F360973
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 249 | 150 | 235 | 500 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0020232|Ga0451576_0020232_3340_5013 |
| Length | 557 |
| Sequence | MQLSLDCCVKNLLVIYRNYFRILSISSKKTGHMSTLKRNRTILIVILCSVSGLFVSCKENQEKPAPRIFSPSFTSDFESFRQYEYPEWFRDAKFGIWAHWGPQAVPRQGDWYARKMYESDIRNRKTGEFTGESSREYLYHLEHYGHPSKFGYKDIIPLWKAERWDPDKLMALYKRVGAKYFVSMATHHDNFFLWDSKIHRWNSVKMGPMKDVVGLWQKAARNEGLRFGISEHLGASYTWFQPSHYADRKGPMKGIPFDGADPEFQDLYHKKTADNDMGWLTTDSANQQEWLSSITEVIDMYKPDLLYSDSEMPFGSVGRTMVSHFYNQDITKNNGRLEAVYTCKHFGSEGRWVSDIERGAMDSISPYPWQTDTSIGDWYYRTGQKYMTGLQVIQMLVDIVSKNGNLLLNVVQTPEGDLEQDVIDILEEVAAWTPVNGEGIYGTRPWKVYGEGPSTENQAKGTFGGVKDVRPYTSSDIRFTSKDNFLYAFLMDRPAGEIKIQSLGRNKGLTDKKIKNISMPGSEEKLKWEQGEEALSVMLPSELPDWNVIALKIEFRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 3 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 4 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 7 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 8 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 9 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 10 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 11 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 12 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 13 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 14 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 90 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 91 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 92 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 93 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 94 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 95 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 96 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 97 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 98 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 99 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 100 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 107 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 108 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 111 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 112 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 115 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 116 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 143 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 147 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 148 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 149 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 150 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.98 |
| Metatranscriptomes | 0.4 |
| Isolates | 5.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.23 |
| Nodule | 0 |
| Rhizoplane | 0.8 |
| Rhizosphere | 87.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10023631 | 3300001989 | Bacteria | 2170 |
| 2 | JGI24737J22298_10000310 | 3300001990 | Bacteria | 16241 |
| 3 | JGI24737J22298_10020750 | 3300001990 | Bacteria | 2096 |
| 4 | JGI24735J21928_10000010 | 3300002067 | Bacteria | 237152 |
| 5 | JGI25162J39368_1000005 | 3300002737 | Bacteria | 435925 |
| 6 | rootH2_10153958 | 3300003320 | Bacteria | 2837 |
| 7 | Ga0055526_1009446 | 3300003771 | Bacteria | 4686 |
| 8 | Ga0055536_1000007 | 3300003781 | Bacteria | 345133 |
| 9 | Ga0055530_10004536 | 3300003791 | Bacteria | 7098 |
| 10 | Ga0065165_1000920 | 3300005262 | Bacteria | 37774 |
| 11 | Ga0065714_10064434 | 3300005288 | Bacteria | 130989 |
| 12 | Ga0070658_10017507 | 3300005327 | Bacteria | 5733 |
| 13 | Ga0070658_10036402 | 3300005327 | Unclassified | 3967 |
| 14 | Ga0070676_10003789 | 3300005328 | Bacteria | 7930 |
| 15 | Ga0070680_100013159 | 3300005336 | Bacteria | 6441 |
| 16 | Ga0068868_100019029 | 3300005338 | Bacteria | 5141 |
| 17 | Ga0070660_100045596 | 3300005339 | Bacteria | 3357 |
| 18 | Ga0070673_100001414 | 3300005364 | Bacteria | 14048 |
| 19 | Ga0070659_100006931 | 3300005366 | Bacteria | 8204 |
| 20 | Ga0070659_100019550 | 3300005366 | Bacteria | 5135 |
| 21 | Ga0070663_100005641 | 3300005455 | Bacteria | 7455 |
| 22 | Ga0070678_100012425 | 3300005456 | Bacteria | 5292 |
| 23 | Ga0070662_100000145 | 3300005457 | Bacteria | 40435 |
| 24 | Ga0070681_10113175 | 3300005458 | Bacteria | 2653 |
| 25 | Ga0068867_100000856 | 3300005459 | Bacteria | 20531 |
| 26 | Ga0070679_100000473 | 3300005530 | Bacteria | 34337 |
| 27 | Ga0068855_100107992 | 3300005563 | Bacteria | 3197 |
| 28 | Ga0068856_100021438 | 3300005614 | Bacteria | 6282 |
| 29 | Ga0068852_100000306 | 3300005616 | Bacteria | 33010 |
