F363592

General Info

Members Datasets Scaffolds Average Seq Length
252 169 246 318

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0048839|Ga0501069_0048839_60_1136
Length 353
Sequence MTGMGSITDVGGIRVGHHHRLDLDATLGSGWASGVTVVLAPPETVGAVDCRGGAPGSRETDLLDPANSVRWVDAVVLSGGSAYGLATADGVMTWLEEQGRGVALDGGVVPIVPAAVIFDLPVGGWDRRPTAQFGYAAGPDGDKPAVGSVGAGVGARAGVFKGGVGTVSATLELGEHTVTVGALVVVNPTGEVIDATTGLPWSAQLVEEFGLTSPPSEQLAVLAGLEPKSLALNTTIAVVATDAALSPAGCRRVAIAAQDGLARTIRPSHTPVDGDTVFALATGAVEVPALPGTPAALSQESGLITAVGAAAADCLARAVLVGLLAADPVAGIPTYRGTLPGAFADRLTGRSWA

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
6 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
88 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
93 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
167 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
168 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.65
Nodule 0.4
Rhizoplane 8.73
Rhizosphere 61.51
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10041715 3300003320 Bacteria 2304
2 Ga0070683_100150271 3300005329 Bacteria 2208
3 Ga0068869_100017354 3300005334 Bacteria 4876
4 Ga0068868_100001656 3300005338 Bacteria 15220
5 Ga0070669_100142405 3300005353 Bacteria 1850
6 Ga0070671_100072274 3300005355 Bacteria 2880
7 Ga0070671_100090692 3300005355 Bacteria 2559
8 Ga0070667_100166452 3300005367 Bacteria 1945
9 Ga0070667_100175687 3300005367 Bacteria 1893
10 Ga0070714_100043501 3300005435 Bacteria 3799
11 Ga0070711_100059928 3300005439 Bacteria 2644
12 Ga0070705_100022376 3300005440 Bacteria 3377
13 Ga0068853_100059326 3300005539 Bacteria 3305
14 Ga0070665_100037186 3300005548 Bacteria 4897
15 Ga0068864_100241812 3300005618 Bacteria 1673
16 Ga0068861_100055473 3300005719 Bacteria 3021
17 Ga0068863_100002589 3300005841 Bacteria 17925
18 Ga0068858_100090132 3300005842 Bacteria 2853
19 Ga0068858_100099601 3300005842 Bacteria 2710
20 Ga0068860_100157854 3300005843 Bacteria 2186
21 Ga0081455_10003425 3300005937 Bacteria 18237
22 Ga0075365_10051850 3300006038 Bacteria 2711
23 Ga0075363_100003755 3300006048 Bacteria 6538
24 Ga0075363_100025196 3300006048 Bacteria 3030
25 Ga0075363_100030783 3300006048 Bacteria 2779
26 Ga0075364_10001876 3300006051 Bacteria 11671
27 Ga0075364_10004203 3300006051 Bacteria 8261
28 Ga0075364_10006317 3300006051 Bacteria 6963
29 Ga0075364_10007295 3300006051 Bacteria 6559
30 Ga0075364_10019749 3300006051 Bacteria 4232
31 Ga0075364_10093176 3300006051 Bacteria 2000
32 Ga0070716_100209610 3300006173 Bacteria 1301
33 Ga0070712_100030237 3300006175 Bacteria 3638
34 Ga0075362_10017572 3300006177 Bacteria 2949
35 Ga0075367_10014876 3300006178 Bacteria 4216
36 Ga0075369_10003054 3300006186 Bacteria 6061
37 Ga0075369_10074651 3300006186 Bacteria 1496
38 Ga0075370_10002379 3300006353 Bacteria 8704
39 Ga0075370_10005380 3300006353 Bacteria 6357
40 Ga0075370_10005607 3300006353 Bacteria 6261
41 Ga0075370_10141698 3300006353 Bacteria 1406
42 Ga0075370_10172744 3300006353 Bacteria 1271
43 Ga0068871_100214309 3300006358 Bacteria 1667
44 Ga0075428_100132112 3300006844 Bacteria 2715
45 Ga0068865_100036434 3300006881 Bacteria 3317
46 Ga0105240_10001499 3300009093 Bacteria 39756
47 Ga0105240_10282019 3300009093 Bacteria 1908
48 Ga0105245_10101586 3300009098 Bacteria 2662
49 Ga0114129_10007725 3300009147 Bacteria 15299
50 Ga0114129_10020644 3300009147 Bacteria 9365
51 Ga0114129_10023954 3300009147 Bacteria 8651
52 Ga0114129_10511472 3300009147 Bacteria 1567
53 Ga0105243_10002404 3300009148 Bacteria 15689
54 Ga0105243_10081467 3300009148 Bacteria 2643
55 Ga0105237_10001807 3300009545 Bacteria 27611
56 Ga0105249_10005596 3300009553 Bacteria 10866
57 Ga0105239_10000361 3300010375 Bacteria 66473
58 Ga0105239_10013051 3300010375 Bacteria 9235
59 Ga0157374_10042403 3300013296 Bacteria 4197
