3300031731 | Bacteria | 47710 |
| 191 | Ga0307407_10000022 | 3300031903 | Bacteria | 120355 |
| 192 | Ga0307412_10000023 | 3300031911 | Bacteria | 237005 |
| 193 | Ga0307416_100000047 | 3300032002 | Bacteria | 120385 |
| 194 | Ga0307414_10009213 | 3300032004 | Bacteria | 5658 |
| 195 | Ga0307414_10027099 | 3300032004 | Bacteria | 3698 |
| 196 | Ga0307414_10064183 | 3300032004 | Bacteria | 2613 |
| 197 | Ga0307414_10069935 | 3300032004 | Bacteria | 2525 |
| 198 | Ga0307411_10025080 | 3300032005 | Bacteria | 3566 |
| 199 | Ga0307411_10104459 | 3300032005 | Bacteria | 2012 |
| 200 | Ga0395899_0002205 | 3300037312 | Bacteria | 15966 |
| 201 | Ga0395899_0050335 | 3300037312 | Bacteria | 3093 |
| 202 | Ga0395899_0104247 | 3300037312 | Bacteria | 2044 |
| 203 | Ga0395900_0010575 | 3300037418 | Bacteria | 9436 |
| 204 | Ga0395898_0075365 | 3300037466 | Bacteria | 3259 |
| 205 | Ga0395898_0673642 | 3300037466 | Unclassified | 976 |
| 206 | Ga0395905_0000769 | 3300037471 | Bacteria | 42306 |
| 207 | Ga0395905_0005066 | 3300037471 | Bacteria | 13559 |
| 208 | Ga0395905_0315306 | 3300037471 | Bacteria | 1453 |
| 209 | Ga0395901_0002005 | 3300038443 | Bacteria | 20948 |
| 210 | Ga0395901_0501042 | 3300038443 | Bacteria | 1236 |
| 211 | Ga0436361_0335649 | 3300039447 | Bacteria | 9308 |
| 212 | Ga0466966_0024657 | 3300044684 | Bacteria | 3933 |
| 213 | Ga0451576_0027753 | 3300045051 | Bacteria | 6078 |
| 214 | Ga0466958_0084210 | 3300045836 | Bacteria | 1961 |
| 215 | Ga0495606_0000002 | 3300046507 | Bacteria | 554637 |
| 216 | Ga0495606_0146962 | 3300046507 | Bacteria | 1387 |
| 217 | Ga0495610_0000066 | 3300046512 | Bacteria | 124205 |
| 218 | Ga0495610_0000463 | 3300046512 | Bacteria | 41930 |
| 219 | Ga0495637_0050219 | 3300046520 | Bacteria | 1750 |
| 220 | Ga0495663_0048393 | 3300046525 | Bacteria | 1311 |
| 221 | Ga0495633_0001770 | 3300046558 | Bacteria | 16011 |
| 222 | Ga0495625_0016686 | 3300046660 | Bacteria | 5769 |
| 223 | Ga0495636_0000047 | 3300047318 | Bacteria | 52861 |
| 224 | Ga0495687_000815 | 3300047443 | Bacteria | 33443 |
| 225 | Ga0495687_001680 | 3300047443 | Bacteria | 19763 |
| 226 | Ga0495686_0001314 | 3300047472 | Bacteria | 27885 |
| 227 | Ga0501033_0045421 | 3300049570 | Bacteria | 3269 |
| 228 | Ga0501034_0059472 | 3300049571 | Bacteria | 3838 |
| 229 | Ga0501034_0074425 | 3300049571 | Bacteria | 3404 |
| 230 | Ga0501241_000198 | 3300049758 | Bacteria | 13561 |
| 231 | Ga0501044_0028857 | 3300049823 | Bacteria | 5852 |
| 232 | Ga0501044_0513513 | 3300049823 | Bacteria | 1098 |
| 233 | nmdc:mga0k408_55_c2 | 3300050493 | Bacteria | 31438 |
| 234 | nmdc:mga09592_145381_c1 | 3300050508 | Bacteria | 2044 |
| 235 | nmdc:mga08y16_28437_c1 | 3300050511 | Bacteria | 5894 |
| 236 | Ga0500608_011302 | 3300053122 | Bacteria | 3871 |
| 237 | Ga0500618_000001 | 3300053125 | Bacteria | 538477 |