| 30 | Ga0068852_100004531 | 3300005616 | Bacteria | 9831 |
| 31 | Ga0075366_10070681 | 3300006195 | Bacteria | 2079 |
| 32 | Ga0097621_100000369 | 3300006237 | Bacteria | 31242 |
| 33 | Ga0068871_100000513 | 3300006358 | Bacteria | 26609 |
| 34 | Ga0068865_100000310 | 3300006881 | Bacteria | 26942 |
| 35 | Ga0105240_10029281 | 3300009093 | Bacteria | 7178 |
| 36 | Ga0105240_10225838 | 3300009093 | Bacteria | 2179 |
| 37 | Ga0105241_10000251 | 3300009174 | Bacteria | 40576 |
| 38 | Ga0105241_10001046 | 3300009174 | Bacteria | 21092 |
| 39 | Ga0105241_10049509 | 3300009174 | Unclassified | 3200 |
| 40 | Ga0105237_10000993 | 3300009545 | Bacteria | 38153 |
| 41 | Ga0105238_10012070 | 3300009551 | Bacteria | 8705 |
| 42 | Ga0105239_10000016 | 3300010375 | Bacteria | 293142 |
| 43 | Ga0105239_10000032 | 3300010375 | Bacteria | 225528 |
| 44 | Ga0105239_10009494 | 3300010375 | Bacteria | 10957 |
| 45 | Ga0157373_10037892 | 3300013100 | Bacteria | 3455 |
| 46 | Ga0157373_10040006 | 3300013100 | Unclassified | 3355 |
| 47 | Ga0157373_10100055 | 3300013100 | Bacteria | 2040 |
| 48 | Ga0157371_10000016 | 3300013102 | Bacteria | 330495 |
| 49 | Ga0157371_10002379 | 3300013102 | Bacteria | 17992 |
| 50 | Ga0157371_10013314 | 3300013102 | Bacteria | 6254 |
| 51 | Ga0157371_10030370 | 3300013102 | Bacteria | 3899 |
| 52 | Ga0157371_10062914 | 3300013102 | Bacteria | 2630 |
| 53 | Ga0157371_10072567 | 3300013102 | Bacteria | 2437 |
| 54 | Ga0157371_10086448 | 3300013102 | Bacteria | 2221 |
| 55 | Ga0157370_10000144 | 3300013104 | Bacteria | 86782 |
| 56 | Ga0157370_10000471 | 3300013104 | Bacteria | 50251 |
| 57 | Ga0157370_10004387 | 3300013104 | Bacteria | 16197 |
| 58 | Ga0157370_10009496 | 3300013104 | Bacteria | 10381 |
| 59 | Ga0157370_10184896 | 3300013104 | Bacteria | 1935 |
| 60 | Ga0157369_10000169 | 3300013105 | Bacteria | 91977 |
| 61 | Ga0157369_10000500 | 3300013105 | Bacteria | 51847 |
| 62 | Ga0157369_10062792 | 3300013105 | Bacteria | 4002 |
| 63 | Ga0157369_10129869 | 3300013105 | Bacteria | 2671 |
| 64 | Ga0157374_10000418 | 3300013296 | Bacteria | 38471 |
| 65 | Ga0157374_10000599 | 3300013296 | Bacteria | 31938 |
| 66 | Ga0157372_10000001 | 3300013307 | Bacteria | 791349 |
| 67 | Ga0157372_10017858 | 3300013307 | Bacteria | 7621 |
| 68 | Ga0157372_10057229 | 3300013307 | Bacteria | 4358 |
| 69 | Ga0157372_10083634 | 3300013307 | Bacteria | 3615 |
| 70 | Ga0157372_10085103 | 3300013307 | Bacteria | 3586 |
| 71 | Ga0157372_10119505 | 3300013307 | Bacteria | 3025 |
| 72 | Ga0157372_10121945 | 3300013307 | Bacteria | 2995 |
| 73 | Ga0157375_10226933 | 3300013308 | Bacteria | 2026 |
| 74 | Ga0182008_10006734 | 3300014497 | Bacteria | 6396 |
| 75 | Ga0182006_1000190 | 3300015261 | Bacteria | 63313 |
| 76 | Ga0182006_1000669 | 3300015261 | Bacteria | 24090 |
| 77 | Ga0182007_10000197 | 3300015262 | Bacteria | 40291 |
| 78 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 79 | Ga0163161_10000170 | 3300017792 | Bacteria | 59576 |
| 80 | Ga0163161_10000206 | 3300017792 | Bacteria | 54119 |
| 81 | Ga0206351_11009503 | 3300020077 | Bacteria | 3535 |
| 82 | Ga0209674_102086 | 3300025226 | Bacteria | 4552 |
| 83 | Ga0209437_100043 | 3300025233 | Bacteria | 440454 |
| 84 | Ga0209233_1001955 | 3300025261 | Bacteria | 7843 |
| 85 | Ga0209676_1000058 | 3300025292 | Bacteria | 345185 |
| 86 | Ga0209564_1003439 | 3300025295 | Bacteria | 10829 |
| 87 | Ga0209050_1000054 | 3300025298 | Bacteria | 345186 |
| 88 | Ga0207647_10000043 | 3300025904 | Bacteria | 91109 |
| 89 | Ga0207647_10000302 | 3300025904 | Bacteria | 40592 |
| 90 | Ga0207645_10001515 | 3300025907 | Bacteria | 18982 |
| 91 | Ga0207705_10004963 | 3300025909 | Bacteria | 9987 |
| 92 | Ga0207705_10012602 | 3300025909 | Bacteria | 6103 |
| 93 | Ga0207654_10003079 | 3300025911 | Bacteria | 8450 |
| 94 | Ga0207654_10026210 | 3300025911 | Bacteria | 3154 |
| 95 | Ga0207695_10001921 | 3300025913 | Bacteria | 32318 |
| 96 | Ga0207671_10015298 | 3300025914 | Bacteria | 6018 |
| 97 | Ga0207657_10004855 | 3300025919 | Bacteria | 14159 |
| 98 | Ga0207657_10034533 | 3300025919 | Bacteria | 4545 |
| 99 | Ga0207652_10006858 | 3300025921 | Bacteria | 9178 |
| 100 | Ga0207694_10019367 | 3300025924 | Bacteria | 5145 |
| 101 | Ga0207690_10064291 | 3300025932 | Bacteria | 2505 |
| 102 | Ga0207690_10080272 | 3300025932 | Bacteria | 2276 |
| 103 | Ga0207706_10000538 | 3300025933 | Bacteria | 40240 |
| 104 | Ga0207686_10050231 | 3300025934 | Bacteria | 2593 |
| 105 | Ga0207704_10004968 | 3300025938 | Bacteria | 6118 |
| 106 | Ga0207661_10083422 | 3300025944 | Bacteria | 2645 |
| 107 | Ga0207667_10039937 | 3300025949 | Bacteria | 4997 |