60 Ga0157378_10176070 3300013297 Bacteria 2009
61 Ga0163162_10438445 3300013306 Bacteria 1438
62 Ga0157375_10243756 3300013308 Bacteria 1957
63 Ga0163163_10082729 3300014325 Bacteria 3214
64 Ga0157377_10008947 3300014745 Bacteria 4900
65 Ga0157379_10016757 3300014968 Bacteria 6449
66 Ga0213876_10015392 3300021384 Bacteria 4048
67 Ga0213875_10000077 3300021388 Bacteria 116884
68 Ga0213875_10078520 3300021388 Bacteria 1540
69 Ga0207656_10040786 3300025321 Bacteria 1969
70 Ga0207688_10001098 3300025901 Bacteria 13865
71 Ga0207680_10147933 3300025903 Bacteria 1564
72 Ga0207699_10067055 3300025906 Bacteria 2180
73 Ga0207695_10012376 3300025913 Bacteria 10246
74 Ga0207671_10003745 3300025914 Bacteria 14977
75 Ga0207693_10004004 3300025915 Bacteria 12528
76 Ga0207687_10035551 3300025927 Bacteria 3389
77 Ga0207664_10193675 3300025929 Bacteria 1751
78 Ga0207644_10040043 3300025931 Bacteria 3310
79 Ga0207644_10056653 3300025931 Bacteria 2829
80 Ga0207709_10014578 3300025935 Bacteria 4343
81 Ga0207669_10104940 3300025937 Bacteria 1878
82 Ga0207704_10302886 3300025938 Bacteria 1225
83 Ga0207665_10047498 3300025939 Bacteria 2878
84 Ga0207665_10202510 3300025939 Bacteria 1447
85 Ga0207689_10029025 3300025942 Bacteria 4624
86 Ga0207651_10219198 3300025960 Bacteria 1537
87 Ga0207668_10279942 3300025972 Bacteria 1367
88 Ga0207658_10061787 3300025986 Bacteria 2801
89 Ga0207658_10154903 3300025986 Bacteria 1871
90 Ga0207658_10248411 3300025986 Bacteria 1511
91 Ga0207677_10154065 3300026023 Bacteria 1777
92 Ga0207639_10120647 3300026041 Bacteria 2153
93 Ga0207678_10082394 3300026067 Bacteria 2752
94 Ga0207708_10020786 3300026075 Bacteria 4952
95 Ga0207641_10028650 3300026088 Bacteria 4602
96 Ga0207676_10281999 3300026095 Bacteria 1509
97 Ga0207683_10100656 3300026121 Bacteria 2580
98 Ga0268266_10022185 3300028379 Bacteria 5411
99 Ga0268266_10025446 3300028379 Bacteria 5035
100 Ga0265320_10040361 3300031240 Bacteria 2328
101 Ga0307405_10054617 3300031731 Bacteria 2495
102 Ga0307413_10150616 3300031824 Bacteria 1620
103 Ga0307413_10281041 3300031824 Bacteria 1252
104 Ga0307410_10007872 3300031852 Bacteria 5868
105 Ga0307407_10044930 3300031903 Bacteria 2493
106 Ga0307412_10156877 3300031911 Bacteria 1686
107 Ga0307414_10167056 3300032004 Bacteria 1755
108 Ga0307415_100014779 3300032126 Bacteria 4602
109 Ga0373952_0016540 3300035092 Bacteria 1502
110 Ga0373962_0019828 3300035242 Bacteria 1762
111 Ga0373931_0044104 3300035691 Bacteria 2351
112 Ga0436364_0024756 3300037853 Bacteria 185423
113 Ga0436364_0548793 3300037853 Bacteria 1395
114 Ga0436364_1462378 3300037853 Bacteria 2414
115 Ga0436365_0790116 3300039437 Bacteria 10062
116 Ga0436365_1876162 3300039437 Bacteria 22108
117 Ga0439461_0000528 3300041410 Bacteria 5540
118 Ga0439466_0022728 3300041411 Bacteria 2211
119 Ga0439434_0010379 3300042435 Bacteria 2745
120 Ga0466969_0025364 3300044656 Bacteria 3049
121 Ga0466972_0006614 3300044658 Bacteria 5821
122 Ga0466972_0050988 3300044658 Bacteria 1997
123 Ga0466965_0000101 3300044683 Bacteria 24867
124 Ga0466965_0003212 3300044683 Bacteria 7145
125 Ga0466965_0087757 3300044683 Bacteria 1579
126 Ga0466966_0061473 3300044684 Bacteria 2369
127 Ga0466966_0090633 3300044684 Bacteria 1898
128 Ga0466961_0053941 3300044693 Bacteria 2565
129 Ga0466963_0049725 3300044694 Bacteria 2774
130 Ga0466963_0067078 3300044694 Bacteria 2407
131 Ga0466971_0020128 3300044719 Bacteria 2966
132 Ga0466971_0029124 3300044719 Bacteria 2469
133 Ga0466968_0006662 3300044735 Bacteria 4363
134 Ga0466968_0025669 3300044735 Bacteria 2414
135 Ga0466970_0074024 3300044765 Bacteria 1833
136 Ga0466957_0027706 3300044842 Bacteria 3369
137 Ga0466957_0180577 3300044842 Bacteria 1378
138 Ga0466960_0000036 3300044901 Bacteria 43705
139 Ga0466959_0011751 3300045049 Bacteria 6302
140 Ga0466959_0083486 3300045049 Bacteria 2300
141 Ga0466958_0005998 3300045836 Bacteria 6580
142 Ga0466958_0114423 3300045836 Bacteria 1685
143 Ga0466967_0001196 3300045976 Bacteria 14597
144 Ga0466967_0005126 3300045976 Bacteria 9006
145 Ga0466967_0060441 3300045976 Bacteria 3358
146 Ga0466967_0066229 3300045976 Bacteria 3218
147 Ga0495638_0090751 3300046460 Bacteria 1841
148 Ga0495648_0007097 3300046524 Bacteria 9019
149 Ga0495642_0058344 3300046528 Bacteria 1598
150 Ga0495668_0022744 3300046616 Bacteria 3582
151 Ga0495611_0010067 3300046648 Bacteria 4002
152 Ga0495671_0078173 3300046692 Bacteria 1622
153 Ga0495649_0082350 3300046694 Bacteria 1720
154 Ga0495672_0007484 3300047320 Bacteria 8207
155 Ga0495672_0095166 3300047320 Bacteria 1627
156 Ga0495672_0107320 3300047320 Bacteria 1504
157 Ga0495673_0002803 3300047469 Bacteria 11901
158 Ga0496100_0011318 3300048903 Bacteria 5076
159 Ga0496100_0067027 3300048903 Bacteria 2383
160 Ga0496101_0000024 3300048904 Bacteria 205570
161 Ga0496102_0000001 3300048905 Bacteria 873433
162 Ga0496102_0093423 3300048905 Bacteria 2787
163 Ga0496102_0099409 3300048905 Bacteria 2700
164 Ga0496102_0206265 3300048905 Bacteria 1853
165 Ga0496103_0000003 3300048906 Bacteria 603967
166 Ga0496103_0186864 3300048906 Bacteria 1332
167 Ga0496104_0028179 3300048907 Bacteria 5205
168 Ga0496104_0475986 3300048907 Bacteria 1160
169 Ga0496105_0030920 3300048908 Bacteria 4389
170 Ga0496106_0006795 3300048909 Bacteria 8469
171 Ga0496106_0030193 3300048909 Bacteria 4041
172 Ga0496106_0068339 3300048909 Bacteria 2710
173 Ga0496108_0000821 3300048911 Bacteria 24144
174 Ga0496108_0014545 3300048911 Bacteria 6425
175 Ga0496109_0013704 3300048912 Bacteria 7042
176 Ga0496111_0296956 3300048914 Bacteria 1198
177 Ga0496112_0001749 3300048915 Bacteria 17020
178 Ga0496112_0007820 3300048915 Bacteria 9515
179 Ga0496113_0029807 3300048916 Bacteria 3944
180 Ga0496116_0000013 3300048919 Bacteria 603993
181 Ga0496117_0000013 3300048920 Bacteria 603995
182 Ga0496118_0000011 3300048921 Bacteria 603995
183 Ga0496118_0000236 3300048921 Bacteria 97321
184 Ga0496120_0024333 3300048923 Bacteria 3777
185 Ga0496121_0000072 3300048924 Bacteria 244975
186 Ga0496121_0000764 3300048924 Bacteria 59030
187 Ga0496122_0102883 3300048925 Bacteria 1902
188 Ga0496123_0006986 3300048926 Bacteria 10765
189 Ga0496126_0000351 3300048929 Bacteria 96459
190 Ga0496126_0001675 3300048929 Bacteria 33240
191 Ga0496126_0003822 3300048929 Bacteria 18656
192 Ga0496126_0006287 3300048929 Bacteria 13261
193 Ga0501032_0007990 3300049569 Bacteria 7710
194 Ga0501033_0006096 3300049570 Bacteria 9456
195 Ga0501033_0024999 3300049570 Bacteria 4501
196 Ga0501034_0055112 3300049571 Bacteria 4001
197 Ga0501036_0017528 3300049572 Bacteria 5989
198 Ga0501037_0104308 3300049573 Bacteria 2044
199 Ga0501038_0045835 3300049574 Bacteria 3794
200 Ga0501043_0013011 3300049579 Bacteria 6505
201 Ga0501043_0138936 3300049579 Bacteria 1903
202 Ga0501046_0001119 3300049580 Bacteria 26186
203 Ga0501047_0019629 3300049581 Bacteria 6485
204 Ga0501048_0007722 3300049582 Bacteria 8153
205 Ga0501048_0225031 3300049582 Bacteria 1331
206 Ga0501069_0048839 3300049585 Bacteria 2351
207 Ga0501069_0053587 3300049585 Bacteria 2246
208 Ga0501070_0001404 3300049586 Bacteria 21565
209 Ga0501080_0005886 3300049742 Bacteria 10986
210 Ga0501035_0001268 3300049822 Bacteria 26187
211 Ga0501035_0049202 3300049822 Bacteria 3778
212 Ga0501044_0001501 3300049823 Bacteria 27346
213 Ga0501044_0001737 3300049823 Bacteria 25445
214 nmdc:mga03683_13638_c1 3300050489 Bacteria 2995
215 nmdc:mga03n38_16103_c1 3300050490 Bacteria 2903
216 nmdc:mga03n38_2920_c1 3300050490 Bacteria 5391
217 nmdc:mga03n38_42486_c1 3300050490 Bacteria 1987
218 nmdc:mga03n38_46200_c1 3300050490 Bacteria 1921
219 nmdc:mga03n38_51674_c1 3300050490 Bacteria 1836
220 nmdc:mga03n38_764_c1 3300050490 Bacteria 8520
221 nmdc:mga00v17_69832_c1 3300050491 Bacteria 2175
222 nmdc:mga00v17_87085_c1 3300050491 Bacteria 1958
223 nmdc:mga0yw44_185582_c1 3300050492 Bacteria 1370
224 nmdc:mga0yw44_58146_c1 3300050492 Bacteria 2361
225 nmdc:mga07m45_34791_c1 3300050496 Bacteria 2801
226 nmdc:mga05p37_183658_c1 3300050507 Bacteria 2543
227 nmdc:mga05p37_407630_c1 3300050507 Bacteria 1585
228 nmdc:mga05p37_7636_c1 3300050507 Bacteria 12760
229 nmdc:mga0rr50_365870_c1 3300050513 Bacteria 1214
230 nmdc:mga0sz30_1023_c1 3300050516 Bacteria 10045
231 nmdc:mga0sz30_1344_c1 3300050516 Bacteria 3775
232 nmdc:mga0sz30_17611_c1 3300050516 Bacteria 2851
233 nmdc:mga0sz30_18913_c1 3300050516 Bacteria 2761
234 nmdc:mga0sz30_3242_c1 3300050516 Bacteria 5376
235 nmdc:mga0sz30_39520_c1 3300050516 Bacteria 1980
236 Ga0500635_0005955 3300053080 Bacteria 3234
237 Ga0500643_000307 3300053087 Bacteria 40351
238 Ga0500643_014796 3300053087 Bacteria 2695
239 Ga0500594_0006158 3300053118 Bacteria 2688
240 Ga0500559_0000385 3300053136 Bacteria 32342
241 Ga0500573_0000015 3300053140 Bacteria 192264
242 Ga0500627_0002692 3300053158 Bacteria 5324
243 Ga0500645_000013 3300053730 Bacteria 154598
244 Ga0500645_024992 3300053730 Bacteria 1823
245 Ga0500661_001315 3300055283 Bacteria 4627
246 Ga0466962_0140922 3300061719 Bacteria 1168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10007725 Ga0114129_100077254 238
2 3300050507 nmdc:mga05p37_7636_c1 nmdc:mga05p37_7636_c1_10219_11118 238
3 3300048907 Ga0496104_0475986 Ga0496104_0475986_16_849 241
4 3300053140 Ga0500573_0000015 Ga0500573_0000015_173309_174310 248
5 3300009147 Ga0114129_10020644 Ga0114129_100206445 249
6 3300021388 Ga0213875_10000077 Ga0213875_1000007744 260
7 3300037853 Ga0436364_0024756 Ga0436364_0024756_85487_86497 260
8 3300009147 Ga0114129_10511472 Ga0114129_105114721 266
9 3300050507 nmdc:mga05p37_407630_c1 nmdc:mga05p37_407630_c1_206_1225 266
10 3300009093 Ga0105240_10001499 Ga0105240_1000149910 267
11 3300010375 Ga0105239_10000361 Ga0105239_1000036130 267
12 3300025913 Ga0207695_10012376 Ga0207695_100123767 267
13 3300048924 Ga0496121_0000072 Ga0496121_0000072_61835_62818 267
14 3300048929 Ga0496126_0006287 Ga0496126_0006287_6142_7125 267
15 3300009093 Ga0105240_10282019 Ga0105240_102820192 268
16 3300046692 Ga0495671_0078173 Ga0495671_0078173_235_1248 268
17 3300053087 Ga0500643_000307 Ga0500643_000307_18229_19233 268
18 3300053118 Ga0500594_0006158 Ga0500594_0006158_111_1124 268
19 3300053136 Ga0500559_0000385 Ga0500559_0000385_11524_12528 268
20 3300055283 Ga0500661_001315 Ga0500661_001315_65_1069 268
21 3300031240 Ga0265320_10040361 Ga0265320_100403612 270
22 3300053730 Ga0500645_000013 Ga0500645_000013_127345_128379 282
23 3300044656 Ga0466969_0025364 Ga0466969_0025364_34_999 283
24 3300046460 Ga0495638_0090751 Ga0495638_0090751_524_1561 284
25 3300005937 Ga0081455_10003425 Ga0081455_100034252 285
26 3300050492 nmdc:mga0yw44_185582_c1 nmdc:mga0yw44_185582_c1_361_1359 288
27 3300048926 Ga0496123_0006986 Ga0496123_0006986_7470_8531 289
28 3300048929 Ga0496126_0001675 Ga0496126_0001675_6076_7137 289
29 3300053730 Ga0500645_024992 Ga0500645_024992_673_1710 289
30 3300025986 Ga0207658_10248411 Ga0207658_102484112 290
31 3300047320 Ga0495672_0107320 Ga0495672_0107320_343_1380 290
32 3300048903 Ga0496100_0067027 Ga0496100_0067027_1053_2114 291
33 3300048915 Ga0496112_0001749 Ga0496112_0001749_9402_10463 291
34 3300048916 Ga0496113_0029807 Ga0496113_0029807_196_1257 291
35 3300048925 Ga0496122_0102883 Ga0496122_0102883_264_1325 291
36 3300005329 Ga0070683_100150271 Ga0070683_1001502712 296
37 3300006173 Ga0070716_100209610 Ga0070716_1002096102 297
38 3300025939 Ga0207665_10202510 Ga0207665_102025102 297
39 3300050516 nmdc:mga0sz30_1023_c1 nmdc:mga0sz30_1023_c1_7064_8086 297
40 3300050516 nmdc:mga0sz30_1344_c1 nmdc:mga0sz30_1344_c1_2643_3662 297
41 3300031824 Ga0307413_10150616 Ga0307413_101506162 298
42 3300031852 Ga0307410_10007872 Ga0307410_100078725 298
43 3300031903 Ga0307407_10044930 Ga0307407_100449302 298
44 3300031911 Ga0307412_10156877 Ga0307412_101568771 298
45 3300032004 Ga0307414_10167056 Ga0307414_101670562 298
46 3300032126 Ga0307415_100014779 Ga0307415_1000147796 298
47 3300047320 Ga0495672_0095166 Ga0495672_0095166_379_1392 298
48 3300050513 nmdc:mga0rr50_365870_c1 nmdc:mga0rr50_365870_c1_139_1188 298
49 3300006048 Ga0075363_100003755 Ga0075363_1000037554 299
50 3300006048 Ga0075363_100025196 Ga0075363_1000251964 299
51 3300006048 Ga0075363_100030783 Ga0075363_1000307832 299
52 3300006051 Ga0075364_10001876 Ga0075364_100018767 299
53 3300006051 Ga0075364_10007295 Ga0075364_100072957 299
54 3300006051 Ga0075364_10019749 Ga0075364_100197494 299
55 3300006177 Ga0075362_10017572 Ga0075362_100175724 299
56 3300006178 Ga0075367_10014876 Ga0075367_100148762 299
57 3300006353 Ga0075370_10002379 Ga0075370_100023798 299
58 3300006353 Ga0075370_10005380 Ga0075370_100053806 299
59 3300006844 Ga0075428_100132112 Ga0075428_1001321124 299
60 3300009147 Ga0114129_10023954 Ga0114129_100239547 299
61 3300031824 Ga0307413_10281041 Ga0307413_102810411 299
62 3300041411 Ga0439466_0022728 Ga0439466_0022728_1179_2198 299
63 3300044658 Ga0466972_0050988 Ga0466972_0050988_465_1484 299
64 3300044683 Ga0466965_0000101 Ga0466965_0000101_7508_8527 299
65 3300044842 Ga0466957_0027706 Ga0466957_0027706_707_1726 299
66 3300044901 Ga0466960_0000036 Ga0466960_0000036_17296_18315 299
67 3300050489 nmdc:mga03683_13638_c1 nmdc:mga03683_13638_c1_1633_2652 299
68 3300050490 nmdc:mga03n38_2920_c1 nmdc:mga03n38_2920_c1_2582_3610 299
69 3300050490 nmdc:mga03n38_42486_c1 nmdc:mga03n38_42486_c1_762_1781 299
70 3300050490 nmdc:mga03n38_46200_c1 nmdc:mga03n38_46200_c1_639_1664 299
71 3300050490 nmdc:mga03n38_764_c1 nmdc:mga03n38_764_c1_4838_5857 299
72 3300050491 nmdc:mga00v17_87085_c1 nmdc:mga00v17_87085_c1_335_1360 299
73 3300050492 nmdc:mga0yw44_58146_c1 nmdc:mga0yw44_58146_c1_286_1311 299
74 3300050496 nmdc:mga07m45_34791_c1 nmdc:mga07m45_34791_c1_1394_2422 299
75 3300050507 nmdc:mga05p37_183658_c1 nmdc:mga05p37_183658_c1_853_1872 299
76 3300050516 nmdc:mga0sz30_18913_c1 nmdc:mga0sz30_18913_c1_70_1089 299
77 3300005338 Ga0068868_100001656 Ga0068868_10000165614 300
78 3300006051 Ga0075364_10093176 Ga0075364_100931762 300
79 3300009148 Ga0105243_10002404 Ga0105243_100024047 300
80 3300009553 Ga0105249_10005596 Ga0105249_100055967 300
81 3300025939 Ga0207665_10047498 Ga0207665_100474981 300
82 3300044683 Ga0466965_0087757 Ga0466965_0087757_50_1081 300
83 3300050490 nmdc:mga03n38_51674_c1 nmdc:mga03n38_51674_c1_798_1817 300
84 3300050516 nmdc:mga0sz30_17611_c1 nmdc:mga0sz30_17611_c1_1777_2796 300
85 iso_pu_bacteria 2842134933 2842140161 300
86 3300006881 Ga0068865_100036434 Ga0068865_1000364342 301
87 3300009148 Ga0105243_10081467 Ga0105243_100814673 301
88 3300013297 Ga0157378_10176070 Ga0157378_101760702 301
89 3300013306 Ga0163162_10438445 Ga0163162_104384451 301
90 3300025906 Ga0207699_10067055 Ga0207699_100670554 301
91 3300025929 Ga0207664_10193675 Ga0207664_101936752 301
92 3300025935 Ga0207709_10014578 Ga0207709_100145784 301
93 3300025937 Ga0207669_10104940 Ga0207669_101049401 301
94 3300025938 Ga0207704_10302886 Ga0207704_103028861 301
95 3300035092 Ga0373952_0016540 Ga0373952_0016540_348_1367 301
96 3300035242 Ga0373962_0019828 Ga0373962_0019828_510_1529 301
97 3300035691 Ga0373931_0044104 Ga0373931_0044104_485_1504 301
98 3300046694 Ga0495649_0082350 Ga0495649_0082350_307_1335 301
99 3300048909 Ga0496106_0006795 Ga0496106_0006795_1393_2412 301
100 3300049569 Ga0501032_0007990 Ga0501032_0007990_593_1642 301
101 3300049570 Ga0501033_0006096 Ga0501033_0006096_6020_7069 301
102 3300049571 Ga0501034_0055112 Ga0501034_0055112_323_1372 301
103 3300049572 Ga0501036_0017528 Ga0501036_0017528_1913_2962 301
104 3300049573 Ga0501037_0104308 Ga0501037_0104308_909_1958 301
105 3300049574 Ga0501038_0045835 Ga0501038_0045835_748_1797 301
106 3300049579 Ga0501043_0013011 Ga0501043_0013011_2973_4022 301
107 3300049580 Ga0501046_0001119 Ga0501046_0001119_19824_20873 301
108 3300049581 Ga0501047_0019629 Ga0501047_0019629_4747_5796 301
109 3300049582 Ga0501048_0007722 Ga0501048_0007722_4112_5161 301
110 3300049585 Ga0501069_0053587 Ga0501069_0053587_311_1360 301
111 3300049586 Ga0501070_0001404 Ga0501070_0001404_20008_21057 301
112 3300049742 Ga0501080_0005886 Ga0501080_0005886_4334_5383 301
113 3300049822 Ga0501035_0049202 Ga0501035_0049202_323_1372 301
114 3300049823 Ga0501044_0001501 Ga0501044_0001501_20008_21057 301
115 3300005334 Ga0068869_100017354 Ga0068869_1000173543 302
116 3300005353 Ga0070669_100142405 Ga0070669_1001424052 302
117 3300005355 Ga0070671_100072274 Ga0070671_1000722744 302
118 3300005355 Ga0070671_100090692 Ga0070671_1000906922 302
119 3300005367 Ga0070667_100166452 Ga0070667_1001664522 302
120 3300005367 Ga0070667_100175687 Ga0070667_1001756872 302
121 3300005439 Ga0070711_100059928 Ga0070711_1000599282 302
122 3300005440 Ga0070705_100022376 Ga0070705_1000223762 302
123 3300005539 Ga0068853_100059326 Ga0068853_1000593264 302
124 3300005548 Ga0070665_100037186 Ga0070665_1000371865 302
125 3300005618 Ga0068864_100241812 Ga0068864_1002418123 302
126 3300005719 Ga0068861_100055473 Ga0068861_1000554734 302
127 3300005841 Ga0068863_100002589 Ga0068863_10000258914 302
128 3300005842 Ga0068858_100090132 Ga0068858_1000901324 302
129 3300005843 Ga0068860_100157854 Ga0068860_1001578542 302
130 3300006038 Ga0075365_10051850 Ga0075365_100518503 302
131 3300006051 Ga0075364_10004203 Ga0075364_100042037 302
132 3300006175 Ga0070712_100030237 Ga0070712_1000302374 302
133 3300006186 Ga0075369_10074651 Ga0075369_100746512 302
134 3300006353 Ga0075370_10141698 Ga0075370_101416981 302
135 3300006353 Ga0075370_10172744 Ga0075370_101727442 302
136 3300006358 Ga0068871_100214309 Ga0068871_1002143092 302
137 3300009098 Ga0105245_10101586 Ga0105245_101015864 302
138 3300013296 Ga0157374_10042403 Ga0157374_100424034 302
139 3300013308 Ga0157375_10243756 Ga0157375_102437562 302
140 3300014325 Ga0163163_10082729 Ga0163163_100827294 302
141 3300014745 Ga0157377_10008947 Ga0157377_100089475 302
142 3300014968 Ga0157379_10016757 Ga0157379_100167576 302
143 3300025321 Ga0207656_10040786 Ga0207656_100407861 302
144 3300025901 Ga0207688_10001098 Ga0207688_100010987 302
145 3300025903 Ga0207680_10147933 Ga0207680_101479332 302
146 3300025915 Ga0207693_10004004 Ga0207693_100040047 302
147 3300025927 Ga0207687_10035551 Ga0207687_100355512 302
148 3300025931 Ga0207644_10040043 Ga0207644_100400432 302
149 3300025931 Ga0207644_10056653 Ga0207644_100566532 302
150 3300025942 Ga0207689_10029025 Ga0207689_100290255 302
151 3300025960 Ga0207651_10219198 Ga0207651_102191982 302
152 3300025986 Ga0207658_10061787 Ga0207658_100617873 302
153 3300025986 Ga0207658_10154903 Ga0207658_101549032 302
154 3300026023 Ga0207677_10154065 Ga0207677_101540652 302
155 3300026041 Ga0207639_10120647 Ga0207639_101206473 302
156 3300026067 Ga0207678_10082394 Ga0207678_100823942 302
157 3300026075 Ga0207708_10020786 Ga0207708_100207865 302
158 3300026088 Ga0207641_10028650 Ga0207641_100286505 302
159 3300026095 Ga0207676_10281999 Ga0207676_102819992 302
160 3300026121 Ga0207683_10100656 Ga0207683_101006564 302
161 3300028379 Ga0268266_10022185 Ga0268266_100221855 302