| 238 | Ga0500618_005836 | 3300053125 | Bacteria | 3692 |
| 239 | Ga0500564_090824 | 3300053138 | Bacteria | 1359 |
| 240 | Ga0500616_0133939 | 3300053153 | Bacteria | 1167 |
| 241 | Ga0500624_000835 | 3300053157 | Bacteria | 6985 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005530 | Ga0070679_100078035 | Ga0070679_1000780353 | 210 |
| 2 | 3300025921 | Ga0207652_10000271 | Ga0207652_1000027136 | 210 |
| 3 | 3300005336 | Ga0070680_100007052 | Ga0070680_1000070527 | 216 |
| 4 | 3300005548 | Ga0070665_100000003 | Ga0070665_100000003544 | 232 |
| 5 | 3300009093 | Ga0105240_10024315 | Ga0105240_100243152 | 232 |
| 6 | 3300025913 | Ga0207695_10003136 | Ga0207695_100031362 | 232 |
| 7 | 3300028379 | Ga0268266_10000052 | Ga0268266_10000052136 | 232 |
| 8 | 3300013296 | Ga0157374_10013797 | Ga0157374_100137973 | 233 |
| 9 | 3300037312 | Ga0395899_0050335 | Ga0395899_0050335_1574_2362 | 234 |
| 10 | 3300037418 | Ga0395900_0010575 | Ga0395900_0010575_1135_1923 | 234 |
| 11 | 3300037466 | Ga0395898_0075365 | Ga0395898_0075365_67_855 | 234 |
| 12 | 3300037471 | Ga0395905_0000769 | Ga0395905_0000769_32763_33551 | 234 |
| 13 | 3300038443 | Ga0395901_0002005 | Ga0395901_0002005_9380_10168 | 234 |
| 14 | 3300013102 | Ga0157371_10002315 | Ga0157371_1000231521 | 236 |
| 15 | 3300013307 | Ga0157372_10000021 | Ga0157372_10000021152 | 236 |
| 16 | 3300044684 | Ga0466966_0024657 | Ga0466966_0024657_490_1287 | 236 |
| 17 | 3300001979 | JGI24740J21852_10021919 | JGI24740J21852_100219192 | 238 |
| 18 | 3300037312 | Ga0395899_0002205 | Ga0395899_0002205_8746_9543 | 238 |
| 19 | 3300045051 | Ga0451576_0027753 | Ga0451576_0027753_3988_4710 | 238 |
| 20 | 3300013104 | Ga0157370_10020452 | Ga0157370_1002045210 | 239 |
| 21 | 3300013105 | Ga0157369_10003057 | Ga0157369_100030575 | 239 |
| 22 | 3300045836 | Ga0466958_0084210 | Ga0466958_0084210_602_1399 | 239 |
| 23 | 3300001990 | JGI24737J22298_10014806 | JGI24737J22298_100148061 | 241 |
| 24 | 3300005339 | Ga0070660_100102769 | Ga0070660_1001027692 | 241 |
| 25 | 3300005366 | Ga0070659_100046945 | Ga0070659_1000469455 | 241 |
| 26 | 3300005457 | Ga0070662_100000559 | Ga0070662_10000055913 | 241 |
| 27 | 3300009093 | Ga0105240_10712565 | Ga0105240_107125652 | 241 |
| 28 | 3300009174 | Ga0105241_10001146 | Ga0105241_100011466 | 241 |
| 29 | 3300010375 | Ga0105239_10189151 | Ga0105239_101891513 | 241 |
| 30 | 3300011119 | Ga0105246_10567498 | Ga0105246_105674982 | 241 |
| 31 | 3300013100 | Ga0157373_10014445 | Ga0157373_100144457 | 241 |
| 32 | 3300013102 | Ga0157371_10283927 | Ga0157371_102839272 | 241 |
| 33 | 3300014745 | Ga0157377_10015289 | Ga0157377_100152895 | 241 |
| 34 | 3300025911 | Ga0207654_10003102 | Ga0207654_100031024 | 241 |
| 35 | 3300025919 | Ga0207657_10105136 | Ga0207657_101051364 | 241 |
| 36 | 3300025932 | Ga0207690_10254540 | Ga0207690_102545402 | 241 |
