F360973

General Info

Members Datasets Scaffolds Average Seq Length
249 150 235 500

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0020232|Ga0451576_0020232_3340_5013
Length 557
Sequence MQLSLDCCVKNLLVIYRNYFRILSISSKKTGHMSTLKRNRTILIVILCSVSGLFVSCKENQEKPAPRIFSPSFTSDFESFRQYEYPEWFRDAKFGIWAHWGPQAVPRQGDWYARKMYESDIRNRKTGEFTGESSREYLYHLEHYGHPSKFGYKDIIPLWKAERWDPDKLMALYKRVGAKYFVSMATHHDNFFLWDSKIHRWNSVKMGPMKDVVGLWQKAARNEGLRFGISEHLGASYTWFQPSHYADRKGPMKGIPFDGADPEFQDLYHKKTADNDMGWLTTDSANQQEWLSSITEVIDMYKPDLLYSDSEMPFGSVGRTMVSHFYNQDITKNNGRLEAVYTCKHFGSEGRWVSDIERGAMDSISPYPWQTDTSIGDWYYRTGQKYMTGLQVIQMLVDIVSKNGNLLLNVVQTPEGDLEQDVIDILEEVAAWTPVNGEGIYGTRPWKVYGEGPSTENQAKGTFGGVKDVRPYTSSDIRFTSKDNFLYAFLMDRPAGEIKIQSLGRNKGLTDKKIKNISMPGSEEKLKWEQGEEALSVMLPSELPDWNVIALKIEFRK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541302 Pedobacter sp. CF074 Isolate Unclassified
3 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
4 2818991437 Pedobacter terrae 518 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
7 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
8 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
9 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
13 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
14 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
91 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.98
Metatranscriptomes 0.4
Isolates 5.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.23
Nodule 0
Rhizoplane 0.8
Rhizosphere 87.15
Stem 0
Stem Tuber 0
Unclassified 4.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10023631 3300001989 Bacteria 2170
2 JGI24737J22298_10000310 3300001990 Bacteria 16241
3 JGI24737J22298_10020750 3300001990 Bacteria 2096
4 JGI24735J21928_10000010 3300002067 Bacteria 237152
5 JGI25162J39368_1000005 3300002737 Bacteria 435925
6 rootH2_10153958 3300003320 Bacteria 2837
7 Ga0055526_1009446 3300003771 Bacteria 4686
8 Ga0055536_1000007 3300003781 Bacteria 345133
9 Ga0055530_10004536 3300003791 Bacteria 7098
10 Ga0065165_1000920 3300005262 Bacteria 37774
11 Ga0065714_10064434 3300005288 Bacteria 130989
12 Ga0070658_10017507 3300005327 Bacteria 5733
13 Ga0070658_10036402 3300005327 Unclassified 3967
14 Ga0070676_10003789 3300005328 Bacteria 7930
15 Ga0070680_100013159 3300005336 Bacteria 6441
16 Ga0068868_100019029 3300005338 Bacteria 5141
17 Ga0070660_100045596 3300005339 Bacteria 3357
18 Ga0070673_100001414 3300005364 Bacteria 14048
19 Ga0070659_100006931 3300005366 Bacteria 8204
20 Ga0070659_100019550 3300005366 Bacteria 5135
21 Ga0070663_100005641 3300005455 Bacteria 7455
22 Ga0070678_100012425 3300005456 Bacteria 5292
23 Ga0070662_100000145 3300005457 Bacteria 40435
24 Ga0070681_10113175 3300005458 Bacteria 2653
25 Ga0068867_100000856 3300005459 Bacteria 20531
26 Ga0070679_100000473 3300005530 Bacteria 34337
27 Ga0068855_100107992 3300005563 Bacteria 3197
28 Ga0068856_100021438 3300005614 Bacteria 6282
29 Ga0068852_100000306 3300005616 Bacteria 33010
30 Ga0068852_100004531 3300005616 Bacteria 9831
31 Ga0075366_10070681 3300006195 Bacteria 2079
32 Ga0097621_100000369 3300006237 Bacteria 31242
33 Ga0068871_100000513 3300006358 Bacteria 26609
34 Ga0068865_100000310 3300006881 Bacteria 26942
35 Ga0105240_10029281 3300009093 Bacteria 7178
36 Ga0105240_10225838 3300009093 Bacteria 2179
37 Ga0105241_10000251 3300009174 Bacteria 40576
38 Ga0105241_10001046 3300009174 Bacteria 21092
39 Ga0105241_10049509 3300009174 Unclassified 3200
40 Ga0105237_10000993 3300009545 Bacteria 38153
41 Ga0105238_10012070 3300009551 Bacteria 8705
42 Ga0105239_10000016 3300010375 Bacteria 293142
43 Ga0105239_10000032 3300010375 Bacteria 225528
44 Ga0105239_10009494 3300010375 Bacteria 10957
45 Ga0157373_10037892 3300013100 Bacteria 3455
46 Ga0157373_10040006 3300013100 Unclassified 3355
47 Ga0157373_10100055 3300013100 Bacteria 2040
48 Ga0157371_10000016 3300013102 Bacteria 330495
49 Ga0157371_10002379 3300013102 Bacteria 17992
50 Ga0157371_10013314 3300013102 Bacteria 6254
51 Ga0157371_10030370 3300013102 Bacteria 3899
52 Ga0157371_10062914 3300013102 Bacteria 2630
53 Ga0157371_10072567 3300013102 Bacteria 2437
54 Ga0157371_10086448 3300013102 Bacteria 2221
55 Ga0157370_10000144 3300013104 Bacteria 86782
56 Ga0157370_10000471 3300013104 Bacteria 50251
57 Ga0157370_10004387 3300013104 Bacteria 16197