| 108 | Ga0207667_10088557 | 3300025949 | Bacteria | 3201 |
| 109 | Ga0207667_10255593 | 3300025949 | Bacteria | 1792 |
| 110 | Ga0207678_10012477 | 3300026067 | Bacteria | 7464 |
| 111 | Ga0207702_10047973 | 3300026078 | Bacteria | 3600 |
| 112 | Ga0207648_10002167 | 3300026089 | Bacteria | 21343 |
| 113 | Ga0207683_10039363 | 3300026121 | Bacteria | 4124 |
| 114 | Ga0207698_10000765 | 3300026142 | Bacteria | 18704 |
| 115 | Ga0207698_10022150 | 3300026142 | Bacteria | 4409 |
| 116 | Ga0207698_10072622 | 3300026142 | Bacteria | 2736 |
| 117 | Ga0307511_10002393 | 3300030521 | Bacteria | 19619 |
| 118 | Ga0316183_1180191 | 3300030742 | Bacteria | 65717 |
| 119 | Ga0316181_1193130 | 3300030744 | Bacteria | 19541 |
| 120 | Ga0265327_10074916 | 3300031251 | Bacteria | 1685 |
| 121 | Ga0265316_10029994 | 3300031344 | Bacteria | 4464 |
| 122 | Ga0307509_10046821 | 3300031507 | Unclassified | 4654 |
| 123 | Ga0307405_10000025 | 3300031731 | Bacteria | 123095 |
| 124 | Ga0307407_10000016 | 3300031903 | Bacteria | 141499 |
| 125 | Ga0307416_100000009 | 3300032002 | Bacteria | 374271 |
| 126 | Ga0307416_100000036 | 3300032002 | Bacteria | 141505 |
| 127 | Ga0307414_10046645 | 3300032004 | Bacteria | 2976 |
| 128 | Ga0307510_10000536 | 3300033180 | Bacteria | 37853 |
| 129 | Ga0373937_0030586 | 3300036401 | Bacteria | 4876 |
| 130 | Ga0395899_0000150 | 3300037312 | Bacteria | 105946 |
| 131 | Ga0395899_0000474 | 3300037312 | Bacteria | 45411 |
| 132 | Ga0395899_0001451 | 3300037312 | Bacteria | 20221 |
| 133 | Ga0395899_0009948 | 3300037312 | Bacteria | 7295 |
| 134 | Ga0395899_0085579 | 3300037312 | Unclassified | 2290 |
| 135 | Ga0395900_0000413 | 3300037418 | Bacteria | 61555 |
| 136 | Ga0395900_0000602 | 3300037418 | Bacteria | 49161 |
| 137 | Ga0395898_0007319 | 3300037466 | Bacteria | 11721 |
| 138 | Ga0395898_0036844 | 3300037466 | Bacteria | 4854 |
| 139 | Ga0395898_0149345 | 3300037466 | Unclassified | 2236 |
| 140 | Ga0395905_0000188 | 3300037471 | Bacteria | 98070 |
| 141 | Ga0395905_0002933 | 3300037471 | Bacteria | 18555 |
| 142 | Ga0395901_0000611 | 3300038443 | Bacteria | 41511 |
| 143 | Ga0395901_0007030 | 3300038443 | Bacteria | 11373 |
| 144 | Ga0439448_0015761 | 3300042005 | Unclassified | 2292 |
| 145 | Ga0451577_0000048 | 3300042876 | Bacteria | 309377 |
| 146 | Ga0451577_0000433 | 3300042876 | Bacteria | 74789 |
| 147 | Ga0451577_0001478 | 3300042876 | Bacteria | 31145 |
| 148 | Ga0451577_0003005 | 3300042876 | Bacteria | 19218 |
| 149 | Ga0451577_0008779 | 3300042876 | Bacteria | 9793 |
| 150 | Ga0451577_0031457 | 3300042876 | Bacteria | 4788 |
| 151 | Ga0453683_0000055 | 3300044673 | Bacteria | 192588 |
| 152 | Ga0453683_0000186 | 3300044673 | Bacteria | 86082 |
| 153 | Ga0453683_0000214 | 3300044673 | Bacteria | 77233 |
| 154 | Ga0453683_0001627 | 3300044673 | Bacteria | 18859 |
| 155 | Ga0453683_0010787 | 3300044673 | Bacteria | 6048 |
| 156 | Ga0453683_0086464 | 3300044673 | Unclassified | 1964 |
| 157 | Ga0453683_0087979 | 3300044673 | Unclassified | 1947 |
| 158 | Ga0466966_0001498 | 3300044684 | Bacteria | 14986 |
| 159 | Ga0466966_0002353 | 3300044684 | Bacteria | 12343 |
| 160 | Ga0466961_0001629 | 3300044693 | Bacteria | 13934 |
| 161 | Ga0466961_0017935 | 3300044693 | Bacteria | 4551 |
| 162 | Ga0453684_0000161 | 3300044712 | Bacteria | 298175 |
| 163 | Ga0453684_0000570 | 3300044712 | Bacteria | 137760 |
| 164 | Ga0453684_0000766 | 3300044712 | Bacteria | 111429 |
| 165 | Ga0453684_0000995 | 3300044712 | Bacteria | 92458 |
| 166 | Ga0453684_0015226 | 3300044712 | Bacteria | 12198 |
| 167 | Ga0453684_0015469 | 3300044712 | Bacteria | 12062 |
| 168 | Ga0453684_0021264 | 3300044712 | Bacteria | 9708 |
| 169 | Ga0453684_0037425 | 3300044712 | Bacteria | 6660 |
| 170 | Ga0453684_0051770 | 3300044712 | Bacteria | 5377 |
| 171 | Ga0453684_0060134 | 3300044712 | Bacteria | 4891 |
| 172 | Ga0453684_0062285 | 3300044712 | Bacteria | 4779 |
| 173 | Ga0453684_0103927 | 3300044712 | Bacteria | 3469 |
| 174 | Ga0453684_0121329 | 3300044712 | Bacteria | 3155 |
| 175 | Ga0453684_0148770 | 3300044712 | Bacteria | 2786 |
| 176 | Ga0453684_0194709 | 3300044712 | Bacteria | 2368 |
| 177 | Ga0466971_0003181 | 3300044719 | Bacteria | 7007 |
| 178 | Ga0466959_0000462 | 3300045049 | Bacteria | 23654 |
| 179 | Ga0466959_0058462 | 3300045049 | Unclassified | 2808 |
| 180 | Ga0466959_0082010 | 3300045049 | Bacteria | 2324 |
| 181 | Ga0451576_0000059 | 3300045051 | Bacteria | 296795 |
| 182 | Ga0451576_0000095 | 3300045051 | Bacteria | 223485 |
| 183 | Ga0451576_0000504 | 3300045051 | Bacteria | 85668 |