| 37 | 3300025933 | Ga0207706_10000126 | Ga0207706_1000012676 | 241 |
| 38 | 3300003323 | rootH1_10126989 | rootH1_101269892 | 244 |
| 39 | 3300005563 | Ga0068855_100009372 | Ga0068855_10000937214 | 245 |
| 40 | 3300005840 | Ga0068870_10097089 | Ga0068870_100970892 | 245 |
| 41 | 3300009093 | Ga0105240_10010038 | Ga0105240_1001003813 | 245 |
| 42 | 3300025908 | Ga0207643_10108189 | Ga0207643_101081891 | 245 |
| 43 | 3300025913 | Ga0207695_10008178 | Ga0207695_1000817813 | 245 |
| 44 | 3300037466 | Ga0395898_0673642 | Ga0395898_0673642_61_846 | 245 |
| 45 | 3300038443 | Ga0395901_0501042 | Ga0395901_0501042_93_878 | 245 |
| 46 | 3300005327 | Ga0070658_10072462 | Ga0070658_100724621 | 246 |
| 47 | 3300005329 | Ga0070683_100025363 | Ga0070683_1000253633 | 246 |
| 48 | 3300005339 | Ga0070660_100200628 | Ga0070660_1002006281 | 246 |
| 49 | 3300005455 | Ga0070663_100008574 | Ga0070663_1000085742 | 246 |
| 50 | 3300013104 | Ga0157370_10173826 | Ga0157370_101738261 | 246 |
| 51 | 3300025919 | Ga0207657_10164321 | Ga0207657_101643212 | 246 |
| 52 | 3300025949 | Ga0207667_10002067 | Ga0207667_1000206720 | 246 |
| 53 | 3300026078 | Ga0207702_10016247 | Ga0207702_100162475 | 246 |
| 54 | 3300037312 | Ga0395899_0104247 | Ga0395899_0104247_1062_1850 | 246 |
| 55 | 3300025909 | Ga0207705_10049317 | Ga0207705_100493172 | 247 |
| 56 | 3300005459 | Ga0068867_100003937 | Ga0068867_1000039375 | 249 |
| 57 | 3300005840 | Ga0068870_10168400 | Ga0068870_101684001 | 249 |
| 58 | 3300006237 | Ga0097621_100000152 | Ga0097621_10000015245 | 249 |
| 59 | 3300006358 | Ga0068871_100000020 | Ga0068871_10000002080 | 249 |
| 60 | 3300009551 | Ga0105238_10029875 | Ga0105238_100298757 | 249 |
| 61 | 3300014326 | Ga0157380_10265310 | Ga0157380_102653102 | 249 |
| 62 | 3300025924 | Ga0207694_10116389 | Ga0207694_101163893 | 249 |
| 63 | 3300026089 | Ga0207648_10000155 | Ga0207648_1000015549 | 249 |
| 64 | 3300009176 | Ga0105242_10014056 | Ga0105242_100140565 | 250 |
| 65 | 3300025934 | Ga0207686_10014443 | Ga0207686_100144434 | 250 |
| 66 | 3300010375 | Ga0105239_10182341 | Ga0105239_101823412 | 252 |
| 67 | 3300009545 | Ga0105237_10005064 | Ga0105237_100050645 | 253 |
| 68 | 3300053122 | Ga0500608_011302 | Ga0500608_011302_1578_2342 | 253 |
| 69 | iso_pu_bacteria | 2910245624 | 2910248612 | 254 |
| 70 | 3300002077 | JGI24744J21845_10006339 | JGI24744J21845_100063393 | 255 |
| 71 | 3300005328 | Ga0070676_10000121 | Ga0070676_1000012123 | 255 |
| 72 | 3300005338 | Ga0068868_100464708 | Ga0068868_1004647082 | 255 |
| 73 | 3300005364 | Ga0070673_100002402 | Ga0070673_10000240210 | 255 |
| 74 | 3300005456 | Ga0070678_100002279 | Ga0070678_10000227912 | 255 |
| 75 | 3300005539 | Ga0068853_100013381 | Ga0068853_1000133812 | 255 |
| 76 | 3300005543 | Ga0070672_100066521 | Ga0070672_1000665213 | 255 |
| 77 | 3300005616 | Ga0068852_100000264 | Ga0068852_10000026420 | 255 |