58 Ga0157370_10009496 3300013104 Bacteria 10381
59 Ga0157370_10184896 3300013104 Bacteria 1935
60 Ga0157369_10000169 3300013105 Bacteria 91977
61 Ga0157369_10000500 3300013105 Bacteria 51847
62 Ga0157369_10062792 3300013105 Bacteria 4002
63 Ga0157369_10129869 3300013105 Bacteria 2671
64 Ga0157374_10000418 3300013296 Bacteria 38471
65 Ga0157374_10000599 3300013296 Bacteria 31938
66 Ga0157372_10000001 3300013307 Bacteria 791349
67 Ga0157372_10017858 3300013307 Bacteria 7621
68 Ga0157372_10057229 3300013307 Bacteria 4358
69 Ga0157372_10083634 3300013307 Bacteria 3615
70 Ga0157372_10085103 3300013307 Bacteria 3586
71 Ga0157372_10119505 3300013307 Bacteria 3025
72 Ga0157372_10121945 3300013307 Bacteria 2995
73 Ga0157375_10226933 3300013308 Bacteria 2026
74 Ga0182008_10006734 3300014497 Bacteria 6396
75 Ga0182006_1000190 3300015261 Bacteria 63313
76 Ga0182006_1000669 3300015261 Bacteria 24090
77 Ga0182007_10000197 3300015262 Bacteria 40291
78 Ga0183373_1001 3300015682 Bacteria 1410374
79 Ga0163161_10000170 3300017792 Bacteria 59576
80 Ga0163161_10000206 3300017792 Bacteria 54119
81 Ga0206351_11009503 3300020077 Bacteria 3535
82 Ga0209674_102086 3300025226 Bacteria 4552
83 Ga0209437_100043 3300025233 Bacteria 440454
84 Ga0209233_1001955 3300025261 Bacteria 7843
85 Ga0209676_1000058 3300025292 Bacteria 345185
86 Ga0209564_1003439 3300025295 Bacteria 10829
87 Ga0209050_1000054 3300025298 Bacteria 345186
88 Ga0207647_10000043 3300025904 Bacteria 91109
89 Ga0207647_10000302 3300025904 Bacteria 40592
90 Ga0207645_10001515 3300025907 Bacteria 18982
91 Ga0207705_10004963 3300025909 Bacteria 9987
92 Ga0207705_10012602 3300025909 Bacteria 6103
93 Ga0207654_10003079 3300025911 Bacteria 8450
94 Ga0207654_10026210 3300025911 Bacteria 3154
95 Ga0207695_10001921 3300025913 Bacteria 32318
96 Ga0207671_10015298 3300025914 Bacteria 6018
97 Ga0207657_10004855 3300025919 Bacteria 14159
98 Ga0207657_10034533 3300025919 Bacteria 4545
99 Ga0207652_10006858 3300025921 Bacteria 9178
100 Ga0207694_10019367 3300025924 Bacteria 5145
101 Ga0207690_10064291 3300025932 Bacteria 2505
102 Ga0207690_10080272 3300025932 Bacteria 2276
103 Ga0207706_10000538 3300025933 Bacteria 40240
104 Ga0207686_10050231 3300025934 Bacteria 2593
105 Ga0207704_10004968 3300025938 Bacteria 6118
106 Ga0207661_10083422 3300025944 Bacteria 2645
107 Ga0207667_10039937 3300025949 Bacteria 4997
108 Ga0207667_10088557 3300025949 Bacteria 3201
109 Ga0207667_10255593 3300025949 Bacteria 1792
110 Ga0207678_10012477 3300026067 Bacteria 7464
111 Ga0207702_10047973 3300026078 Bacteria 3600
112 Ga0207648_10002167 3300026089 Bacteria 21343
113 Ga0207683_10039363 3300026121 Bacteria 4124
114 Ga0207698_10000765 3300026142 Bacteria 18704
115 Ga0207698_10022150 3300026142 Bacteria 4409
116 Ga0207698_10072622 3300026142 Bacteria 2736
117 Ga0307511_10002393 3300030521 Bacteria 19619
118 Ga0316183_1180191 3300030742 Bacteria 65717
119 Ga0316181_1193130 3300030744 Bacteria 19541
120 Ga0265327_10074916 3300031251 Bacteria 1685
121 Ga0265316_10029994 3300031344 Bacteria 4464
122 Ga0307509_10046821 3300031507 Unclassified 4654
123 Ga0307405_10000025 3300031731 Bacteria 123095
124 Ga0307407_10000016 3300031903 Bacteria 141499
125 Ga0307416_100000009 3300032002 Bacteria 374271
126 Ga0307416_100000036 3300032002 Bacteria 141505
127 Ga0307414_10046645 3300032004 Bacteria 2976
128 Ga0307510_10000536 3300033180 Bacteria 37853
129 Ga0373937_0030586 3300036401 Bacteria 4876
130 Ga0395899_0000150 3300037312 Bacteria 105946
131 Ga0395899_0000474 3300037312 Bacteria 45411
132 Ga0395899_0001451 3300037312 Bacteria 20221
133 Ga0395899_0009948 3300037312 Bacteria 7295
134 Ga0395899_0085579 3300037312 Unclassified 2290
135 Ga0395900_0000413 3300037418 Bacteria 61555
136 Ga0395900_0000602 3300037418 Bacteria 49161
137 Ga0395898_0007319 3300037466 Bacteria 11721
138 Ga0395898_0036844 3300037466 Bacteria 4854
139 Ga0395898_0149345 3300037466 Unclassified 2236
140 Ga0395905_0000188 3300037471 Bacteria 98070
141 Ga0395905_0002933 3300037471 Bacteria 18555
142 Ga0395901_0000611 3300038443 Bacteria 41511
143 Ga0395901_0007030 3300038443 Bacteria 11373
144 Ga0439448_0015761 3300042005 Unclassified 2292
145 Ga0451577_0000048 3300042876 Bacteria 309377
146 Ga0451577_0000433 3300042876 Bacteria 74789
147 Ga0451577_0001478 3300042876 Bacteria 31145
148 Ga0451577_0003005 3300042876 Bacteria 19218
149 Ga0451577_0008779 3300042876 Bacteria 9793
150 Ga0451577_0031457 3300042876 Bacteria 4788
151 Ga0453683_0000055 3300044673 Bacteria 192588
152 Ga0453683_0000186 3300044673 Bacteria 86082
153 Ga0453683_0000214 3300044673 Bacteria 77233
154 Ga0453683_0001627 3300044673 Bacteria 18859
155 Ga0453683_0010787 3300044673 Bacteria 6048
156 Ga0453683_0086464 3300044673 Unclassified 1964
157 Ga0453683_0087979 3300044673 Unclassified 1947
158 Ga0466966_0001498 3300044684 Bacteria 14986
159 Ga0466966_0002353 3300044684 Bacteria 12343
160 Ga0466961_0001629 3300044693 Bacteria 13934
161 Ga0466961_0017935 3300044693 Bacteria 4551
162 Ga0453684_0000161 3300044712 Bacteria 298175
163 Ga0453684_0000570 3300044712 Bacteria 137760
164 Ga0453684_0000766 3300044712 Bacteria 111429
165 Ga0453684_0000995 3300044712 Bacteria 92458
166 Ga0453684_0015226 3300044712 Bacteria 12198
167 Ga0453684_0015469 3300044712 Bacteria 12062
168 Ga0453684_0021264 3300044712 Bacteria 9708
169 Ga0453684_0037425 3300044712 Bacteria 6660
170 Ga0453684_0051770 3300044712 Bacteria 5377
171 Ga0453684_0060134 3300044712 Bacteria 4891
172 Ga0453684_0062285 3300044712 Bacteria 4779
173 Ga0453684_0103927 3300044712 Bacteria 3469
174 Ga0453684_0121329 3300044712 Bacteria 3155
175 Ga0453684_0148770 3300044712 Bacteria 2786
176 Ga0453684_0194709 3300044712 Bacteria 2368
177 Ga0466971_0003181 3300044719 Bacteria 7007
178 Ga0466959_0000462 3300045049 Bacteria 23654
179 Ga0466959_0058462 3300045049 Unclassified 2808
180 Ga0466959_0082010 3300045049 Bacteria 2324
181 Ga0451576_0000059 3300045051 Bacteria 296795
182 Ga0451576_0000095 3300045051 Bacteria 223485
183 Ga0451576_0000504 3300045051 Bacteria 85668
184 Ga0451576_0000689 3300045051 Bacteria 68784
185 Ga0451576_0001819 3300045051 Bacteria 34710
186 Ga0451576_0004689 3300045051 Bacteria 17583
187 Ga0451576_0005256 3300045051 Bacteria 16343
188 Ga0451576_0008893 3300045051 Bacteria 11718
189 Ga0451576_0020232 3300045051 Bacteria 7249
190 Ga0451576_0033587 3300045051 Bacteria 5453
191 Ga0451576_0101909 3300045051 Unclassified 2986
192 Ga0466958_0002398 3300045836 Bacteria 9387
193 Ga0466958_0018354 3300045836 Bacteria 4060
194 Ga0495638_0000086 3300046460 Bacteria 152781
195 Ga0495638_0014688 3300046460 Bacteria 5282
196 Ga0495650_0001594 3300046471 Bacteria 21229
197 Ga0495584_0001635 3300046491 Bacteria 13168
198 Ga0495596_0026799 3300046500 Unclassified 2321
199 Ga0495607_0022319 3300046501 Bacteria 3977
200 Ga0495583_0000456 3300046506 Bacteria 60762
201 Ga0495606_0008989 3300046507 Bacteria 8547
202 Ga0495606_0067080 3300046507 Bacteria 2273
203 Ga0495610_0000495 3300046512 Bacteria 40233
204 Ga0495616_0003315 3300046513 Bacteria 10341
205 Ga0495631_0005057 3300046518 Bacteria 6946
206 Ga0495643_0037542 3300046522 Bacteria 2656
207 Ga0495648_0000001 3300046524 Bacteria 696872
208 Ga0495666_0057760 3300046526 Bacteria 1857
209 Ga0495642_0000467 3300046528 Bacteria 21246
210 Ga0495609_0000030 3300046538 Bacteria 215885
211 Ga0495609_0000342 3300046538 Bacteria 41240
212 Ga0495622_0000094 3300046557 Bacteria 79405
213 Ga0495633_0000096 3300046558 Bacteria 118933
214 Ga0495633_0037495 3300046558 Bacteria 2319
215 Ga0495668_0000151 3300046616 Bacteria 105466
216 Ga0495611_0000182 3300046648 Bacteria 44769
217 Ga0495625_0000065 3300046660 Bacteria 173230
218 Ga0495661_0001850 3300046665 Bacteria 16904
219 Ga0495589_0000021 3300046794 Bacteria 197941
220 Ga0495683_0016821 3300047323 Bacteria 3795
221 Ga0495687_000360 3300047443 Bacteria 57082
222 Ga0495687_001909 3300047443 Bacteria 17895
223 Ga0495677_0000383 3300047445 Bacteria 18990
224 Ga0495626_0002942 3300048091 Bacteria 11337
225 Ga0496115_0104226 3300048918 Bacteria 2328
226 Ga0495678_000361 3300049459 Bacteria 46514
227 Ga0501034_0101886 3300049571 Unclassified 2865
228 Ga0501035_0124018 3300049822 Bacteria 2256
229 nmdc:mga0k408_34915_c1 3300050493 Bacteria 2881
230 nmdc:mga0k408_974_c2 3300050493 Bacteria 6264
231 Ga0500635_0000290 3300053080 Bacteria 18253
232 Ga0500608_005102 3300053122 Bacteria 5173
233 Ga0500608_016130 3300053122 Bacteria 3370
234 Ga0500622_0000547 3300053156 Bacteria 34632
235 Ga0466962_0004084 3300061719 Bacteria 6991

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0124018 Ga0501035_0124018_19_1302 413
2 3300013102 Ga0157371_10062914 Ga0157371_100629142 414
3 3300046526 Ga0495666_0057760 Ga0495666_0057760_56_1366 416
4 3300046522 Ga0495643_0037542 Ga0495643_0037542_1277_2626 419
5 3300044712 Ga0453684_0000995 Ga0453684_0000995_21205_22767 457
6 3300053156 Ga0500622_0000547 Ga0500622_0000547_24667_26169 457
7 3300013307 Ga0157372_10121945 Ga0157372_101219452 458
8 3300044684 Ga0466966_0001498 Ga0466966_0001498_11043_12614 460
9 3300044693 Ga0466961_0001629 Ga0466961_0001629_4420_5991 460
10 3300044719 Ga0466971_0003181 Ga0466971_0003181_945_2516 460
11 3300045049 Ga0466959_0000462 Ga0466959_0000462_12997_14568 460
12 3300045836 Ga0466958_0002398 Ga0466958_0002398_3410_4981 460
13 3300061719 Ga0466962_0004084 Ga0466962_0004084_4402_5973 460
14 3300031903 Ga0307407_10000016 Ga0307407_1000001612 466
15 3300032002 Ga0307416_100000036 Ga0307416_10000003612 466
16 3300046558 Ga0495633_0037495 Ga0495633_0037495_521_1990 466
17 3300046512 Ga0495610_0000495 Ga0495610_0000495_5126_6673 467
18 3300009174 Ga0105241_10001046 Ga0105241_100010462 471
19 3300009545 Ga0105237_10000993 Ga0105237_100009938 471
20 3300009551 Ga0105238_10012070 Ga0105238_100120703 471
21 3300013296 Ga0157374_10000599 Ga0157374_1000059914 471
22 3300042005 Ga0439448_0015761 Ga0439448_0015761_797_2248 471
23 3300045049 Ga0466959_0058462 Ga0466959_0058462_1131_2636 474
24 3300046665 Ga0495661_0001850 Ga0495661_0001850_3332_4918 476
25 3300053122 Ga0500608_005102 Ga0500608_005102_348_1859 476
26 3300013104 Ga0157370_10000471 Ga0157370_1000047116 477
27 3300032002 Ga0307416_100000009 Ga0307416_100000009113 477
28 3300032004 Ga0307414_10046645 Ga0307414_100466453 477
29 3300037312 Ga0395899_0001451 Ga0395899_0001451_11922_13472 477
30 3300037418 Ga0395900_0000602 Ga0395900_0000602_28359_29909 477
31 3300044673 Ga0453683_0087979 Ga0453683_0087979_135_1673 477
32 3300044712 Ga0453684_0037425 Ga0453684_0037425_4490_6028 477
33 3300045051 Ga0451576_0101909 Ga0451576_0101909_92_1630 477
34 3300046460 Ga0495638_0000086 Ga0495638_0000086_140195_141745 477
35 3300046471 Ga0495650_0001594 Ga0495650_0001594_17528_19078 477
36 3300046491 Ga0495584_0001635 Ga0495584_0001635_6672_8222 477
37 3300046500 Ga0495596_0026799 Ga0495596_0026799_14_1486 477
38 3300046501 Ga0495607_0022319 Ga0495607_0022319_1368_2918 477
39 3300046506 Ga0495583_0000456 Ga0495583_0000456_49353_50903 477
40 3300046513 Ga0495616_0003315 Ga0495616_0003315_1054_2604 477
41 3300046524 Ga0495648_0000001 Ga0495648_0000001_340916_342466 477
42 3300046528 Ga0495642_0000467 Ga0495642_0000467_3236_4786 477
43 3300046538 Ga0495609_0000030 Ga0495609_0000030_184428_185978 477
44 3300046538 Ga0495609_0000342 Ga0495609_0000342_23657_25207 477
45 3300046557 Ga0495622_0000094 Ga0495622_0000094_66915_68465 477
46 3300046558 Ga0495633_0000096 Ga0495633_0000096_73601_75151 477
47 3300046616 Ga0495668_0000151 Ga0495668_0000151_61752_63302 477
48 3300046660 Ga0495625_0000065 Ga0495625_0000065_42801_44351 477
49 3300046794 Ga0495589_0000021 Ga0495589_0000021_184603_186153 477
50 3300047443 Ga0495687_000360 Ga0495687_000360_29908_31458 477
51 3300047445 Ga0495677_0000383 Ga0495677_0000383_9097_10647 477
52 3300048091 Ga0495626_0002942 Ga0495626_0002942_717_2267 477
53 3300049459 Ga0495678_000361 Ga0495678_000361_18715_20265 477
54 3300031731 Ga0307405_10000025 Ga0307405_1000002536 478
55 3300013104 Ga0157370_10009496 Ga0157370_1000949610 479
56 3300037471 Ga0395905_0002933 Ga0395905_0002933_685_2223 479
57 3300042876 Ga0451577_0008779 Ga0451577_0008779_2927_4462 479
58 3300046460 Ga0495638_0014688 Ga0495638_0014688_464_2053 479
59 3300013100 Ga0157373_10037892 Ga0157373_100378923 480
60 3300013102 Ga0157371_10002379 Ga0157371_1000237911 480
61 3300013105 Ga0157369_10062792 Ga0157369_100627923 480
62 3300013307 Ga0157372_10085103 Ga0157372_100851032 480
63 3300025261 Ga0209233_1001955 Ga0209233_10019553 480
64 3300025904 Ga0207647_10000043 Ga0207647_1000004354 480
65 3300030521 Ga0307511_10002393 Ga0307511_1000239311 480
66 3300037312 Ga0395899_0009948 Ga0395899_0009948_3607_5169 480
67 3300037466 Ga0395898_0036844 Ga0395898_0036844_2905_4467 480
68 3300006195 Ga0075366_10070681 Ga0075366_100706811 481
69 3300025226 Ga0209674_102086 Ga0209674_1020862 481
70 3300050493 nmdc:mga0k408_974_c2 nmdc:mga0k408_974_c2_4659_6164 481
71 3300003771 Ga0055526_1009446 Ga0055526_10094462 482
72 3300005262 Ga0065165_1000920 Ga0065165_10009206 482
73 3300005288 Ga0065714_10064434 Ga0065714_1006443414 482
74 3300009174 Ga0105241_10049509 Ga0105241_100495091 482
75 3300013102 Ga0157371_10000016 Ga0157371_10000016250 482
76 3300013104 Ga0157370_10004387 Ga0157370_100043879 482
77 3300025295 Ga0209564_1003439 Ga0209564_10034392 482
78 3300042876 Ga0451577_0003005 Ga0451577_0003005_11869_13428 482
79 3300044673 Ga0453683_0000214 Ga0453683_0000214_33035_34687 482
80 3300050493 nmdc:mga0k408_34915_c1 nmdc:mga0k408_34915_c1_711_2285 482
81 iso_pu_bacteria 2738541302 2738851731 482
82 iso_pu_bacteria 2818991437 2819550028 482
83 iso_pu_bacteria 2842722452 2842726743 482
84 iso_pu_bacteria 2842909656 2842911585 482
85 iso_pu_bacteria 2849281842 2849286147 482
86 iso_pu_bacteria 2904445276 2904448609 482
87 iso_pu_bacteria 2945997725 2946001930 482
88 iso_pu_bacteria 2954016120 2954019812 482
89 3300013102 Ga0157371_10072567 Ga0157371_100725672 483
90 3300013104 Ga0157370_10000144 Ga0157370_1000014442 483
91 3300013105 Ga0157369_10000169 Ga0157369_1000016957 483
92 3300013307 Ga0157372_10083634 Ga0157372_100836344 483
93 3300013307 Ga0157372_10119505 Ga0157372_101195052 483
94 3300014497 Ga0182008_10006734 Ga0182008_100067345 483
95 3300015262 Ga0182007_10000197 Ga0182007_1000019724 483
96 3300015682 Ga0183373_1001 Ga0183373_1001201 483
97 3300017792 Ga0163161_10000206 Ga0163161_1000020614 483
98 3300030742 Ga0316183_1180191 Ga0316183_11801912 483
99 3300030744 Ga0316181_1193130 Ga0316181_11931304 483
100 3300031507 Ga0307509_10046821 Ga0307509_100468214 483
101 3300044712 Ga0453684_0015226 Ga0453684_0015226_10066_11625 484
102 3300005366 Ga0070659_100006931 Ga0070659_1000069311 485
103 3300005458 Ga0070681_10113175 Ga0070681_101131751 485
104 3300025932 Ga0207690_10080272 Ga0207690_100802722 485
105 3300025944 Ga0207661_10083422 Ga0207661_100834223 485
106 3300031251 Ga0265327_10074916 Ga0265327_100749161 485
107 3300042876 Ga0451577_0000433 Ga0451577_0000433_24909_26417 485
108 3300042876 Ga0451577_0001478 Ga0451577_0001478_12184_13707 485
109 3300044673 Ga0453683_0086464 Ga0453683_0086464_326_1834 485
110 3300044712 Ga0453684_0000570 Ga0453684_0000570_35394_36917 485
111 3300044712 Ga0453684_0015469 Ga0453684_0015469_4383_5891 485
112 3300045051 Ga0451576_0000095 Ga0451576_0000095_186571_188094 485
113 3300045051 Ga0451576_0000689 Ga0451576_0000689_44486_45994 485
114 3300053122 Ga0500608_016130 Ga0500608_016130_1081_2601 485
115 iso_pu_bacteria 2775506987 2776614469 485
116 3300003781 Ga0055536_1000007 Ga0055536_100000787 486
117 3300003791 Ga0055530_10004536 Ga0055530_100045366 486
118 3300005614 Ga0068856_100021438 Ga0068856_1000214382 486
119 3300010375 Ga0105239_10000016 Ga0105239_10000016178 486
120 3300013308 Ga0157375_10226933 Ga0157375_102269332 486
121 3300015261 Ga0182006_1000190 Ga0182006_100019032 486
122 3300015261 Ga0182006_1000669 Ga0182006_100066913 486
123 3300017792 Ga0163161_10000170 Ga0163161_1000017037 486
124 3300025292 Ga0209676_1000058 Ga0209676_100005884 486
125 3300025298 Ga0209050_1000054 Ga0209050_100005484 486
126 3300026078 Ga0207702_10047973 Ga0207702_100479732 486
127 3300044673 Ga0453683_0000055 Ga0453683_0000055_34434_35942 486
128 3300044712 Ga0453684_0051770 Ga0453684_0051770_2278_3837 486
129 3300045051 Ga0451576_0001819 Ga0451576_0001819_7163_8722 486
130 3300045051 Ga0451576_0004689 Ga0451576_0004689_11701_13209 486
131 3300045051 Ga0451576_0033587 Ga0451576_0033587_194_1702 486
132 3300046507 Ga0495606_0067080 Ga0495606_0067080_591_2108 486
133 3300047443 Ga0495687_001909 Ga0495687_001909_4451_5956 486
134 3300049571 Ga0501034_0101886 Ga0501034_0101886_1184_2692 486
135 3300053080 Ga0500635_0000290 Ga0500635_0000290_7764_9275 486
136 iso_pu_bacteria 2818991460 2819679180 486
137 3300010375 Ga0105239_10009494 Ga0105239_100094942 487
138 3300048918 Ga0496115_0104226 Ga0496115_0104226_266_1843 487
139 iso_pu_bacteria 2599185184 2599481060 487
140 iso_pu_bacteria 2928078545 2928083067 487
141 iso_pu_bacteria 2928147474 2928150088 487
142 iso_pu_bacteria 2932082852 2932086892 487
143 3300001990 JGI24737J22298_10020750 JGI24737J22298_100207502 488
144 3300005366 Ga0070659_100019550 Ga0070659_1000195502 488
145 3300005455 Ga0070663_100005641 Ga0070663_1000056413 488
146 3300005457 Ga0070662_100000145 Ga0070662_10000014514 488
147 3300009174 Ga0105241_10000251 Ga0105241_1000025113 488
148 3300013100 Ga0157373_10100055 Ga0157373_101000552 488
149 3300013102 Ga0157371_10030370 Ga0157371_100303703 488
150 3300013105 Ga0157369_10000500 Ga0157369_1000050020 488
151 3300013105 Ga0157369_10129869 Ga0157369_101298692 488
152 3300013296 Ga0157374_10000418 Ga0157374_1000041813 488
153 3300013307 Ga0157372_10000001 Ga0157372_10000001543 488
154 3300013307 Ga0157372_10057229 Ga0157372_100572292 488
155 3300020077 Ga0206351_11009503 Ga0206351_110095032 488
156 3300025904 Ga0207647_10000302 Ga0207647_1000030212 488
157 3300025911 Ga0207654_10003079 Ga0207654_100030795 488
158 3300025919 Ga0207657_10004855 Ga0207657_1000485510 488
159 3300025932 Ga0207690_10064291 Ga0207690_100642912 488
160 3300025933 Ga0207706_10000538 Ga0207706_1000053813 488
161 3300026067 Ga0207678_10012477 Ga0207678_100124773 488
162 3300037312 Ga0395899_0000150 Ga0395899_0000150_56233_57744 488
163 3300037312 Ga0395899_0000474 Ga0395899_0000474_28861_30408 488
164 3300037312 Ga0395899_0085579 Ga0395899_0085579_287_1804 488
165 3300037418 Ga0395900_0000413 Ga0395900_0000413_28865_30412 488
166 3300037466 Ga0395898_0007319 Ga0395898_0007319_2975_4522 488
167 3300037466 Ga0395898_0149345 Ga0395898_0149345_442_1959 488
168 3300037471 Ga0395905_0000188 Ga0395905_0000188_67659_69206 488
169 3300038443 Ga0395901_0000611 Ga0395901_0000611_11100_12647 488
170 3300038443 Ga0395901_0007030 Ga0395901_0007030_6877_8394 488
171 3300044684 Ga0466966_0002353 Ga0466966_0002353_808_2319 488
172 3300044693 Ga0466961_0017935 Ga0466961_0017935_2008_3519 488
173 3300044712 Ga0453684_0021264 Ga0453684_0021264_8087_9640 488
174 3300045051 Ga0451576_0008893 Ga0451576_0008893_7991_9541 488
175 3300045836 Ga0466958_0018354 Ga0466958_0018354_2508_4019 488
176 3300046507 Ga0495606_0008989 Ga0495606_0008989_5535_7064 488
177 3300033180 Ga0307510_10000536 Ga0307510_100005369 489
178 3300042876 Ga0451577_0000048 Ga0451577_0000048_104426_105982 489
179 3300044673 Ga0453683_0001627 Ga0453683_0001627_9427_10983 489
180 3300044712 Ga0453684_0000161 Ga0453684_0000161_93224_94780 489
181 3300044712 Ga0453684_0121329 Ga0453684_0121329_1489_3003 489
182 3300045051 Ga0451576_0000059 Ga0451576_0000059_203396_204952 489
183 3300046518 Ga0495631_0005057 Ga0495631_0005057_3171_4682 489
184 3300047323 Ga0495683_0016821 Ga0495683_0016821_913_2424 489
185 3300003320 rootH2_10153958 rootH2_101539583 490
186 3300005327 Ga0070658_10017507 Ga0070658_100175072 490
187 3300005327 Ga0070658_10036402 Ga0070658_100364024 490
188 3300005336 Ga0070680_100013159 Ga0070680_1000131593 490
189 3300005339 Ga0070660_100045596 Ga0070660_1000455963 490
190 3300005530 Ga0070679_100000473 Ga0070679_10000047320 490
191 3300005616 Ga0068852_100004531 Ga0068852_1000045316 490
192 3300009093 Ga0105240_10225838 Ga0105240_102258381 490
193 3300013100 Ga0157373_10040006 Ga0157373_100400062 490
194 3300013102 Ga0157371_10086448 Ga0157371_100864481 490
195 3300013104 Ga0157370_10184896 Ga0157370_101848961 490
196 3300025909 Ga0207705_10004963 Ga0207705_100049632 490
197 3300025909 Ga0207705_10012602 Ga0207705_100126023 490
198 3300025919 Ga0207657_10034533 Ga0207657_100345333 490
199 3300025921 Ga0207652_10006858 Ga0207652_100068585 490
200 3300025949 Ga0207667_10039937 Ga0207667_100399372 490
201 3300025949 Ga0207667_10255593 Ga0207667_102555932 490
202 3300026142 Ga0207698_10022150 Ga0207698_100221503 490
203 3300026142 Ga0207698_10072622 Ga0207698_100726222 490
204 3300031344 Ga0265316_10029994 Ga0265316_100299942 490
205 3300036401 Ga0373937_0030586 Ga0373937_0030586_1443_2954 490
206 3300042876 Ga0451577_0031457 Ga0451577_0031457_3169_4752 490
207 3300044673 Ga0453683_0000186 Ga0453683_0000186_55338_56855 490
208 3300044673 Ga0453683_0010787 Ga0453683_0010787_1118_2653 490
209 3300044712 Ga0453684_0000766 Ga0453684_0000766_89190_90752 490
210 3300044712 Ga0453684_0060134 Ga0453684_0060134_1752_3269 490
211 3300044712 Ga0453684_0062285 Ga0453684_0062285_2476_3993 490
212 3300044712 Ga0453684_0103927 Ga0453684_0103927_16_1599 490
213 3300044712 Ga0453684_0194709 Ga0453684_0194709_797_2314 490
214 3300045051 Ga0451576_0000504 Ga0451576_0000504_63064_64581 490
215 3300045051 Ga0451576_0005256 Ga0451576_0005256_7250_8767 490
216 3300045051 Ga0451576_0020232 Ga0451576_0020232_3340_5013 490
217 3300001989 JGI24739J22299_10023631 JGI24739J22299_100236312 491
218 3300001990 JGI24737J22298_10000310 JGI24737J22298_100003109 491
219 3300002067 JGI24735J21928_10000010 JGI24735J21928_10000010197 491
220 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005252 491
221 3300005328 Ga0070676_10003789 Ga0070676_100037892 491
222 3300005338 Ga0068868_100019029 Ga0068868_1000190295 491
223 3300005364 Ga0070673_100001414 Ga0070673_1000014142 491
224 3300005456 Ga0070678_100012425 Ga0070678_1000124253 491
225 3300005459 Ga0068867_100000856 Ga0068867_1000008563 491
226 3300005563 Ga0068855_100107992 Ga0068855_1001079921 491
227 3300005616 Ga0068852_100000306 Ga0068852_10000030618 491
228 3300006237 Ga0097621_100000369 Ga0097621_1000003697 491
229 3300006358 Ga0068871_100000513 Ga0068871_1000005137 491
230 3300006881 Ga0068865_100000310 Ga0068865_10000031017 491
231 3300009093 Ga0105240_10029281 Ga0105240_100292815 491
232 3300010375 Ga0105239_10000032 Ga0105239_1000003294 491
233 3300013102 Ga0157371_10013314 Ga0157371_100133143 491
234 3300013307 Ga0157372_10017858 Ga0157372_100178586 491
235 3300025233 Ga0209437_100043 Ga0209437_100043155 491
236 3300025907 Ga0207645_10001515 Ga0207645_100015152 491
237 3300025911 Ga0207654_10026210 Ga0207654_100262102 491
238 3300025913 Ga0207695_10001921 Ga0207695_100019215 491
239 3300025914 Ga0207671_10015298 Ga0207671_100152982 491
240 3300025924 Ga0207694_10019367 Ga0207694_100193672 491
241 3300025934 Ga0207686_10050231 Ga0207686_100502311 491
242 3300025938 Ga0207704_10004968 Ga0207704_100049682 491
243 3300025949 Ga0207667_10088557 Ga0207667_100885572 491
244 3300026089 Ga0207648_10002167 Ga0207648_100021675 491
245 3300026121 Ga0207683_10039363 Ga0207683_100393631 491
246 3300026142 Ga0207698_10000765 Ga0207698_100007658 491
247 3300044712 Ga0453684_0148770 Ga0453684_0148770_1130_2719 491
248 3300045049 Ga0466959_0082010 Ga0466959_0082010_235_1746 491
249 3300046648 Ga0495611_0000182 Ga0495611_0000182_18024_19655 491

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01120

Alpha_L_fucos

Alpha-L-fucosidase

61

438

0.88

PF16757

Fucosidase_C

Alpha-L-fucosidase C-terminal domain

470

554

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lk7-assembly1.cif.gz_A structure of the exo-alpha-l-galactosidase bpgh29 from bacteroides plebeius in complex with l-galactose 0.8641 31 489
7lnp-assembly2.cif.gz_C structure of the exo-alpha-l-galactosidase bpgh29 (d264n mutant) from bacteroides plebeius in complex with paranitrophenyl-alpha-l-galactopyranoside 0.8571 25 489
7snk-assembly1.cif.gz_A structure of bacple_01702, a gh29 family glycoside hydrolase 0.8484 33 489
7ljj-assembly1.cif.gz_A structure of the exo-alpha-l-galactosidase bpgh29 from bacteroides plebeius 0.8457 33 489
7lnp-assembly4.cif.gz_E structure of the exo-alpha-l-galactosidase bpgh29 (d264n mutant) from bacteroides plebeius in complex with paranitrophenyl-alpha-l-galactopyranoside 0.8456 30 489
ID Description Score Start End Superfamily
4pspA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7817 32 376 3.20.20.80
1hl9B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7668 34 376 3.20.20.80
1hl9B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7625 34 376 3.20.20.80
4pspA02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7498 378 489 2.60.40.1180
af_Q551C1_18_358_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7496 32 372 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A364WF27-F1-model_v4 deleted 0.965 24 491
AF-A0A7X9D8H1-F1-model_v4 Alpha-L-fucosidase 0.953 275 490 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A7V5U959-F1-model_v4 Alpha-L-fucosidase 0.9512 24 389 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A522SKP2-F1-model_v4 Alpha-L-fucosidase 0.9505 24 491 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A7V6BDQ5-F1-model_v4 Alpha-L-fucosidase 0.941 24 337 GO:0004560
GO:0005764
GO:0006004
GO:0016139

Feature Viewer

pLDDT pTM Quality
87.51 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map