162 3300028379 Ga0268266_10025446 Ga0268266_100254464 302
163 3300048905 Ga0496102_0093423 Ga0496102_0093423_1691_2710 302
164 3300048907 Ga0496104_0028179 Ga0496104_0028179_2443_3462 302
165 3300048908 Ga0496105_0030920 Ga0496105_0030920_3184_4203 302
166 3300048911 Ga0496108_0000821 Ga0496108_0000821_6587_7606 302
167 3300048912 Ga0496109_0013704 Ga0496109_0013704_5931_7007 302
168 3300050490 nmdc:mga03n38_16103_c1 nmdc:mga03n38_16103_c1_1455_2474 302
169 3300050491 nmdc:mga00v17_69832_c1 nmdc:mga00v17_69832_c1_647_1666 302
170 3300050516 nmdc:mga0sz30_3242_c1 nmdc:mga0sz30_3242_c1_717_1736 302
171 3300053080 Ga0500635_0005955 Ga0500635_0005955_1146_2180 302
172 3300053087 Ga0500643_014796 Ga0500643_014796_164_1201 302
173 3300053158 Ga0500627_0002692 Ga0500627_0002692_3482_4519 302
174 iso_pu_bacteria 2738541274 2738707753 302
175 iso_pu_bacteria 2738543028 2739334093 302
176 3300005435 Ga0070714_100043501 Ga0070714_1000435014 303
177 3300025972 Ga0207668_10279942 Ga0207668_102799422 303
178 3300048911 Ga0496108_0014545 Ga0496108_0014545_256_1275 303
179 3300048914 Ga0496111_0296956 Ga0496111_0296956_117_1136 303
180 3300048915 Ga0496112_0007820 Ga0496112_0007820_4015_5034 303
181 3300048929 Ga0496126_0003822 Ga0496126_0003822_9939_10970 303
182 3300049585 Ga0501069_0048839 Ga0501069_0048839_60_1136 303
183 iso_pu_bacteria 2902799365 2902801977 303
184 3300021384 Ga0213876_10015392 Ga0213876_100153924 304
185 3300021388 Ga0213875_10078520 Ga0213875_100785202 304
186 3300037853 Ga0436364_1462378 Ga0436364_1462378_1087_2142 304
187 3300039437 Ga0436365_0790116 Ga0436365_0790116_4911_5966 304
188 3300044694 Ga0466963_0049725 Ga0466963_0049725_1374_2432 304
189 3300044694 Ga0466963_0067078 Ga0466963_0067078_393_1430 304
190 3300044719 Ga0466971_0020128 Ga0466971_0020128_749_1786 304
191 3300045836 Ga0466958_0114423 Ga0466958_0114423_253_1290 304
192 3300045976 Ga0466967_0001196 Ga0466967_0001196_7188_8246 304
193 3300045976 Ga0466967_0005126 Ga0466967_0005126_4638_5675 304
194 3300045976 Ga0466967_0060441 Ga0466967_0060441_1474_2523 304
195 3300046524 Ga0495648_0007097 Ga0495648_0007097_4526_5572 304
196 3300046528 Ga0495642_0058344 Ga0495642_0058344_84_1130 304
197 3300046616 Ga0495668_0022744 Ga0495668_0022744_2482_3528 304
198 3300046648 Ga0495611_0010067 Ga0495611_0010067_523_1569 304
199 3300047320 Ga0495672_0007484 Ga0495672_0007484_2472_3518 304
200 3300047469 Ga0495673_0002803 Ga0495673_0002803_9192_10238 304
201 3300061719 Ga0466962_0140922 Ga0466962_0140922_19_1056 304
202 3300006186 Ga0075369_10003054 Ga0075369_100030549 305
203 3300006353 Ga0075370_10005607 Ga0075370_100056078 305
204 3300009545 Ga0105237_10001807 Ga0105237_100018074 305
205 3300010375 Ga0105239_10013051 Ga0105239_100130517 305
206 3300025914 Ga0207671_10003745 Ga0207671_100037457 305
207 3300037853 Ga0436364_0548793 Ga0436364_0548793_83_1153 305
208 3300044684 Ga0466966_0061473 Ga0466966_0061473_344_1375 305
209 3300044693 Ga0466961_0053941 Ga0466961_0053941_943_1974 305
210 3300044719 Ga0466971_0029124 Ga0466971_0029124_1025_2059 305
211 3300045049 Ga0466959_0011751 Ga0466959_0011751_4715_5746 305
212 3300045836 Ga0466958_0005998 Ga0466958_0005998_4494_5525 305
213 3300048903 Ga0496100_0011318 Ga0496100_0011318_124_1161 305
214 3300048904 Ga0496101_0000024 Ga0496101_0000024_57705_58742 305
215 3300048905 Ga0496102_0000001 Ga0496102_0000001_814203_815240 305
216 3300048905 Ga0496102_0099409 Ga0496102_0099409_484_1539 305
217 3300048906 Ga0496103_0000003 Ga0496103_0000003_545265_546302 305
218 3300048906 Ga0496103_0186864 Ga0496103_0186864_152_1207 305
219 3300048909 Ga0496106_0068339 Ga0496106_0068339_408_1445 305
220 3300048919 Ga0496116_0000013 Ga0496116_0000013_57692_58729 305
221 3300048920 Ga0496117_0000013 Ga0496117_0000013_545265_546302 305
222 3300048921 Ga0496118_0000011 Ga0496118_0000011_57694_58731 305
223 3300048921 Ga0496118_0000236 Ga0496118_0000236_23341_24396 305
224 3300048923 Ga0496120_0024333 Ga0496120_0024333_1018_2055 305
225 3300048924 Ga0496121_0000764 Ga0496121_0000764_53039_54076 305
226 3300048929 Ga0496126_0000351 Ga0496126_0000351_53338_54375 305
227 3300050516 nmdc:mga0sz30_39520_c1 nmdc:mga0sz30_39520_c1_400_1449 305
228 iso_pu_bacteria 2643221715 2644635983 305
229 iso_pu_bacteria 2902810491 2902811935 305
230 3300003320 rootH2_10041715 rootH2_100417152 306
231 3300005842 Ga0068858_100099601 Ga0068858_1000996013 306
232 3300006051 Ga0075364_10006317 Ga0075364_100063174 306
233 3300031731 Ga0307405_10054617 Ga0307405_100546174 306
234 3300039437 Ga0436365_1876162 Ga0436365_1876162_14723_15778 306
235 3300041410 Ga0439461_0000528 Ga0439461_0000528_535_1581 306
236 3300042435 Ga0439434_0010379 Ga0439434_0010379_443_1489 306
237 3300044658 Ga0466972_0006614 Ga0466972_0006614_3682_4722 306
238 3300044683 Ga0466965_0003212 Ga0466965_0003212_3810_4850 306
239 3300044684 Ga0466966_0090633 Ga0466966_0090633_357_1391 306
240 3300044735 Ga0466968_0006662 Ga0466968_0006662_959_1999 306
241 3300044735 Ga0466968_0025669 Ga0466968_0025669_611_1645 306
242 3300044765 Ga0466970_0074024 Ga0466970_0074024_428_1462 306
243 3300044842 Ga0466957_0180577 Ga0466957_0180577_325_1359 306
244 3300045049 Ga0466959_0083486 Ga0466959_0083486_885_1919 306
245 3300045976 Ga0466967_0066229 Ga0466967_0066229_785_1825 306
246 3300048905 Ga0496102_0206265 Ga0496102_0206265_379_1422 306
247 3300048909 Ga0496106_0030193 Ga0496106_0030193_1596_2639 306
248 3300049570 Ga0501033_0024999 Ga0501033_0024999_3085_4125 306
249 3300049579 Ga0501043_0138936 Ga0501043_0138936_593_1633 306
250 3300049582 Ga0501048_0225031 Ga0501048_0225031_49_1089 306
251 3300049822 Ga0501035_0001268 Ga0501035_0001268_20357_21397 306
252 3300049823 Ga0501044_0001737 Ga0501044_0001737_19670_20710 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03576

Peptidase_S58

Peptidase family S58

5

336

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihd-assembly1.cif.gz_A crystal structure of uncleaved thnt t282c, derivatized at the active site with ethg 0.758 2 284
4ihe-assembly2.cif.gz_B crystal structure of uncleaved thnt t282a 0.7556 2 284
3s3u-assembly1.cif.gz_A crystal structure of uncleaved thnt t282c 0.7336 2 298
4ihe-assembly1.cif.gz_A crystal structure of uncleaved thnt t282a 0.7304 2 298
3tm1-assembly1.cif.gz_A crystal structure of mature thnt, a pantetheine hydrolase 0.7167 2 298
ID Description Score Start End Superfamily
af_P9WM23_1_341_3.60.70.12 Alpha Beta;4-Layer Sandwich;L-amino peptidase D-ALA esterase/amidase;L-amino peptidase D-ALA esterase/amidase 0.7922 1 300 3.60.70.12
af_P9WM23_1_341_3.60.70.12 Alpha Beta;4-Layer Sandwich;L-amino peptidase D-ALA esterase/amidase;L-amino peptidase D-ALA esterase/amidase 0.7749 1 300 3.60.70.12
4iheA00 Alpha Beta;4-Layer Sandwich;L-amino peptidase D-ALA esterase/amidase;L-amino peptidase D-ALA esterase/amidase 0.7279 2 298 3.60.70.12
4iheA00 Alpha Beta;4-Layer Sandwich;L-amino peptidase D-ALA esterase/amidase;L-amino peptidase D-ALA esterase/amidase 0.7056 2 298 3.60.70.12
3n5iD00 Alpha Beta;4-Layer Sandwich;L-amino peptidase D-ALA esterase/amidase;L-amino peptidase D-ALA esterase/amidase 0.6355 2 284 3.60.70.12
ID Description Score Start End GO Terms
AF-V7KNK6-F1-model_v4 deleted 0.9512 1 140
AF-X8B0Y6-F1-model_v4 deleted 0.9511 1 111
AF-A0A7U8U5C5-F1-model_v4 deleted 0.942 1 145
AF-X8B0Y6-F1-model_v4 deleted 0.9348 1 111
AF-A0A357FQG6-F1-model_v4 Peptidase S58 0.9295 2 139 GO:0004177

Feature Viewer

pLDDT pTM Quality
75.91 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map