| 78 | 3300005718 | Ga0068866_10157931 | Ga0068866_101579312 | 255 |
| 79 | 3300006881 | Ga0068865_100000138 | Ga0068865_10000013840 | 255 |
| 80 | 3300009174 | Ga0105241_10000630 | Ga0105241_100006302 | 255 |
| 81 | 3300009176 | Ga0105242_10015983 | Ga0105242_100159837 | 255 |
| 82 | 3300009545 | Ga0105237_10000803 | Ga0105237_1000080327 | 255 |
| 83 | 3300010375 | Ga0105239_10008401 | Ga0105239_100084016 | 255 |
| 84 | 3300013296 | Ga0157374_10000349 | Ga0157374_100003493 | 255 |
| 85 | 3300025899 | Ga0207642_10113905 | Ga0207642_101139052 | 255 |
| 86 | 3300025907 | Ga0207645_10000131 | Ga0207645_1000013136 | 255 |
| 87 | 3300025911 | Ga0207654_10022780 | Ga0207654_100227802 | 255 |
| 88 | 3300025914 | Ga0207671_10041286 | Ga0207671_100412863 | 255 |
| 89 | 3300025934 | Ga0207686_10020520 | Ga0207686_100205205 | 255 |
| 90 | 3300025938 | Ga0207704_10000109 | Ga0207704_1000010934 | 255 |
| 91 | 3300025940 | Ga0207691_10081153 | Ga0207691_100811533 | 255 |
| 92 | 3300025960 | Ga0207651_10034378 | Ga0207651_100343783 | 255 |
| 93 | 3300026023 | Ga0207677_10140020 | Ga0207677_101400202 | 255 |
| 94 | 3300026041 | Ga0207639_10007595 | Ga0207639_100075959 | 255 |
| 95 | 3300026121 | Ga0207683_10000968 | Ga0207683_1000096829 | 255 |
| 96 | 3300026142 | Ga0207698_10036779 | Ga0207698_100367793 | 255 |
| 97 | 3300032004 | Ga0307414_10064183 | Ga0307414_100641832 | 255 |
| 98 | 3300005327 | Ga0070658_10209975 | Ga0070658_102099752 | 256 |
| 99 | 3300005336 | Ga0070680_100003652 | Ga0070680_1000036529 | 256 |
| 100 | 3300005339 | Ga0070660_100049977 | Ga0070660_1000499773 | 256 |
| 101 | 3300005577 | Ga0068857_100327350 | Ga0068857_1003273502 | 256 |
| 102 | 3300025917 | Ga0207660_10048233 | Ga0207660_100482333 | 256 |
| 103 | 3300025919 | Ga0207657_10037147 | Ga0207657_100371475 | 256 |
| 104 | 3300025932 | Ga0207690_10038811 | Ga0207690_100388114 | 256 |
| 105 | iso_pu_bacteria | 2932082852 | 2932083451 | 256 |
| 106 | 3300013102 | Ga0157371_10037521 | Ga0157371_100375214 | 257 |
| 107 | 3300013307 | Ga0157372_10022752 | Ga0157372_100227526 | 257 |
| 108 | 3300025250 | Ga0209026_1005398 | Ga0209026_10053984 | 257 |
| 109 | 3300037471 | Ga0395905_0005066 | Ga0395905_0005066_2160_2936 | 257 |
| 110 | 3300005327 | Ga0070658_10013480 | Ga0070658_100134803 | 258 |
| 111 | 3300013102 | Ga0157371_10007654 | Ga0157371_100076549 | 258 |
| 112 | 3300013104 | Ga0157370_10000173 | Ga0157370_1000017314 | 258 |
| 113 | 3300013307 | Ga0157372_10233100 | Ga0157372_102331002 | 258 |
| 114 | 3300025909 | Ga0207705_10157586 | Ga0207705_101575863 | 258 |
| 115 | 3300037471 | Ga0395905_0315306 | Ga0395905_0315306_121_903 | 258 |
| 116 | 3300006844 | Ga0075428_100027487 | Ga0075428_1000274875 | 259 |
| 117 | 3300006880 | Ga0075429_100194171 | Ga0075429_1001941712 | 259 |
| 118 | 3300009094 | Ga0111539_10001098 | Ga0111539_1000109822 | 259 |
| 119 | 3300013306 | Ga0163162_10003180 | Ga0163162_1000318012 | 259 |
| 120 | 3300027907 | Ga0207428_10250108 | Ga0207428_102501081 | 259 |
| 121 | 3300046507 | Ga0495606_0000002 | Ga0495606_0000002_309457_310236 | 259 |
| 122 | 3300050508 | nmdc:mga09592_145381_c1 | nmdc:mga09592_145381_c1_605_1390 | 259 |
| 123 | 3300050511 | nmdc:mga08y16_28437_c1 | nmdc:mga08y16_28437_c1_2546_3331 | 259 |
| 124 | 3300053125 | Ga0500618_000001 | Ga0500618_000001_100654_101433 | 259 |
| 125 | 3300053125 | Ga0500618_005836 | Ga0500618_005836_2789_3568 | 259 |
| 126 | 3300002737 | JGI25162J39368_1000749 | JGI25162J39368_100074914 | 260 |
| 127 | 3300002772 | JGI25164J39214_1000901 | JGI25164J39214_10009013 | 260 |
| 128 | 3300003214 | JGI25165J46597_1000519 | JGI25165J46597_100051916 | 260 |
| 129 | 3300003316 | rootH1_10070312 | rootH1_1007031211 | 260 |
| 130 | 3300004799 | Ga0058863_11945642 | Ga0058863_119456424 | 260 |
| 131 | 3300005530 | Ga0070679_100065850 | Ga0070679_1000658504 | 260 |
| 132 | 3300005563 | Ga0068855_100166353 | Ga0068855_1001663532 | 260 |
| 133 | 3300005614 | Ga0068856_100000092 | Ga0068856_10000009237 | 260 |
| 134 | 3300009093 | Ga0105240_10085539 | Ga0105240_100855392 | 260 |
| 135 | 3300009093 | Ga0105240_10484503 | Ga0105240_104845032 | 260 |
| 136 | 3300009148 | Ga0105243_10263407 | Ga0105243_102634072 | 260 |
| 137 | 3300009174 | Ga0105241_10167570 | Ga0105241_101675703 | 260 |
| 138 | 3300009545 | Ga0105237_10130437 | Ga0105237_101304373 | 260 |
| 139 | 3300009551 | Ga0105238_10294575 | Ga0105238_102945752 | 260 |
| 140 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002497 | 260 |
| 141 | 3300010375 | Ga0105239_10004316 | Ga0105239_1000431617 | 260 |
| 142 | 3300010375 | Ga0105239_10012536 | Ga0105239_100125368 | 260 |
| 143 | 3300010375 | Ga0105239_10033240 | Ga0105239_100332402 | 260 |
| 144 | 3300013306 | Ga0163162_10202524 | Ga0163162_102025242 | 260 |
| 145 | 3300013308 | Ga0157375_10004387 | Ga0157375_100043878 | 260 |
| 146 | 3300014969 | Ga0157376_10021299 | Ga0157376_100212995 | 260 |
| 147 | 3300017792 | Ga0163161_10006484 | Ga0163161_100064845 | 260 |
| 148 | 3300021361 | Ga0213872_10020246 | Ga0213872_100202461 | 260 |
| 149 | 3300025230 | Ga0209563_108797 | Ga0209563_1087973 | 260 |
| 150 | 3300025231 | Ga0207427_100103 | Ga0207427_10010366 | 260 |
| 151 | 3300025233 | Ga0209437_100085 | Ga0209437_100085109 | 260 |
| 152 | 3300025233 | Ga0209437_100101 | Ga0209437_10010187 | 260 |
| 153 | 3300025258 | Ga0209129_1011946 | Ga0209129_10119462 | 260 |
| 154 | 3300025261 | Ga0209233_1000124 | Ga0209233_1000124149 | 260 |
| 155 | 3300025909 | Ga0207705_10097257 | Ga0207705_100972573 | 260 |
| 156 | 3300025911 | Ga0207654_10074280 | Ga0207654_100742802 | 260 |
| 157 | 3300025911 | Ga0207654_10196814 | Ga0207654_101968141 | 260 |
| 158 | 3300025913 | Ga0207695_10000189 | Ga0207695_1000018992 | 260 |
| 159 | 3300025913 | Ga0207695_10551178 | Ga0207695_105511781 | 260 |
| 160 | 3300025914 | Ga0207671_10021517 | Ga0207671_100215174 | 260 |
| 161 | 3300025917 | Ga0207660_10098107 | Ga0207660_100981072 | 260 |
| 162 | 3300025921 | Ga0207652_10008194 | Ga0207652_100081943 | 260 |
| 163 | 3300025931 | Ga0207644_10011827 | Ga0207644_100118271 | 260 |
| 164 | 3300025949 | Ga0207667_10211799 | Ga0207667_102117992 | 260 |
| 165 | 3300026041 | Ga0207639_10006033 | Ga0207639_100060336 | 260 |
| 166 | 3300026078 | Ga0207702_10000451 | Ga0207702_100004513 | 260 |
| 167 | 3300028794 | Ga0307515_10001310 | Ga0307515_1000131036 | 260 |
| 168 | 3300028794 | Ga0307515_10002920 | Ga0307515_1000292023 | 260 |
| 169 | 3300039447 | Ga0436361_0335649 | Ga0436361_0335649_2559_3344 | 260 |
| 170 | 3300046507 | Ga0495606_0146962 | Ga0495606_0146962_588_1376 | 260 |
| 171 | 3300046558 | Ga0495633_0001770 | Ga0495633_0001770_9365_10159 | 260 |
| 172 | 3300046660 | Ga0495625_0016686 | Ga0495625_0016686_2557_3342 | 260 |
| 173 | 3300047318 | Ga0495636_0000047 | Ga0495636_0000047_42692_43483 | 260 |
| 174 | 3300047443 | Ga0495687_000815 | Ga0495687_000815_21732_22529 | 260 |
| 175 | 3300047443 | Ga0495687_001680 | Ga0495687_001680_10550_11335 | 260 |
| 176 | 3300047472 | Ga0495686_0001314 | Ga0495686_0001314_2328_3116 | 260 |
| 177 | 3300050493 | nmdc:mga0k408_55_c2 | nmdc:mga0k408_55_c2_27257_28051 | 260 |
| 178 | 3300053138 | Ga0500564_090824 | Ga0500564_090824_303_1091 | 260 |
| 179 | 3300053153 | Ga0500616_0133939 | Ga0500616_0133939_134_934 | 260 |
| 180 | 3300053157 | Ga0500624_000835 | Ga0500624_000835_3614_4396 | 260 |
| 181 | 3300003354 | JGI25160J50197_1002187 | JGI25160J50197_10021875 | 261 |
| 182 | 3300025302 | Ga0207426_1000009 | Ga0207426_1000009396 | 261 |
| 183 | iso_pu_bacteria | 2585427687 | 2586210962 | 261 |
| 184 | iso_pu_bacteria | 2738541302 | 2738855661 | 261 |
| 185 | iso_pu_bacteria | 2739367651 | 2739590543 | 261 |
| 186 | iso_pu_bacteria | 2739367656 | 2739617221 | 261 |
| 187 | iso_pu_bacteria | 2739367663 | 2739647480 | 261 |
| 188 | iso_pu_bacteria | 2818991437 | 2819549264 | 261 |
| 189 | iso_pu_bacteria | 2842722452 | 2842724853 | 261 |
| 190 | iso_pu_bacteria | 2842909656 | 2842913127 | 261 |
| 191 | iso_pu_bacteria | 2849281842 | 2849284660 | 261 |
| 192 | iso_pu_bacteria | 2857627736 | 2857630190 | 261 |
| 193 | iso_pu_bacteria | 2904445276 | 2904449337 | 261 |
| 194 | iso_pu_bacteria | 2945997725 | 2946001839 | 261 |
| 195 | iso_pu_bacteria | 2954016120 | 2954018675 | 261 |
| 196 | 3300049570 | Ga0501033_0045421 | Ga0501033_0045421_1978_2775 | 262 |
| 197 | 3300049571 | Ga0501034_0059472 | Ga0501034_0059472_414_1211 | 262 |
| 198 | 3300049571 | Ga0501034_0074425 | Ga0501034_0074425_32_829 | 262 |
| 199 | 3300049823 | Ga0501044_0028857 | Ga0501044_0028857_2450_3247 | 262 |