| 184 | Ga0451576_0000689 | 3300045051 | Bacteria | 68784 |
| 185 | Ga0451576_0001819 | 3300045051 | Bacteria | 34710 |
| 186 | Ga0451576_0004689 | 3300045051 | Bacteria | 17583 |
| 187 | Ga0451576_0005256 | 3300045051 | Bacteria | 16343 |
| 188 | Ga0451576_0008893 | 3300045051 | Bacteria | 11718 |
| 189 | Ga0451576_0020232 | 3300045051 | Bacteria | 7249 |
| 190 | Ga0451576_0033587 | 3300045051 | Bacteria | 5453 |
| 191 | Ga0451576_0101909 | 3300045051 | Unclassified | 2986 |
| 192 | Ga0466958_0002398 | 3300045836 | Bacteria | 9387 |
| 193 | Ga0466958_0018354 | 3300045836 | Bacteria | 4060 |
| 194 | Ga0495638_0000086 | 3300046460 | Bacteria | 152781 |
| 195 | Ga0495638_0014688 | 3300046460 | Bacteria | 5282 |
| 196 | Ga0495650_0001594 | 3300046471 | Bacteria | 21229 |
| 197 | Ga0495584_0001635 | 3300046491 | Bacteria | 13168 |
| 198 | Ga0495596_0026799 | 3300046500 | Unclassified | 2321 |
| 199 | Ga0495607_0022319 | 3300046501 | Bacteria | 3977 |
| 200 | Ga0495583_0000456 | 3300046506 | Bacteria | 60762 |
| 201 | Ga0495606_0008989 | 3300046507 | Bacteria | 8547 |
| 202 | Ga0495606_0067080 | 3300046507 | Bacteria | 2273 |
| 203 | Ga0495610_0000495 | 3300046512 | Bacteria | 40233 |
| 204 | Ga0495616_0003315 | 3300046513 | Bacteria | 10341 |
| 205 | Ga0495631_0005057 | 3300046518 | Bacteria | 6946 |
| 206 | Ga0495643_0037542 | 3300046522 | Bacteria | 2656 |
| 207 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 208 | Ga0495666_0057760 | 3300046526 | Bacteria | 1857 |
| 209 | Ga0495642_0000467 | 3300046528 | Bacteria | 21246 |
| 210 | Ga0495609_0000030 | 3300046538 | Bacteria | 215885 |
| 211 | Ga0495609_0000342 | 3300046538 | Bacteria | 41240 |
| 212 | Ga0495622_0000094 | 3300046557 | Bacteria | 79405 |
| 213 | Ga0495633_0000096 | 3300046558 | Bacteria | 118933 |
| 214 | Ga0495633_0037495 | 3300046558 | Bacteria | 2319 |
| 215 | Ga0495668_0000151 | 3300046616 | Bacteria | 105466 |
| 216 | Ga0495611_0000182 | 3300046648 | Bacteria | 44769 |
| 217 | Ga0495625_0000065 | 3300046660 | Bacteria | 173230 |
| 218 | Ga0495661_0001850 | 3300046665 | Bacteria | 16904 |
| 219 | Ga0495589_0000021 | 3300046794 | Bacteria | 197941 |
| 220 | Ga0495683_0016821 | 3300047323 | Bacteria | 3795 |
| 221 | Ga0495687_000360 | 3300047443 | Bacteria | 57082 |
| 222 | Ga0495687_001909 | 3300047443 | Bacteria | 17895 |
| 223 | Ga0495677_0000383 | 3300047445 | Bacteria | 18990 |
| 224 | Ga0495626_0002942 | 3300048091 | Bacteria | 11337 |
| 225 | Ga0496115_0104226 | 3300048918 | Bacteria | 2328 |
| 226 | Ga0495678_000361 | 3300049459 | Bacteria | 46514 |
| 227 | Ga0501034_0101886 | 3300049571 | Unclassified | 2865 |
| 228 | Ga0501035_0124018 | 3300049822 | Bacteria | 2256 |
| 229 | nmdc:mga0k408_34915_c1 | 3300050493 | Bacteria | 2881 |
| 230 | nmdc:mga0k408_974_c2 | 3300050493 | Bacteria | 6264 |
| 231 | Ga0500635_0000290 | 3300053080 | Bacteria | 18253 |
| 232 | Ga0500608_005102 | 3300053122 | Bacteria | 5173 |
| 233 | Ga0500608_016130 | 3300053122 | Bacteria | 3370 |
| 234 | Ga0500622_0000547 | 3300053156 | Bacteria | 34632 |
| 235 | Ga0466962_0004084 | 3300061719 | Bacteria | 6991 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0124018 | Ga0501035_0124018_19_1302 | 413 |
| 2 | 3300013102 | Ga0157371_10062914 | Ga0157371_100629142 | 414 |
| 3 | 3300046526 | Ga0495666_0057760 | Ga0495666_0057760_56_1366 | 416 |
| 4 | 3300046522 | Ga0495643_0037542 | Ga0495643_0037542_1277_2626 | 419 |
| 5 | 3300044712 | Ga0453684_0000995 | Ga0453684_0000995_21205_22767 | 457 |
| 6 | 3300053156 | Ga0500622_0000547 | Ga0500622_0000547_24667_26169 | 457 |
| 7 | 3300013307 | Ga0157372_10121945 | Ga0157372_101219452 | 458 |
| 8 | 3300044684 | Ga0466966_0001498 | Ga0466966_0001498_11043_12614 | 460 |
| 9 | 3300044693 | Ga0466961_0001629 | Ga0466961_0001629_4420_5991 | 460 |
| 10 | 3300044719 | Ga0466971_0003181 | Ga0466971_0003181_945_2516 | 460 |
| 11 | 3300045049 | Ga0466959_0000462 | Ga0466959_0000462_12997_14568 | 460 |
| 12 | 3300045836 | Ga0466958_0002398 | Ga0466958_0002398_3410_4981 | 460 |
| 13 | 3300061719 | Ga0466962_0004084 | Ga0466962_0004084_4402_5973 | 460 |
| 14 | 3300031903 | Ga0307407_10000016 | Ga0307407_1000001612 | 466 |
| 15 | 3300032002 | Ga0307416_100000036 | Ga0307416_10000003612 | 466 |
| 16 | 3300046558 | Ga0495633_0037495 | Ga0495633_0037495_521_1990 | 466 |
| 17 | 3300046512 | Ga0495610_0000495 | Ga0495610_0000495_5126_6673 | 467 |
| 18 | 3300009174 | Ga0105241_10001046 | Ga0105241_100010462 | 471 |
| 19 | 3300009545 | Ga0105237_10000993 | Ga0105237_100009938 | 471 |
| 20 | 3300009551 | Ga0105238_10012070 | Ga0105238_100120703 | 471 |
| 21 | 3300013296 | Ga0157374_10000599 | Ga0157374_1000059914 | 471 |
| 22 | 3300042005 | Ga0439448_0015761 | Ga0439448_0015761_797_2248 | 471 |
| 23 | 3300045049 | Ga0466959_0058462 | Ga0466959_0058462_1131_2636 | 474 |
| 24 | 3300046665 | Ga0495661_0001850 | Ga0495661_0001850_3332_4918 | 476 |
| 25 | 3300053122 | Ga0500608_005102 | Ga0500608_005102_348_1859 | 476 |
| 26 | 3300013104 | Ga0157370_10000471 | Ga0157370_1000047116 | 477 |
| 27 | 3300032002 | Ga0307416_100000009 | Ga0307416_100000009113 | 477 |
| 28 | 3300032004 | Ga0307414_10046645 | Ga0307414_100466453 | 477 |
| 29 | 3300037312 | Ga0395899_0001451 | Ga0395899_0001451_11922_13472 | 477 |
| 30 | 3300037418 | Ga0395900_0000602 | Ga0395900_0000602_28359_29909 | 477 |
| 31 | 3300044673 | Ga0453683_0087979 | Ga0453683_0087979_135_1673 | 477 |
| 32 | 3300044712 | Ga0453684_0037425 | Ga0453684_0037425_4490_6028 | 477 |
| 33 | 3300045051 | Ga0451576_0101909 | Ga0451576_0101909_92_1630 | 477 |
| 34 | 3300046460 | Ga0495638_0000086 | Ga0495638_0000086_140195_141745 | 477 |
| 35 | 3300046471 | Ga0495650_0001594 | Ga0495650_0001594_17528_19078 | 477 |
| 36 | 3300046491 | Ga0495584_0001635 | Ga0495584_0001635_6672_8222 | 477 |
| 37 | 3300046500 | Ga0495596_0026799 | Ga0495596_0026799_14_1486 | 477 |
| 38 | 3300046501 | Ga0495607_0022319 | Ga0495607_0022319_1368_2918 | 477 |
| 39 | 3300046506 | Ga0495583_0000456 | Ga0495583_0000456_49353_50903 | 477 |
| 40 | 3300046513 | Ga0495616_0003315 | Ga0495616_0003315_1054_2604 | 477 |
| 41 | 3300046524 | Ga0495648_0000001 | Ga0495648_0000001_340916_342466 | 477 |
| 42 | 3300046528 | Ga0495642_0000467 | Ga0495642_0000467_3236_4786 | 477 |
| 43 | 3300046538 | Ga0495609_0000030 | Ga0495609_0000030_184428_185978 | 477 |
| 44 | 3300046538 | Ga0495609_0000342 | Ga0495609_0000342_23657_25207 | 477 |
| 45 | 3300046557 | Ga0495622_0000094 | Ga0495622_0000094_66915_68465 | 477 |
| 46 | 3300046558 | Ga0495633_0000096 | Ga0495633_0000096_73601_75151 | 477 |
| 47 | 3300046616 | Ga0495668_0000151 | Ga0495668_0000151_61752_63302 | 477 |
| 48 | 3300046660 | Ga0495625_0000065 | Ga0495625_0000065_42801_44351 | 477 |
| 49 | 3300046794 | Ga0495589_0000021 | Ga0495589_0000021_184603_186153 | 477 |
| 50 | 3300047443 | Ga0495687_000360 | Ga0495687_000360_29908_31458 | 477 |
| 51 | 3300047445 | Ga0495677_0000383 | Ga0495677_0000383_9097_10647 | 477 |
| 52 | 3300048091 | Ga0495626_0002942 | Ga0495626_0002942_717_2267 | 477 |
| 53 | 3300049459 | Ga0495678_000361 | Ga0495678_000361_18715_20265 | 477 |
| 54 | 3300031731 | Ga0307405_10000025 | Ga0307405_1000002536 | 478 |
| 55 | 3300013104 | Ga0157370_10009496 | Ga0157370_1000949610 | 479 |
| 56 | 3300037471 | Ga0395905_0002933 | Ga0395905_0002933_685_2223 | 479 |
| 57 | 3300042876 | Ga0451577_0008779 | Ga0451577_0008779_2927_4462 | 479 |
| 58 | 3300046460 | Ga0495638_0014688 | Ga0495638_0014688_464_2053 | 479 |
| 59 | 3300013100 | Ga0157373_10037892 | Ga0157373_100378923 | 480 |
| 60 | 3300013102 | Ga0157371_10002379 | Ga0157371_1000237911 | 480 |
| 61 | 3300013105 | Ga0157369_10062792 | Ga0157369_100627923 | 480 |
| 62 | 3300013307 | Ga0157372_10085103 | Ga0157372_100851032 | 480 |
| 63 | 3300025261 | Ga0209233_1001955 | Ga0209233_10019553 | 480 |
| 64 | 3300025904 | Ga0207647_10000043 | Ga0207647_1000004354 | 480 |
| 65 | 3300030521 | Ga0307511_10002393 | Ga0307511_1000239311 | 480 |
| 66 | 3300037312 | Ga0395899_0009948 | Ga0395899_0009948_3607_5169 | 480 |
| 67 | 3300037466 | Ga0395898_0036844 | Ga0395898_0036844_2905_4467 | 480 |
| 68 | 3300006195 | Ga0075366_10070681 | Ga0075366_100706811 | 481 |
| 69 | 3300025226 | Ga0209674_102086 | Ga0209674_1020862 | 481 |
| 70 | 3300050493 | nmdc:mga0k408_974_c2 | nmdc:mga0k408_974_c2_4659_6164 | 481 |
| 71 | 3300003771 | Ga0055526_1009446 | Ga0055526_10094462 | 482 |
| 72 | 3300005262 | Ga0065165_1000920 | Ga0065165_10009206 | 482 |
| 73 | 3300005288 | Ga0065714_10064434 | Ga0065714_1006443414 | 482 |
| 74 | 3300009174 | Ga0105241_10049509 | Ga0105241_100495091 | 482 |
| 75 | 3300013102 | Ga0157371_10000016 | Ga0157371_10000016250 | 482 |
| 76 | 3300013104 | Ga0157370_10004387 | Ga0157370_100043879 | 482 |
| 77 | 3300025295 | Ga0209564_1003439 | Ga0209564_10034392 | 482 |
| 78 | 3300042876 | Ga0451577_0003005 | Ga0451577_0003005_11869_13428 | 482 |
| 79 | 3300044673 | Ga0453683_0000214 | Ga0453683_0000214_33035_34687 | 482 |
| 80 | 3300050493 | nmdc:mga0k408_34915_c1 | nmdc:mga0k408_34915_c1_711_2285 | 482 |
| 81 | iso_pu_bacteria | 2738541302 | 2738851731 | 482 |
| 82 | iso_pu_bacteria | 2818991437 | 2819550028 | 482 |
| 83 | iso_pu_bacteria | 2842722452 | 2842726743 | 482 |
| 84 | iso_pu_bacteria | 2842909656 | 2842911585 | 482 |
| 85 | iso_pu_bacteria | 2849281842 | 2849286147 | 482 |
| 86 | iso_pu_bacteria | 2904445276 | 2904448609 | 482 |
| 87 | iso_pu_bacteria | 2945997725 | 2946001930 | 482 |
| 88 | iso_pu_bacteria | 2954016120 | 2954019812 | 482 |
| 89 | 3300013102 | Ga0157371_10072567 | Ga0157371_100725672 | 483 |
| 90 | 3300013104 | Ga0157370_10000144 | Ga0157370_1000014442 | 483 |
| 91 | 3300013105 | Ga0157369_10000169 | Ga0157369_1000016957 | 483 |
| 92 | 3300013307 | Ga0157372_10083634 | Ga0157372_100836344 | 483 |
| 93 | 3300013307 | Ga0157372_10119505 | Ga0157372_101195052 | 483 |
| 94 | 3300014497 | Ga0182008_10006734 | Ga0182008_100067345 | 483 |
| 95 | 3300015262 | Ga0182007_10000197 | Ga0182007_1000019724 | 483 |
| 96 | 3300015682 | Ga0183373_1001 | Ga0183373_1001201 | 483 |
| 97 | 3300017792 | Ga0163161_10000206 | Ga0163161_1000020614 | 483 |
| 98 | 3300030742 | Ga0316183_1180191 | Ga0316183_11801912 | 483 |
| 99 | 3300030744 | Ga0316181_1193130 | Ga0316181_11931304 | 483 |
| 100 | 3300031507 | Ga0307509_10046821 | Ga0307509_100468214 | 483 |
| 101 | 3300044712 | Ga0453684_0015226 | Ga0453684_0015226_10066_11625 | 484 |
| 102 | 3300005366 | Ga0070659_100006931 | Ga0070659_1000069311 | 485 |
| 103 | 3300005458 | Ga0070681_10113175 | Ga0070681_101131751 | 485 |
| 104 | 3300025932 | Ga0207690_10080272 | Ga0207690_100802722 | 485 |
| 105 | 3300025944 | Ga0207661_10083422 | Ga0207661_100834223 | 485 |
| 106 | 3300031251 | Ga0265327_10074916 | Ga0265327_100749161 | 485 |
| 107 | 3300042876 | Ga0451577_0000433 | Ga0451577_0000433_24909_26417 | 485 |
| 108 | 3300042876 | Ga0451577_0001478 | Ga0451577_0001478_12184_13707 | 485 |
| 109 | 3300044673 | Ga0453683_0086464 | Ga0453683_0086464_326_1834 | 485 |
| 110 | 3300044712 | Ga0453684_0000570 | Ga0453684_0000570_35394_36917 | 485 |
| 111 | 3300044712 | Ga0453684_0015469 | Ga0453684_0015469_4383_5891 | 485 |
| 112 | 3300045051 | Ga0451576_0000095 | Ga0451576_0000095_186571_188094 | 485 |
| 113 | 3300045051 | Ga0451576_0000689 | Ga0451576_0000689_44486_45994 | 485 |
| 114 | 3300053122 | Ga0500608_016130 | Ga0500608_016130_1081_2601 | 485 |
| 115 | iso_pu_bacteria | 2775506987 | 2776614469 | 485 |
| 116 | 3300003781 | Ga0055536_1000007 | Ga0055536_100000787 | 486 |
| 117 | 3300003791 | Ga0055530_10004536 | Ga0055530_100045366 | 486 |
| 118 | 3300005614 | Ga0068856_100021438 | Ga0068856_1000214382 | 486 |
| 119 | 3300010375 | Ga0105239_10000016 | Ga0105239_10000016178 | 486 |
| 120 | 3300013308 | Ga0157375_10226933 | Ga0157375_102269332 | 486 |
| 121 | 3300015261 | Ga0182006_1000190 | Ga0182006_100019032 | 486 |
| 122 | 3300015261 | Ga0182006_1000669 | Ga0182006_100066913 | 486 |
| 123 | 3300017792 | Ga0163161_10000170 | Ga0163161_1000017037 | 486 |
| 124 | 3300025292 | Ga0209676_1000058 | Ga0209676_100005884 | 486 |
| 125 | 3300025298 | Ga0209050_1000054 | Ga0209050_100005484 | 486 |
| 126 | 3300026078 | Ga0207702_10047973 | Ga0207702_100479732 | 486 |
| 127 | 3300044673 | Ga0453683_0000055 | Ga0453683_0000055_34434_35942 | 486 |
| 128 | 3300044712 | Ga0453684_0051770 | Ga0453684_0051770_2278_3837 | 486 |
| 129 | 3300045051 | Ga0451576_0001819 | Ga0451576_0001819_7163_8722 | 486 |
| 130 | 3300045051 | Ga0451576_0004689 | Ga0451576_0004689_11701_13209 | 486 |
| 131 | 3300045051 | Ga0451576_0033587 | Ga0451576_0033587_194_1702 | 486 |
| 132 | 3300046507 | Ga0495606_0067080 | Ga0495606_0067080_591_2108 | 486 |
| 133 | 3300047443 | Ga0495687_001909 | Ga0495687_001909_4451_5956 | 486 |
| 134 | 3300049571 | Ga0501034_0101886 | Ga0501034_0101886_1184_2692 | 486 |
| 135 | 3300053080 | Ga0500635_0000290 | Ga0500635_0000290_7764_9275 | 486 |
| 136 | iso_pu_bacteria | 2818991460 | 2819679180 | 486 |
| 137 | 3300010375 | Ga0105239_10009494 | Ga0105239_100094942 | 487 |
| 138 | 3300048918 | Ga0496115_0104226 | Ga0496115_0104226_266_1843 | 487 |
| 139 | iso_pu_bacteria | 2599185184 | 2599481060 | 487 |
| 140 | iso_pu_bacteria | 2928078545 | 2928083067 | 487 |
| 141 | iso_pu_bacteria | 2928147474 | 2928150088 | 487 |
| 142 | iso_pu_bacteria | 2932082852 | 2932086892 | 487 |
| 143 | 3300001990 | JGI24737J22298_10020750 | JGI24737J22298_100207502 | 488 |
| 144 | 3300005366 | Ga0070659_100019550 | Ga0070659_1000195502 | 488 |
| 145 | 3300005455 | Ga0070663_100005641 | Ga0070663_1000056413 | 488 |
| 146 | 3300005457 | Ga0070662_100000145 | Ga0070662_10000014514 | 488 |
| 147 | 3300009174 | Ga0105241_10000251 | Ga0105241_1000025113 | 488 |
| 148 | 3300013100 | Ga0157373_10100055 | Ga0157373_101000552 | 488 |
| 149 | 3300013102 | Ga0157371_10030370 | Ga0157371_100303703 | 488 |
| 150 | 3300013105 | Ga0157369_10000500 | Ga0157369_1000050020 | 488 |
| 151 | 3300013105 | Ga0157369_10129869 | Ga0157369_101298692 | 488 |
| 152 | 3300013296 | Ga0157374_10000418 | Ga0157374_1000041813 | 488 |
| 153 | 3300013307 | Ga0157372_10000001 | Ga0157372_10000001543 | 488 |
| 154 | 3300013307 | Ga0157372_10057229 | Ga0157372_100572292 | 488 |
| 155 | 3300020077 | Ga0206351_11009503 | Ga0206351_110095032 | 488 |
| 156 | 3300025904 | Ga0207647_10000302 | Ga0207647_1000030212 | 488 |
| 157 | 3300025911 | Ga0207654_10003079 | Ga0207654_100030795 | 488 |
| 158 | 3300025919 | Ga0207657_10004855 | Ga0207657_1000485510 | 488 |
| 159 | 3300025932 | Ga0207690_10064291 | Ga0207690_100642912 | 488 |
| 160 | 3300025933 | Ga0207706_10000538 | Ga0207706_1000053813 | 488 |
| 161 | 3300026067 | Ga0207678_10012477 | Ga0207678_100124773 | 488 |
| 162 | 3300037312 | Ga0395899_0000150 | Ga0395899_0000150_56233_57744 | 488 |
| 163 | 3300037312 | Ga0395899_0000474 | Ga0395899_0000474_28861_30408 | 488 |
| 164 | 3300037312 | Ga0395899_0085579 | Ga0395899_0085579_287_1804 | 488 |
| 165 | 3300037418 | Ga0395900_0000413 | Ga0395900_0000413_28865_30412 | 488 |
| 166 | 3300037466 | Ga0395898_0007319 | Ga0395898_0007319_2975_4522 | 488 |
| 167 | 3300037466 | Ga0395898_0149345 | Ga0395898_0149345_442_1959 | 488 |
| 168 | 3300037471 | Ga0395905_0000188 | Ga0395905_0000188_67659_69206 | 488 |
| 169 | 3300038443 | Ga0395901_0000611 | Ga0395901_0000611_11100_12647 | 488 |
| 170 | 3300038443 | Ga0395901_0007030 | Ga0395901_0007030_6877_8394 | 488 |
| 171 | 3300044684 | Ga0466966_0002353 | Ga0466966_0002353_808_2319 | 488 |
| 172 | 3300044693 | Ga0466961_0017935 | Ga0466961_0017935_2008_3519 | 488 |
| 173 | 3300044712 | Ga0453684_0021264 | Ga0453684_0021264_8087_9640 | 488 |
| 174 | 3300045051 | Ga0451576_0008893 | Ga0451576_0008893_7991_9541 | 488 |
| 175 | 3300045836 | Ga0466958_0018354 | Ga0466958_0018354_2508_4019 | 488 |
| 176 | 3300046507 | Ga0495606_0008989 | Ga0495606_0008989_5535_7064 | 488 |
| 177 | 3300033180 | Ga0307510_10000536 | Ga0307510_100005369 | 489 |
| 178 | 3300042876 | Ga0451577_0000048 | Ga0451577_0000048_104426_105982 | 489 |
| 179 | 3300044673 | Ga0453683_0001627 | Ga0453683_0001627_9427_10983 | 489 |
| 180 | 3300044712 | Ga0453684_0000161 | Ga0453684_0000161_93224_94780 | 489 |
| 181 | 3300044712 | Ga0453684_0121329 | Ga0453684_0121329_1489_3003 | 489 |
| 182 | 3300045051 | Ga0451576_0000059 | Ga0451576_0000059_203396_204952 | 489 |
| 183 | 3300046518 | Ga0495631_0005057 | Ga0495631_0005057_3171_4682 | 489 |
| 184 | 3300047323 | Ga0495683_0016821 | Ga0495683_0016821_913_2424 | 489 |
| 185 | 3300003320 | rootH2_10153958 | rootH2_101539583 | 490 |
| 186 | 3300005327 | Ga0070658_10017507 | Ga0070658_100175072 | 490 |
| 187 | 3300005327 | Ga0070658_10036402 | Ga0070658_100364024 | 490 |
| 188 | 3300005336 | Ga0070680_100013159 | Ga0070680_1000131593 | 490 |
| 189 | 3300005339 | Ga0070660_100045596 | Ga0070660_1000455963 | 490 |
| 190 | 3300005530 | Ga0070679_100000473 | Ga0070679_10000047320 | 490 |
| 191 | 3300005616 | Ga0068852_100004531 | Ga0068852_1000045316 | 490 |
| 192 | 3300009093 | Ga0105240_10225838 | Ga0105240_102258381 | 490 |
| 193 | 3300013100 | Ga0157373_10040006 | Ga0157373_100400062 | 490 |
| 194 | 3300013102 | Ga0157371_10086448 | Ga0157371_100864481 | 490 |
| 195 | 3300013104 | Ga0157370_10184896 | Ga0157370_101848961 | 490 |
| 196 | 3300025909 | Ga0207705_10004963 | Ga0207705_100049632 | 490 |
| 197 | 3300025909 | Ga0207705_10012602 | Ga0207705_100126023 | 490 |
| 198 | 3300025919 | Ga0207657_10034533 | Ga0207657_100345333 | 490 |
| 199 | 3300025921 | Ga0207652_10006858 | Ga0207652_100068585 | 490 |
| 200 | 3300025949 | Ga0207667_10039937 | Ga0207667_100399372 | 490 |
| 201 | 3300025949 | Ga0207667_10255593 | Ga0207667_102555932 | 490 |
| 202 | 3300026142 | Ga0207698_10022150 | Ga0207698_100221503 | 490 |
| 203 | 3300026142 | Ga0207698_10072622 | Ga0207698_100726222 | 490 |
| 204 | 3300031344 | Ga0265316_10029994 | Ga0265316_100299942 | 490 |
| 205 | 3300036401 | Ga0373937_0030586 | Ga0373937_0030586_1443_2954 | 490 |
| 206 | 3300042876 | Ga0451577_0031457 | Ga0451577_0031457_3169_4752 | 490 |
| 207 | 3300044673 | Ga0453683_0000186 | Ga0453683_0000186_55338_56855 | 490 |
| 208 | 3300044673 | Ga0453683_0010787 | Ga0453683_0010787_1118_2653 | 490 |
| 209 | 3300044712 | Ga0453684_0000766 | Ga0453684_0000766_89190_90752 | 490 |
| 210 | 3300044712 | Ga0453684_0060134 | Ga0453684_0060134_1752_3269 | 490 |
| 211 | 3300044712 | Ga0453684_0062285 | Ga0453684_0062285_2476_3993 | 490 |
| 212 | 3300044712 | Ga0453684_0103927 | Ga0453684_0103927_16_1599 | 490 |
| 213 | 3300044712 | Ga0453684_0194709 | Ga0453684_0194709_797_2314 | 490 |
| 214 | 3300045051 | Ga0451576_0000504 | Ga0451576_0000504_63064_64581 | 490 |
| 215 | 3300045051 | Ga0451576_0005256 | Ga0451576_0005256_7250_8767 | 490 |
| 216 | 3300045051 | Ga0451576_0020232 | Ga0451576_0020232_3340_5013 | 490 |
| 217 | 3300001989 | JGI24739J22299_10023631 | JGI24739J22299_100236312 | 491 |
| 218 | 3300001990 | JGI24737J22298_10000310 | JGI24737J22298_100003109 | 491 |
| 219 | 3300002067 | JGI24735J21928_10000010 | JGI24735J21928_10000010197 | 491 |
| 220 | 3300002737 | JGI25162J39368_1000005 | JGI25162J39368_1000005252 | 491 |
| 221 | 3300005328 | Ga0070676_10003789 | Ga0070676_100037892 | 491 |
| 222 | 3300005338 | Ga0068868_100019029 | Ga0068868_1000190295 | 491 |
| 223 | 3300005364 | Ga0070673_100001414 | Ga0070673_1000014142 | 491 |
| 224 | 3300005456 | Ga0070678_100012425 | Ga0070678_1000124253 | 491 |
| 225 | 3300005459 | Ga0068867_100000856 | Ga0068867_1000008563 | 491 |
| 226 | 3300005563 | Ga0068855_100107992 | Ga0068855_1001079921 | 491 |
| 227 | 3300005616 | Ga0068852_100000306 | Ga0068852_10000030618 | 491 |
| 228 | 3300006237 | Ga0097621_100000369 | Ga0097621_1000003697 | 491 |
| 229 | 3300006358 | Ga0068871_100000513 | Ga0068871_1000005137 | 491 |
| 230 | 3300006881 | Ga0068865_100000310 | Ga0068865_10000031017 | 491 |
| 231 | 3300009093 | Ga0105240_10029281 | Ga0105240_100292815 | 491 |
| 232 | 3300010375 | Ga0105239_10000032 | Ga0105239_1000003294 | 491 |
| 233 | 3300013102 | Ga0157371_10013314 | Ga0157371_100133143 | 491 |
| 234 | 3300013307 | Ga0157372_10017858 | Ga0157372_100178586 | 491 |
| 235 | 3300025233 | Ga0209437_100043 | Ga0209437_100043155 | 491 |
| 236 | 3300025907 | Ga0207645_10001515 | Ga0207645_100015152 | 491 |
| 237 | 3300025911 | Ga0207654_10026210 | Ga0207654_100262102 | 491 |
| 238 | 3300025913 | Ga0207695_10001921 | Ga0207695_100019215 | 491 |
| 239 | 3300025914 | Ga0207671_10015298 | Ga0207671_100152982 | 491 |
| 240 | 3300025924 | Ga0207694_10019367 | Ga0207694_100193672 | 491 |
| 241 | 3300025934 | Ga0207686_10050231 | Ga0207686_100502311 | 491 |
| 242 | 3300025938 | Ga0207704_10004968 | Ga0207704_100049682 | 491 |
| 243 | 3300025949 | Ga0207667_10088557 | Ga0207667_100885572 | 491 |
| 244 | 3300026089 | Ga0207648_10002167 | Ga0207648_100021675 | 491 |
| 245 | 3300026121 | Ga0207683_10039363 | Ga0207683_100393631 | 491 |
| 246 | 3300026142 | Ga0207698_10000765 | Ga0207698_100007658 | 491 |
| 247 | 3300044712 | Ga0453684_0148770 | Ga0453684_0148770_1130_2719 | 491 |
| 248 | 3300045049 | Ga0466959_0082010 | Ga0466959_0082010_235_1746 | 491 |
| 249 | 3300046648 | Ga0495611_0000182 | Ga0495611_0000182_18024_19655 | 491 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lk7-assembly1.cif.gz_A | structure of the exo-alpha-l-galactosidase bpgh29 from bacteroides plebeius in complex with l-galactose | 0.8641 | 31 | 489 |
| 7lnp-assembly2.cif.gz_C | structure of the exo-alpha-l-galactosidase bpgh29 (d264n mutant) from bacteroides plebeius in complex with paranitrophenyl-alpha-l-galactopyranoside | 0.8571 | 25 | 489 |
| 7snk-assembly1.cif.gz_A | structure of bacple_01702, a gh29 family glycoside hydrolase | 0.8484 | 33 | 489 |
| 7ljj-assembly1.cif.gz_A | structure of the exo-alpha-l-galactosidase bpgh29 from bacteroides plebeius | 0.8457 | 33 | 489 |
| 7lnp-assembly4.cif.gz_E | structure of the exo-alpha-l-galactosidase bpgh29 (d264n mutant) from bacteroides plebeius in complex with paranitrophenyl-alpha-l-galactopyranoside | 0.8456 | 30 | 489 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pspA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7817 | 32 | 376 | 3.20.20.80 |
| 1hl9B01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7668 | 34 | 376 | 3.20.20.80 |
| 1hl9B01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7625 | 34 | 376 | 3.20.20.80 |
| 4pspA02 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.7498 | 378 | 489 | 2.60.40.1180 |
| af_Q551C1_18_358_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7496 | 32 | 372 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A364WF27-F1-model_v4 | deleted | 0.965 | 24 | 491 |
|
| AF-A0A7X9D8H1-F1-model_v4 | Alpha-L-fucosidase | 0.953 | 275 | 490 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A7V5U959-F1-model_v4 | Alpha-L-fucosidase | 0.9512 | 24 | 389 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A522SKP2-F1-model_v4 | Alpha-L-fucosidase | 0.9505 | 24 | 491 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A7V6BDQ5-F1-model_v4 | Alpha-L-fucosidase | 0.941 | 24 | 337 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar