F359234

General Info

Members Datasets Scaffolds Average Seq Length
247 148 239 301

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0032378|Ga0451577_0032378_3390_4376
Length 328
Sequence LRQAWRDSIKLFIDDKYVELIFIVSPGETVDRFLEMQTFNAVVDAGSFVKAADALNLSKAAVSRYVVDMETRLGVRLLHRTTRRLSLTEEGQVFYARSKELLAELDEAEAEITSRSDAASGLLRVNAPVTFGILHLAPLWGVFRAHNPKVTLDITLSDRVVDLVEDGYDLAIRIGLLDNSTLVSRQLSTTGLVLCASPQYLRTHGTPIHPSELAHHAVIAYSYWSGRDEWRFDGPQGPVSVTTQPCIRTNNGDTCRAAALAHQGVILQPSFLVGQDLAQGTLVTLLPEFRSVELGIYAIYPTRKHVSAKVRMLIDFLAGQLAGRGPGW

Samples

Sample ID Description Type Environment
1 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
4 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
5 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
6 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
7 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
60 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
67 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
68 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
72 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
73 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
85 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
86 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
124 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
135 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
136 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
137 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
138 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
139 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
140 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
141 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
146 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
147 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
148 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.31
Nodule 0.81
Rhizoplane 0.4
Rhizosphere 78.54
Stem 0
Stem Tuber 0
Unclassified 10.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055529_1001112 3300003763 Bacteria 11858
2 Ga0070660_100035982 3300005339 Bacteria 3748
3 Ga0070673_100230271 3300005364 Bacteria 1607
4 Ga0070659_100130989 3300005366 Bacteria 2037
5 Ga0070681_10111628 3300005458 Bacteria 2673
6 Ga0068855_100241139 3300005563 Bacteria 2020
7 Ga0068862_100009085 3300005844 Bacteria 8226
8 Ga0075366_10099989 3300006195 Bacteria 1740
9 Ga0075366_10116649 3300006195 Bacteria 1608
10 Ga0075429_100009609 3300006880 Bacteria 8388
11 Ga0105251_10000032 3300009011 Bacteria 120825
12 Ga0105240_10047717 3300009093 Bacteria 5418
13 Ga0114129_10026544 3300009147 Bacteria 8202
14 Ga0105237_10043277 3300009545 Bacteria 4537
15 Ga0105238_10018981 3300009551 Bacteria 7003
16 Ga0105238_10034468 3300009551 Bacteria 5150
17 Ga0105249_10063168 3300009553 Bacteria 3401
18 Ga0105239_10397532 3300010375 Unclassified 1559
19 Ga0157371_10065844 3300013102 Bacteria 2566
20 Ga0157370_10004825 3300013104 Bacteria 15333
21 Ga0157372_10092884 3300013307 Bacteria 3433
22 Ga0163163_10183329 3300014325 Bacteria 2141
23 Ga0182008_10059536 3300014497 Bacteria 1885
24 Ga0157379_10154740 3300014968 Bacteria 2068
25 Ga0157376_10438414 3300014969 Bacteria 1271
26 Ga0209672_106488 3300025228 Bacteria 1894
27 Ga0209455_1001125 3300025272 Bacteria 12990
28 Ga0207713_1000020 3300025735 Bacteria 359258
29 Ga0207695_10040566 3300025913 Bacteria 4989
30 Ga0207671_10036199 3300025914 Bacteria 3659
31 Ga0207657_10019886 3300025919 Bacteria 6362
32 Ga0207694_10068311 3300025924 Bacteria 2775
33 Ga0207698_10340885 3300026142 Bacteria 1412
34 Ga0268266_10007695 3300028379 Bacteria 9673
35 Ga0268266_10304168 3300028379 Bacteria 1488
36 Ga0268265_10006028 3300028380 Bacteria 8247
37 Ga0307517_10000160 3300028786 Bacteria 108370
38 Ga0307517_10027704 3300028786 Bacteria 6792
39 Ga0307517_10055067 3300028786 Bacteria 3915
40 Ga0307515_10065288 3300028794 Bacteria 5069
41 Ga0307512_10044649 3300030522 Bacteria 3640
42 Ga0307512_10096892 3300030522 Unclassified 2021
43 Ga0265332_10000015 3300031238 Bacteria 243944
44 Ga0265332_10000021 3300031238 Bacteria 217090
45 Ga0307513_10407846 3300031456 Bacteria 1092
46 Ga0307509_10000317 3300031507 Bacteria 79032
47 Ga0307509_10000365 3300031507 Bacteria 76187
48 Ga0307509_10001515 3300031507 Bacteria 39177
49 Ga0307509_10130152 3300031507 Bacteria 2474
50 Ga0307509_10299027 3300031507 Bacteria 1359
51 Ga0307508_10000030 3300031616 Bacteria 165616
52 Ga0307514_10006907 3300031649 Bacteria 9829
53 Ga0307514_10077836 3300031649 Bacteria 2465
54 Ga0307516_10040759 3300031730 Bacteria 4620
55 Ga0307414_10003643 3300032004 Bacteria 8254
56 Ga0307414_10228604 3300032004 Bacteria 1532
57 Ga0307507_10003609 3300033179 Bacteria 29424
58 Ga0307507_10032435 3300033179 Bacteria 5452
59 Ga0307510_10000001 3300033180 Bacteria 1172244
60 Ga0307510_10008254 3300033180 Bacteria 12408
61 Ga0307510_10024130 3300033180 Bacteria 7033
62 Ga0373944_0011666 3300035089 Bacteria 2411
63 Ga0316574_0095920 3300035398 Bacteria 1895
64 Ga0316584_0011268 3300036712 Bacteria 6277
65 Ga0373925_0028319 3300037068 Bacteria 4104
66 Ga0395905_0061385 3300037471 Bacteria 3516
67 Ga0395905_0160369 3300037471 Bacteria 2114
68 Ga0395901_0021918 3300038443 Bacteria 6549
69 Ga0451853_2764788 3300041512 Bacteria 1207
70 Ga0450914_001189 3300042118 Unclassified 1561
71 Ga0451577_0032378 3300042876 Bacteria 4710
72 Ga0451577_0253882 3300042876 Bacteria 1592
73 Ga0453683_0004160 3300044673 Bacteria 10361
74 Ga0466965_0003043 3300044683 Bacteria 7295
75 Ga0466960_0003470 3300044901 Bacteria 6065
76 Ga0451576_0002708 3300045051 Bacteria 25749
77 Ga0451576_0131965 3300045051 Bacteria 2604
78 Ga0495617_000129 3300046452 Bacteria 50053
79 Ga0495617_000788 3300046452 Bacteria 15320
80 Ga0495590_0001484 3300046457 Bacteria 10114
81 Ga0495591_000348 3300046458 Bacteria 40857
82 Ga0495591_002255 3300046458 Bacteria 10990
83 Ga0495591_002353 3300046458 Bacteria 10626
84 Ga0495591_003743 3300046458 Bacteria 7697
85 Ga0495638_0000621 3300046460 Bacteria 39333
86 Ga0495638_0005774 3300046460 Bacteria 9115
87 Ga0495638_0017093 3300046460 Bacteria 4844
88 Ga0495638_0168768 3300046460 Bacteria 1257
89 Ga0495651_0002405 3300046462 Bacteria 14452
90 Ga0495650_0000180 3300046471 Bacteria 137884
91 Ga0495650_0000213 3300046471 Bacteria 123910
92 Ga0495650_0008988 3300046471 Bacteria 5745
93 Ga0495650_0011321 3300046471 Bacteria 4897
94 Ga0495605_0000011 3300046474 Bacteria 314856
95 Ga0495605_0000272 3300046474 Bacteria 58560
96 Ga0495605_0051517 3300046474 Bacteria 2004
97 Ga0495584_0001248 3300046491 Bacteria 15535
98 Ga0495584_0002131 3300046491 Bacteria 11327
99 Ga0495585_0000533 3300046492 Bacteria 35989
100 Ga0495594_0002003 3300046499 Bacteria 10611
101 Ga0495596_0004989 3300046500 Bacteria 6355
102 Ga0495607_0002662 3300046501 Bacteria 14308
103 Ga0495607_0002673 3300046501 Bacteria 14249
104 Ga0495607_0012707 3300046501 Bacteria 5544
105 Ga0495607_0040064 3300046501 Bacteria 2792
106 Ga0495583_0000114 3300046506 Bacteria 136026
107 Ga0495583_0000118 3300046506 Bacteria 133498
108 Ga0495583_0004799 3300046506 Bacteria 9481
109 Ga0495583_0004985 3300046506 Bacteria 9209
110 Ga0495606_0001305 3300046507 Bacteria 34342
111 Ga0495606_0009405 3300046507 Bacteria 8274
112 Ga0495606_0073879 3300046507 Bacteria 2137
113 Ga0495606_0175611 3300046507 Bacteria 1239
114 Ga0495610_0001041 3300046512 Bacteria 25468
115 Ga0495610_0004558 3300046512 Bacteria 10189
116 Ga0495616_0062862 3300046513 Bacteria 1816
117 Ga0495620_0000203 3300046515 Bacteria 44714
118 Ga0495620_0005736 3300046515 Bacteria 6904
119 Ga0495620_0008679 3300046515 Bacteria 5444
120 Ga0495628_0068063 3300046516 Bacteria 2779
121 Ga0495631_0007089 3300046518 Bacteria 5731
122 Ga0495631_0020233 3300046518 Bacteria 3111
123 Ga0495632_0001061 3300046519 Bacteria 23597
124 Ga0495632_0001440 3300046519 Bacteria 19816
125 Ga0495632_0028767 3300046519 Bacteria 2899
126 Ga0495637_0000081 3300046520 Bacteria 74206
127 Ga0495637_0001006 3300046520 Bacteria 17776
128 Ga0495637_0008050 3300046520 Bacteria 5190
129 Ga0495643_0004340 3300046522 Bacteria 9951
130 Ga0495648_0000505 3300046524 Bacteria 41982
131 Ga0495648_0000793 3300046524 Bacteria 33549
132 Ga0495648_0002051 3300046524 Bacteria 19107
133 Ga0495648_0002378 3300046524 Bacteria 17468
134 Ga0495648_0027921 3300046524 Bacteria 3768
135 Ga0495648_0220065 3300046524 Bacteria 937
136 Ga0495666_0005550 3300046526 Bacteria 6355
137 Ga0495652_0054296 3300046529 Bacteria 3412
138 Ga0495654_0001513 3300046530 Bacteria 15863
139 Ga0495654_0004332 3300046530 Bacteria 8458
140 Ga0495654_0017818 3300046530 Bacteria 3727
141 Ga0495609_0000013 3300046538 Bacteria 328540
142 Ga0495609_0000270 3300046538 Bacteria 48509
143 Ga0495609_0003410 3300046538 Bacteria 9117
144 Ga0495609_0102301 3300046538 Bacteria 1241
145 Ga0495597_0001224 3300046542 Bacteria 19111
146 Ga0495597_0004482 3300046542 Bacteria 7659
147 Ga0495622_0013056 3300046557 Bacteria 3854
148 Ga0495633_0000010 3300046558 Bacteria 280844
149 Ga0495668_0005116 3300046616 Bacteria 9017
150 Ga0495668_0021769 3300046616 Bacteria 3670
151 Ga0495611_0000541 3300046648 Bacteria 22183
152 Ga0495611_0003806 3300046648 Bacteria 6581
153 Ga0495625_0000016 3300046660 Bacteria 311353
154 Ga0495625_0001103 3300046660 Bacteria 35026
155 Ga0495625_0015868 3300046660 Bacteria 5946
156 Ga0495661_0000001 3300046665 Bacteria 898372
157 Ga0495661_0000005 3300046665 Bacteria 433622
158 Ga0495661_0001594 3300046665 Bacteria 18676
159 Ga0495599_0161532 3300046678 Bacteria 1384
160 Ga0495623_0011290 3300046679 Bacteria 5778
161 Ga0495623_0167845 3300046679 Bacteria 1285
162 Ga0495646_0020919 3300046680 Bacteria 4137
163 Ga0495624_0001109 3300046690 Bacteria 21303
164 Ga0495670_0000018 3300046691 Bacteria 115019
165 Ga0495670_0000206 3300046691 Bacteria 26640
166 Ga0495671_0000540 3300046692 Bacteria 28569
167 Ga0495671_0008227 3300046692 Bacteria 5883
168 Ga0495671_0012991 3300046692 Bacteria 4529
169 Ga0495671_0017067 3300046692 Bacteria 3865
170 Ga0495671_0076616 3300046692 Unclassified 1640
171 Ga0495649_0004389 3300046694 Bacteria 9226
172 Ga0495589_0000440 3300046794 Bacteria 30537
173 Ga0495589_0000793 3300046794 Bacteria 20055
174 Ga0495589_0001491 3300046794 Bacteria 13467
175 Ga0495660_0000414 3300046810 Bacteria 36352
176 Ga0495660_0002936 3300046810 Bacteria 10673
177 Ga0495660_0022442 3300046810 Bacteria 3604
178 Ga0495604_0239484 3300047317 Bacteria 1241
179 Ga0495674_0333522 3300047319 Bacteria 1234
180 Ga0495672_0000322 3300047320 Bacteria 63657
181 Ga0495672_0001369 3300047320 Bacteria 24135
182 Ga0495672_0003238 3300047320 Bacteria 14133
183 Ga0495672_0020275 3300047320 Bacteria 4363
184 Ga0495672_0081291 3300047320 Bacteria 1805
185 Ga0495676_0000001 3300047321 Bacteria 624167
186 Ga0495680_0015609 3300047322 Bacteria 6549
187 Ga0495680_0304552 3300047322 Bacteria 1118
188 Ga0495683_0000031 3300047323 Bacteria 150363
189 Ga0495683_0000456 3300047323 Bacteria 32056
190 Ga0495675_0167553 3300047444 Bacteria 1350
191 Ga0495679_000053 3300047446 Bacteria 119015
192 Ga0495679_000239 3300047446 Bacteria 45720
193 Ga0495679_000278 3300047446 Bacteria 42823
194 Ga0495673_0000077 3300047469 Bacteria 204403
195 Ga0495673_0000477 3300047469 Bacteria 43268
196 Ga0495673_0001240 3300047469 Bacteria 21134
197 Ga0495673_0006861 3300047469 Bacteria 6637
198 Ga0495681_0000116 3300047470 Bacteria 69786
199 Ga0495681_0000487 3300047470 Bacteria 30516
200 Ga0495681_0016955 3300047470 Bacteria 4062
201 Ga0495686_0003734 3300047472 Bacteria 12982
202 Ga0495686_0046348 3300047472 Bacteria 2748
203 Ga0495602_0077306 3300048088 Bacteria 2816
204 Ga0495602_0246224 3300048088 Bacteria 1334
205 Ga0495626_0000002 3300048091 Bacteria 436012
206 Ga0495626_0000119 3300048091 Bacteria 102920
207 Ga0495626_0000185 3300048091 Bacteria 75817
208 Ga0495626_0080417 3300048091 Bacteria 1449
209 Ga0495626_0108682 3300048091 Bacteria 1203
210 Ga0496122_0046196 3300048925 Bacteria 3375
211 Ga0495678_000008 3300049459 Bacteria 445926
212 Ga0495678_000375 3300049459 Bacteria 45295
213 Ga0495678_002914 3300049459 Bacteria 10987
214 Ga0495678_071822 3300049459 Bacteria 1266
215 Ga0495682_0010668 3300049460 Bacteria 3549
216 Ga0501031_0001706 3300049568 Bacteria 13795
217 Ga0501035_0010751 3300049822 Bacteria 8473
218 nmdc:mga00v17_246889_c1 3300050491 Bacteria 1157
219 nmdc:mga0k408_39173_c1 3300050493 Bacteria 2722
220 nmdc:mga07m45_104496_c1 3300050496 Bacteria 1628
221 nmdc:mga05p37_606564_c1 3300050507 Bacteria 1235
222 nmdc:mga09592_3525_c1 3300050508 Bacteria 12643
223 nmdc:mga0qj67_23869_c1 3300050509 Bacteria 4710
224 nmdc:mga06r32_57695_c1 3300050510 Bacteria 3730
225 Ga0500583_0001775 3300053092 Bacteria 6312
226 Ga0500583_0005378 3300053092 Bacteria 4287
227 Ga0500562_009500 3300053108 Bacteria 2456
228 Ga0500594_0006385 3300053118 Bacteria 2646
229 Ga0500618_004279 3300053125 Bacteria 4623
230 Ga0500642_0138639 3300053130 Unclassified 1141
231 Ga0500652_020643 3300053131 Bacteria 2468
232 Ga0500559_0001694 3300053136 Bacteria 12147
233 Ga0500564_025652 3300053138 Bacteria 2708
234 Ga0500568_0048415 3300053139 Bacteria 1681
235 Ga0500619_001693 3300053154 Bacteria 3995
236 Ga0500622_0000656 3300053156 Bacteria 30810
237 Ga0500636_0103497 3300053177 Bacteria 1616
238 Ga0500645_014637 3300053730 Bacteria 2497
239 Ga0500587_000916 3300053739 Bacteria 3936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10438414 Ga0157376_104384142 270
2 3300014497 Ga0182008_10059536 Ga0182008_100595363 281
3 3300031507 Ga0307509_10000365 Ga0307509_1000036535 284
4 3300046460 Ga0495638_0005774 Ga0495638_0005774_2202_3110 285
5 3300046660 Ga0495625_0015868 Ga0495625_0015868_928_1836 285
6 3300031456 Ga0307513_10407846 Ga0307513_104078461 291
7 3300005458 Ga0070681_10111628 Ga0070681_101116284 293
8 3300005563 Ga0068855_100241139 Ga0068855_1002411393 293
9 3300046460 Ga0495638_0168768 Ga0495638_0168768_180_1061 293
10 3300048925 Ga0496122_0046196 Ga0496122_0046196_756_1637 293
11 3300050491 nmdc:mga00v17_246889_c1 nmdc:mga00v17_246889_c1_85_966 293
12 iso_pu_bacteria 2887375801 2887376382 293
13 3300006195 Ga0075366_10116649 Ga0075366_101166492 294
14 3300048088 Ga0495602_0246224 Ga0495602_0246224_13_915 294
15 3300053130 Ga0500642_0138639 Ga0500642_0138639_16_900 294
16 3300046794 Ga0495589_0000440 Ga0495589_0000440_7516_8403 295
17 iso_pu_bacteria 2547132512 2548847945 295
18 iso_pu_bacteria 2857576091 2857577150 295
19 3300046794 Ga0495589_0001491 Ga0495589_0001491_1524_2414 296
20 iso_pu_bacteria 2513237083 2513562313 296
21 iso_pu_bacteria 2600255389 2602007901 296
22 iso_pu_bacteria 2738543020 2739285595 296
23 iso_pu_bacteria 2738543021 2739290908 296
24 iso_pu_bacteria 8003955200 8003958986 296
25 3300006195 Ga0075366_10099989 Ga0075366_100999892 297
26 3300031238 Ga0265332_10000015 Ga0265332_10000015150 297
27 3300042876 Ga0451577_0032378 Ga0451577_0032378_3390_4376 297
28 3300042876 Ga0451577_0253882 Ga0451577_0253882_36_935 297
29 3300044673 Ga0453683_0004160 Ga0453683_0004160_3246_4232 297
30 3300045051 Ga0451576_0002708 Ga0451576_0002708_15819_16805 297
31 3300050496 nmdc:mga07m45_104496_c1 nmdc:mga07m45_104496_c1_360_1259 297
32 3300028786 Ga0307517_10000160 Ga0307517_1000016032 298
33 3300028786 Ga0307517_10027704 Ga0307517_100277049 298
34 3300028786 Ga0307517_10055067 Ga0307517_100550675 298
35 3300028794 Ga0307515_10065288 Ga0307515_100652884 298
36 3300030522 Ga0307512_10044649 Ga0307512_100446495 298
37 3300030522 Ga0307512_10096892 Ga0307512_100968922 298
38 3300031507 Ga0307509_10000317 Ga0307509_1000031734 298
39 3300031507 Ga0307509_10001515 Ga0307509_1000151534 298
40 3300031507 Ga0307509_10130152 Ga0307509_101301523 298
41 3300031507 Ga0307509_10299027 Ga0307509_102990271 298
42 3300031616 Ga0307508_10000030 Ga0307508_10000030111 298
43 3300031649 Ga0307514_10006907 Ga0307514_100069077 298
44 3300031649 Ga0307514_10077836 Ga0307514_100778363 298
45 3300031730 Ga0307516_10040759 Ga0307516_100407592 298
46 3300033179 Ga0307507_10003609 Ga0307507_1000360916 298
47 3300033179 Ga0307507_10032435 Ga0307507_100324356 298
48 3300033180 Ga0307510_10008254 Ga0307510_1000825413 298
49 3300042118 Ga0450914_001189 Ga0450914_001189_275_1171 298
50 3300053092 Ga0500583_0005378 Ga0500583_0005378_1821_2717 298
51 3300053108 Ga0500562_009500 Ga0500562_009500_493_1389 298
52 3300053118 Ga0500594_0006385 Ga0500594_0006385_999_1931 298
53 3300053131 Ga0500652_020643 Ga0500652_020643_151_1083 298
54 3300053136 Ga0500559_0001694 Ga0500559_0001694_399_1331 298
55 3300053138 Ga0500564_025652 Ga0500564_025652_457_1389 298
56 3300053139 Ga0500568_0048415 Ga0500568_0048415_361_1257 298
57 3300053154 Ga0500619_001693 Ga0500619_001693_2981_3913 298
58 3300053156 Ga0500622_0000656 Ga0500622_0000656_9000_9932 298
59 3300053177 Ga0500636_0103497 Ga0500636_0103497_151_1083 298
60 3300053739 Ga0500587_000916 Ga0500587_000916_1679_2575 298
61 3300009011 Ga0105251_10000032 Ga0105251_1000003277 299
62 3300025735 Ga0207713_1000020 Ga0207713_1000020298 299
63 3300031238 Ga0265332_10000021 Ga0265332_1000002125 299
64 3300035089 Ga0373944_0011666 Ga0373944_0011666_1491_2390 299
65 3300035398 Ga0316574_0095920 Ga0316574_0095920_984_1883 299
66 3300037068 Ga0373925_0028319 Ga0373925_0028319_2827_3726 299
67 3300037471 Ga0395905_0061385 Ga0395905_0061385_713_1612 299
68 3300044683 Ga0466965_0003043 Ga0466965_0003043_2691_3590 299
69 3300044901 Ga0466960_0003470 Ga0466960_0003470_1406_2305 299
70 3300046452 Ga0495617_000129 Ga0495617_000129_40044_40943 299
71 3300046452 Ga0495617_000788 Ga0495617_000788_14342_15241 299
72 3300046457 Ga0495590_0001484 Ga0495590_0001484_8369_9268 299
73 3300046458 Ga0495591_000348 Ga0495591_000348_2343_3242 299
74 3300046458 Ga0495591_002255 Ga0495591_002255_3545_4444 299
75 3300046458 Ga0495591_002353 Ga0495591_002353_211_1110 299
76 3300046458 Ga0495591_003743 Ga0495591_003743_3576_4475 299
77 3300046460 Ga0495638_0000621 Ga0495638_0000621_32681_33580 299
78 3300046460 Ga0495638_0017093 Ga0495638_0017093_2010_2909 299
79 3300046471 Ga0495650_0000180 Ga0495650_0000180_31424_32323 299
80 3300046471 Ga0495650_0008988 Ga0495650_0008988_3746_4645 299
81 3300046471 Ga0495650_0011321 Ga0495650_0011321_901_1800 299
82 3300046474 Ga0495605_0000011 Ga0495605_0000011_3081_3980 299
83 3300046474 Ga0495605_0000272 Ga0495605_0000272_28550_29449 299
84 3300046474 Ga0495605_0051517 Ga0495605_0051517_846_1745 299
85 3300046491 Ga0495584_0001248 Ga0495584_0001248_7064_7963 299
86 3300046491 Ga0495584_0002131 Ga0495584_0002131_2953_3852 299
87 3300046492 Ga0495585_0000533 Ga0495585_0000533_28921_29820 299
88 3300046499 Ga0495594_0002003 Ga0495594_0002003_6831_7730 299
89 3300046500 Ga0495596_0004989 Ga0495596_0004989_1144_2043 299
90 3300046501 Ga0495607_0002662 Ga0495607_0002662_11751_12650 299
91 3300046501 Ga0495607_0002673 Ga0495607_0002673_3446_4345 299
92 3300046501 Ga0495607_0012707 Ga0495607_0012707_1326_2225 299
93 3300046501 Ga0495607_0040064 Ga0495607_0040064_197_1099 299
94 3300046506 Ga0495583_0000114 Ga0495583_0000114_31788_32687 299
95 3300046506 Ga0495583_0000118 Ga0495583_0000118_98405_99304 299
96 3300046506 Ga0495583_0004799 Ga0495583_0004799_5607_6509 299
97 3300046506 Ga0495583_0004985 Ga0495583_0004985_4720_5619 299
98 3300046507 Ga0495606_0001305 Ga0495606_0001305_31841_32740 299
99 3300046507 Ga0495606_0009405 Ga0495606_0009405_5257_6156 299
100 3300046507 Ga0495606_0073879 Ga0495606_0073879_943_1842 299
101 3300046507 Ga0495606_0175611 Ga0495606_0175611_183_1082 299
102 3300046512 Ga0495610_0001041 Ga0495610_0001041_6382_7281 299
103 3300046512 Ga0495610_0004558 Ga0495610_0004558_6275_7174 299
104 3300046513 Ga0495616_0062862 Ga0495616_0062862_558_1457 299
105 3300046515 Ga0495620_0000203 Ga0495620_0000203_2946_3845 299
106 3300046515 Ga0495620_0005736 Ga0495620_0005736_906_1805 299
107 3300046515 Ga0495620_0008679 Ga0495620_0008679_2454_3353 299
108 3300046518 Ga0495631_0007089 Ga0495631_0007089_3896_4795 299
109 3300046518 Ga0495631_0020233 Ga0495631_0020233_399_1298 299
110 3300046519 Ga0495632_0001061 Ga0495632_0001061_20841_21740 299
111 3300046519 Ga0495632_0001440 Ga0495632_0001440_587_1486 299
112 3300046519 Ga0495632_0028767 Ga0495632_0028767_665_1567 299
113 3300046520 Ga0495637_0000081 Ga0495637_0000081_38158_39057 299
114 3300046520 Ga0495637_0001006 Ga0495637_0001006_11135_12034 299
115 3300046520 Ga0495637_0008050 Ga0495637_0008050_1833_2732 299
116 3300046522 Ga0495643_0004340 Ga0495643_0004340_719_1618 299
117 3300046524 Ga0495648_0000793 Ga0495648_0000793_30561_31460 299
118 3300046524 Ga0495648_0002051 Ga0495648_0002051_15323_16222 299
119 3300046524 Ga0495648_0002378 Ga0495648_0002378_955_1857 299
120 3300046524 Ga0495648_0027921 Ga0495648_0027921_320_1219 299
121 3300046524 Ga0495648_0220065 Ga0495648_0220065_14_913 299
122 3300046530 Ga0495654_0001513 Ga0495654_0001513_12024_12923 299
123 3300046530 Ga0495654_0004332 Ga0495654_0004332_409_1308 299
124 3300046530 Ga0495654_0017818 Ga0495654_0017818_978_1877 299
125 3300046538 Ga0495609_0000013 Ga0495609_0000013_256153_257052 299
126 3300046538 Ga0495609_0000270 Ga0495609_0000270_2857_3756 299
127 3300046542 Ga0495597_0001224 Ga0495597_0001224_2962_3861 299
128 3300046542 Ga0495597_0004482 Ga0495597_0004482_2046_2945 299
129 3300046557 Ga0495622_0013056 Ga0495622_0013056_2178_3077 299
130 3300046558 Ga0495633_0000010 Ga0495633_0000010_3081_3980 299
131 3300046616 Ga0495668_0005116 Ga0495668_0005116_7067_7966 299
132 3300046616 Ga0495668_0021769 Ga0495668_0021769_1811_2710 299
133 3300046648 Ga0495611_0000541 Ga0495611_0000541_3052_3951 299
134 3300046648 Ga0495611_0003806 Ga0495611_0003806_5134_6033 299
135 3300046660 Ga0495625_0000016 Ga0495625_0000016_199060_199959 299
136 3300046660 Ga0495625_0001103 Ga0495625_0001103_30916_31815 299
137 3300046665 Ga0495661_0000001 Ga0495661_0000001_680505_681404 299
138 3300046665 Ga0495661_0000005 Ga0495661_0000005_310494_311393 299
139 3300046665 Ga0495661_0001594 Ga0495661_0001594_829_1728 299
140 3300046679 Ga0495623_0167845 Ga0495623_0167845_322_1224 299
141 3300046691 Ga0495670_0000018 Ga0495670_0000018_32670_33569 299
142 3300046691 Ga0495670_0000206 Ga0495670_0000206_15121_16020 299
143 3300046692 Ga0495671_0000540 Ga0495671_0000540_21948_22847 299
144 3300046692 Ga0495671_0008227 Ga0495671_0008227_2913_3812 299
145 3300046692 Ga0495671_0012991 Ga0495671_0012991_3006_3905 299
146 3300046692 Ga0495671_0017067 Ga0495671_0017067_1650_2549 299
147 3300046692 Ga0495671_0076616 Ga0495671_0076616_182_1081 299
148 3300046694 Ga0495649_0004389 Ga0495649_0004389_7467_8366 299
149 3300046794 Ga0495589_0000793 Ga0495589_0000793_15892_16791 299
150 3300046810 Ga0495660_0000414 Ga0495660_0000414_7192_8091 299
151 3300046810 Ga0495660_0002936 Ga0495660_0002936_6831_7730 299
152 3300046810 Ga0495660_0022442 Ga0495660_0022442_1326_2225 299
153 3300047320 Ga0495672_0001369 Ga0495672_0001369_21660_22559 299
154 3300047320 Ga0495672_0020275 Ga0495672_0020275_82_981 299
155 3300047320 Ga0495672_0081291 Ga0495672_0081291_72_974 299
156 3300047321 Ga0495676_0000001 Ga0495676_0000001_317858_318757 299
157 3300047322 Ga0495680_0304552 Ga0495680_0304552_114_1013 299
158 3300047323 Ga0495683_0000031 Ga0495683_0000031_3080_3979 299
159 3300047323 Ga0495683_0000456 Ga0495683_0000456_22879_23778 299
160 3300047446 Ga0495679_000053 Ga0495679_000053_94508_95407 299
161 3300047446 Ga0495679_000239 Ga0495679_000239_41867_42766 299
162 3300047446 Ga0495679_000278 Ga0495679_000278_13610_14509 299
163 3300047469 Ga0495673_0000077 Ga0495673_0000077_102036_102935 299
164 3300047469 Ga0495673_0000477 Ga0495673_0000477_29200_30099 299
165 3300047469 Ga0495673_0001240 Ga0495673_0001240_19522_20421 299
166 3300047469 Ga0495673_0006861 Ga0495673_0006861_3819_4718 299
167 3300047470 Ga0495681_0000116 Ga0495681_0000116_21979_22878 299
168 3300047470 Ga0495681_0000487 Ga0495681_0000487_26665_27564 299
169 3300047470 Ga0495681_0016955 Ga0495681_0016955_276_1175 299
170 3300047472 Ga0495686_0003734 Ga0495686_0003734_10281_11180 299
171 3300047472 Ga0495686_0046348 Ga0495686_0046348_688_1587 299
172 3300048091 Ga0495626_0000002 Ga0495626_0000002_389391_390290 299
173 3300048091 Ga0495626_0000119 Ga0495626_0000119_56808_57707 299
174 3300048091 Ga0495626_0000185 Ga0495626_0000185_44082_44981 299
175 3300048091 Ga0495626_0080417 Ga0495626_0080417_200_1099 299
176 3300049459 Ga0495678_000008 Ga0495678_000008_370446_371345 299
177 3300049459 Ga0495678_000375 Ga0495678_000375_41429_42328 299
178 3300049459 Ga0495678_002914 Ga0495678_002914_153_1052 299
179 3300049459 Ga0495678_071822 Ga0495678_071822_299_1198 299
180 3300049460 Ga0495682_0010668 Ga0495682_0010668_15_914 299
181 3300049568 Ga0501031_0001706 Ga0501031_0001706_4814_5713 299
182 3300053730 Ga0500645_014637 Ga0500645_014637_288_1196 299
183 3300005339 Ga0070660_100035982 Ga0070660_1000359825 300
184 3300005364 Ga0070673_100230271 Ga0070673_1002302712 300
185 3300005366 Ga0070659_100130989 Ga0070659_1001309893 300
186 3300005844 Ga0068862_100009085 Ga0068862_1000090853 300
187 3300006880 Ga0075429_100009609 Ga0075429_1000096094 300
188 3300009093 Ga0105240_10047717 Ga0105240_100477172 300
189 3300009147 Ga0114129_10026544 Ga0114129_100265447 300
190 3300009545 Ga0105237_10043277 Ga0105237_100432774 300
191 3300009551 Ga0105238_10018981 Ga0105238_100189816 300
192 3300009551 Ga0105238_10034468 Ga0105238_100344683 300
193 3300009553 Ga0105249_10063168 Ga0105249_100631683 300
194 3300010375 Ga0105239_10397532 Ga0105239_103975321 300
195 3300013102 Ga0157371_10065844 Ga0157371_100658441 300
196 3300013104 Ga0157370_10004825 Ga0157370_1000482511 300
197 3300013307 Ga0157372_10092884 Ga0157372_100928843 300
198 3300014325 Ga0163163_10183329 Ga0163163_101833292 300
199 3300014968 Ga0157379_10154740 Ga0157379_101547402 300
200 3300025913 Ga0207695_10040566 Ga0207695_100405663 300
201 3300025914 Ga0207671_10036199 Ga0207671_100361992 300
202 3300025919 Ga0207657_10019886 Ga0207657_100198865 300
203 3300025924 Ga0207694_10068311 Ga0207694_100683114 300
204 3300026142 Ga0207698_10340885 Ga0207698_103408851 300
205 3300028379 Ga0268266_10007695 Ga0268266_100076959 300
206 3300028379 Ga0268266_10304168 Ga0268266_103041682 300
207 3300028380 Ga0268265_10006028 Ga0268265_100060283 300
208 3300032004 Ga0307414_10003643 Ga0307414_100036433 300
209 3300032004 Ga0307414_10228604 Ga0307414_102286042 300
210 3300033180 Ga0307510_10000001 Ga0307510_10000001858 300
211 3300033180 Ga0307510_10024130 Ga0307510_100241304 300
212 3300036712 Ga0316584_0011268 Ga0316584_0011268_4007_4912 300
213 3300037471 Ga0395905_0160369 Ga0395905_0160369_719_1657 300
214 3300038443 Ga0395901_0021918 Ga0395901_0021918_4216_5154 300
215 3300041512 Ga0451853_2764788 Ga0451853_2764788_112_1053 300
216 3300045051 Ga0451576_0131965 Ga0451576_0131965_670_1596 300
217 3300046462 Ga0495651_0002405 Ga0495651_0002405_6440_7360 300
218 3300046471 Ga0495650_0000213 Ga0495650_0000213_49765_50676 300
219 3300046516 Ga0495628_0068063 Ga0495628_0068063_281_1201 300
220 3300046524 Ga0495648_0000505 Ga0495648_0000505_37548_38459 300
221 3300046526 Ga0495666_0005550 Ga0495666_0005550_4899_5819 300
222 3300046529 Ga0495652_0054296 Ga0495652_0054296_241_1161 300
223 3300046538 Ga0495609_0003410 Ga0495609_0003410_4029_4940 300
224 3300046538 Ga0495609_0102301 Ga0495609_0102301_49_1011 300
225 3300046678 Ga0495599_0161532 Ga0495599_0161532_107_1027 300
226 3300046679 Ga0495623_0011290 Ga0495623_0011290_1460_2380 300
227 3300046680 Ga0495646_0020919 Ga0495646_0020919_1570_2490 300
228 3300046690 Ga0495624_0001109 Ga0495624_0001109_20262_21182 300
229 3300047317 Ga0495604_0239484 Ga0495604_0239484_241_1161 300
230 3300047319 Ga0495674_0333522 Ga0495674_0333522_205_1125 300
231 3300047320 Ga0495672_0000322 Ga0495672_0000322_62307_63218 300
232 3300047320 Ga0495672_0003238 Ga0495672_0003238_12465_13385 300
233 3300047322 Ga0495680_0015609 Ga0495680_0015609_5132_6052 300
234 3300047444 Ga0495675_0167553 Ga0495675_0167553_192_1112 300
235 3300048088 Ga0495602_0077306 Ga0495602_0077306_1597_2517 300
236 3300048091 Ga0495626_0108682 Ga0495626_0108682_240_1151 300
237 3300050493 nmdc:mga0k408_39173_c1 nmdc:mga0k408_39173_c1_397_1302 300
238 3300050507 nmdc:mga05p37_606564_c1 nmdc:mga05p37_606564_c1_310_1212 300
239 3300050508 nmdc:mga09592_3525_c1 nmdc:mga09592_3525_c1_11304_12206 300
240 3300050509 nmdc:mga0qj67_23869_c1 nmdc:mga0qj67_23869_c1_2321_3223 300
241 3300050510 nmdc:mga06r32_57695_c1 nmdc:mga06r32_57695_c1_2702_3604 300
242 3300053092 Ga0500583_0001775 Ga0500583_0001775_3848_4759 300
243 3300053125 Ga0500618_004279 Ga0500618_004279_3583_4494 300
244 3300003763 Ga0055529_1001112 Ga0055529_10011125 301
245 3300025228 Ga0209672_106488 Ga0209672_1064881 301
246 3300025272 Ga0209455_1001125 Ga0209455_10011259 301
247 3300049822 Ga0501035_0010751 Ga0501035_0010751_6746_7651 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

33

92

0.98

PF03466

LysR_substrate

LysR substrate binding domain

116

322

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9463 1 84
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9207 1 84
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9189 4 84
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.906 1 88
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9045 1 84
ID Description Score Start End Superfamily
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9832 4 84 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9645 4 74 1.10.10.10
af_P45463_8_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9643 5 87 1.10.10.10
af_P0ACR7_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9624 5 82 1.10.10.10
af_P67660_2_90_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.957 4 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5F0LPX3-F1-model_v4 LysR family transcriptional regulator 0.9547 162 298
AF-A0A7Y4T7C7-F1-model_v4 LysR family transcriptional regulator 0.9458 110 298 GO:0003700
GO:0006351
GO:0043565
AF-A0A850QN73-F1-model_v4 LysR family transcriptional regulator 0.9416 96 293 GO:0003700
GO:0006351
GO:0043565
AF-U6ZXM9-F1-model_v4 deleted 0.9384 124 301
AF-A0A7T9TE06-F1-model_v4 deleted 0.9362 1 298

Feature Viewer

pLDDT pTM Quality
87.9 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map