| 200 | 3300049823 | Ga0501044_0513513 | Ga0501044_0513513_265_1086 | 262 |
| 201 | 3300032004 | Ga0307414_10069935 | Ga0307414_100699352 | 263 |
| 202 | 3300032005 | Ga0307411_10025080 | Ga0307411_100250803 | 263 |
| 203 | 3300003322 | rootL2_10022103 | rootL2_100221036 | 264 |
| 204 | 3300003323 | rootH1_10168334 | rootH1_101683342 | 264 |
| 205 | 3300049758 | Ga0501241_000198 | Ga0501241_000198_2958_3770 | 264 |
| 206 | 2162886007 | SwRhRL2b_contig_785041 | SwRhRL2b_0073.00004290 | 265 |
| 207 | 3300002773 | JGI25152J39213_1000062 | JGI25152J39213_100006252 | 265 |
| 208 | 3300002773 | JGI25152J39213_1001383 | JGI25152J39213_10013834 | 265 |
| 209 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001671 | 265 |
| 210 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001134 | 265 |
| 211 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_1000000123 | 265 |
| 212 | 3300003781 | Ga0055536_1000001 | Ga0055536_1000001145 | 265 |
| 213 | 3300003791 | Ga0055530_10002498 | Ga0055530_100024988 | 265 |
| 214 | 3300005288 | Ga0065714_10064548 | Ga0065714_1006454826 | 265 |
| 215 | 3300005289 | Ga0065704_10000310 | Ga0065704_100003105 | 265 |
| 216 | 3300005563 | Ga0068855_100241826 | Ga0068855_1002418264 | 265 |
| 217 | 3300009036 | Ga0105244_10063883 | Ga0105244_100638832 | 265 |
| 218 | 3300013100 | Ga0157373_10001634 | Ga0157373_100016342 | 265 |
| 219 | 3300013100 | Ga0157373_10090080 | Ga0157373_100900802 | 265 |
| 220 | 3300013102 | Ga0157371_10000021 | Ga0157371_10000021219 | 265 |
| 221 | 3300013102 | Ga0157371_10001425 | Ga0157371_100014253 | 265 |
| 222 | 3300013104 | Ga0157370_10002390 | Ga0157370_1000239012 | 265 |
| 223 | 3300013104 | Ga0157370_10002892 | Ga0157370_1000289214 | 265 |
| 224 | 3300013104 | Ga0157370_10008464 | Ga0157370_100084646 | 265 |
| 225 | 3300013104 | Ga0157370_10216760 | Ga0157370_102167602 | 265 |
| 226 | 3300013105 | Ga0157369_10000008 | Ga0157369_10000008136 | 265 |
| 227 | 3300013306 | Ga0163162_10000206 | Ga0163162_1000020639 | 265 |
| 228 | 3300014497 | Ga0182008_10001392 | Ga0182008_100013927 | 265 |
| 229 | 3300015261 | Ga0182006_1000412 | Ga0182006_100041221 | 265 |
| 230 | 3300015261 | Ga0182006_1000558 | Ga0182006_100055816 | 265 |
| 231 | 3300015261 | Ga0182006_1003901 | Ga0182006_10039014 | 265 |
| 232 | 3300015262 | Ga0182007_10000003 | Ga0182007_10000003127 | 265 |
| 233 | 3300015682 | Ga0183373_1001 | Ga0183373_1001847 | 265 |
| 234 | 3300017792 | Ga0163161_10000453 | Ga0163161_1000045318 | 265 |
| 235 | 3300017792 | Ga0163161_10001588 | Ga0163161_100015889 | 265 |
| 236 | 3300017792 | Ga0163161_10114349 | Ga0163161_101143493 | 265 |
| 237 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002506 | 265 |
| 238 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002506 | 265 |
| 239 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008714 | 265 |
| 240 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004685 | 265 |
| 241 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006685 | 265 |
| 242 | 3300025298 | Ga0209050_1000045 | Ga0209050_100004571 | 265 |
| 243 | 3300028794 | Ga0307515_10031935 | Ga0307515_100319352 | 265 |
| 244 | 3300030744 | Ga0316181_1001436 | Ga0316181_10014362 | 265 |
| 245 | 3300031548 | Ga0307408_100603419 | Ga0307408_1006034191 | 265 |
| 246 | 3300031731 | Ga0307405_10000069 | Ga0307405_100000694 | 265 |
| 247 | 3300031903 | Ga0307407_10000022 | Ga0307407_1000002265 | 265 |
| 248 | 3300031911 | Ga0307412_10000023 | Ga0307412_1000002383 | 265 |
| 249 | 3300032002 | Ga0307416_100000047 | Ga0307416_10000004765 | 265 |
| 250 | 3300032004 | Ga0307414_10009213 | Ga0307414_100092134 | 265 |
| 251 | 3300032004 | Ga0307414_10027099 | Ga0307414_100270992 | 265 |
| 252 | 3300032005 | Ga0307411_10104459 | Ga0307411_101044592 | 265 |
| 253 | 3300046512 | Ga0495610_0000066 | Ga0495610_0000066_28372_29169 | 265 |
| 254 | 3300046512 | Ga0495610_0000463 | Ga0495610_0000463_24760_25557 | 265 |
| 255 | 3300046520 | Ga0495637_0050219 | Ga0495637_0050219_38_835 | 265 |
| 256 | 3300046525 | Ga0495663_0048393 | Ga0495663_0048393_340_1143 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5m34-assembly2.cif.gz_B | structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli | 0.8845 | 21 | 262 |
| 5m2q-assembly1.cif.gz_A | structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli | 0.8799 | 20 | 265 |
| 5m34-assembly1.cif.gz_A | structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli | 0.8762 | 20 | 265 |
| 5m3b-assembly1.cif.gz_A | structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli | 0.8759 | 21 | 265 |
| 5m2q-assembly1.cif.gz_A | structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli | 0.8728 | 20 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3pshA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9 | 3 | 135 | 3.40.50.1980 |
| 5yscA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8974 | 18 | 135 | 3.40.50.1980 |
| 2rg7D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8947 | 20 | 135 | 3.40.50.1980 |
| 3gfvB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8857 | 1 | 146 | 3.40.50.1980 |
| af_Q2G0F6_19_140_3.40.50.1980 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8848 | 20 | 135 | 3.40.50.1980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1ZZL0-F1-model_v4 | Cobalamin-binding protein | 0.9941 | 1 | 135 |
|
| AF-A0A3C0IQU3-F1-model_v4 | Cobalamin-binding protein | 0.99 | 21 | 131 |
|
| AF-A0A519MHR4-F1-model_v4 | Cobalamin-binding protein | 0.9899 | 1 | 146 |
|
| AF-A0A7Y7CIA5-F1-model_v4 | ABC transporter substrate-binding protein | 0.9878 | 3 | 121 |
|
| AF-A0A520CHY8-F1-model_v4 | Cobalamin-binding protein | 0.9877 | 1 | 145 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar