F356455

General Info

Members Datasets Scaffolds Average Seq Length
244 162 234 200

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10858406|Ga0105245_108584062
Length 231
Sequence MNWCRLTADKVDSRLPAPAFEARIFPPQVSMARSVTGPEIERLIQLLARLPGLGPRSARRAALHLIKKKDDLLVPLAEAMDVAVESIVVCSTCGNIDTTNPCTICSDPRRDQSVLVVVEDVADLWALERAGAINARYHVLGGVLSPLDGVGPDDLAIAPLVKRVAAGGIGEVILAVNATVEGATTAHYVTDQLAGLNVKVSRLAHGVPVGGELDYLDEGTLSAAMRSRTPF

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2643221733 Bosea sp. Root381 Isolate Unclassified
3 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
4 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
5 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
6 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
7 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
8 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
9 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
10 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
157 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
158 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
159 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
160 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.9
Metatranscriptomes 0
Isolates 4.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 0.82
Rhizosphere 86.07
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10017320 3300003203 Bacteria 2983
2 Ga0065715_10156555 3300005293 Bacteria 1671
3 Ga0065707_10469592 3300005295 Bacteria 783
4 Ga0070676_10117819 3300005328 Bacteria 1663
5 Ga0070690_100261900 3300005330 Bacteria 1227
6 Ga0070670_100016910 3300005331 Bacteria 6261
7 Ga0070670_100243032 3300005331 Bacteria 1567
8 Ga0070677_10001997 3300005333 Bacteria 6488
9 Ga0070668_100139438 3300005347 Bacteria 1953
10 Ga0070675_100214770 3300005354 Bacteria 1673
11 Ga0070674_100014576 3300005356 Bacteria 4890
12 Ga0070673_100058108 3300005364 Bacteria 3057
13 Ga0070667_100085710 3300005367 Bacteria 2702
14 Ga0070709_10009360 3300005434 Bacteria 5402
15 Ga0070711_100223364 3300005439 Unclassified 1465
16 Ga0070678_100017817 3300005456 Bacteria 4585
17 Ga0070662_100009754 3300005457 Bacteria 6286
18 Ga0068867_100166799 3300005459 Bacteria 1741
19 Ga0070684_100032071 3300005535 Bacteria 4476
20 Ga0070672_100006473 3300005543 Bacteria 7875
21 Ga0068856_100920934 3300005614 Bacteria 893
22 Ga0068859_100027176 3300005617 Bacteria 5741
23 Ga0068864_100164433 3300005618 Bacteria 2019
24 Ga0068870_10156945 3300005840 Bacteria 1346
25 Ga0068858_100218509 3300005842 Bacteria 1804
26 Ga0081539_10001975 3300005985 Bacteria 31233
27 Ga0075368_10098806 3300006042 Bacteria 1197
28 Ga0075364_10074560 3300006051 Bacteria 2237
29 Ga0075364_10127460 3300006051 Bacteria 1707
30 Ga0075367_10051991 3300006178 Bacteria 2424
31 Ga0068871_100814999 3300006358 Bacteria 861
32 Ga0075430_100865926 3300006846 Bacteria 744
33 Ga0075431_100000345 3300006847 Bacteria 36593
34 Ga0075429_100005281 3300006880 Bacteria 11112
35 Ga0097620_100027176 3300006931 Bacteria 5741
36 Ga0105240_11227799 3300009093 Bacteria 793
37 Ga0105245_10858406 3300009098 Bacteria 948
38 Ga0105247_10018056 3300009101 Bacteria 4231
39 Ga0114129_10016707 3300009147 Bacteria 10452
40 Ga0105243_10037604 3300009148 Bacteria 3763
41 Ga0105241_10314213 3300009174 Bacteria 1349
42 Ga0105242_10325899 3300009176 Bacteria 1410
43 Ga0105242_11144819 3300009176 Bacteria 794
44 Ga0105248_10572121 3300009177 Bacteria 1275
45 Ga0105238_10020466 3300009551 Bacteria 6736
46 Ga0105246_10373346 3300011119 Bacteria 1176
47 Ga0157378_10110893 3300013297 Bacteria 2515
48 Ga0157375_11434157 3300013308 Bacteria 814
49 Ga0163163_10142688 3300014325 Bacteria 2437
50 Ga0157380_11357231 3300014326 Bacteria 760
51 Ga0157376_10153510 3300014969 Bacteria 2079
52 Ga0182005_1112396 3300015265 Bacteria 770
53 Ga0213876_10072285 3300021384 Bacteria 1822
54 Ga0213876_10123172 3300021384 Bacteria 1377
55 Ga0213876_10132234 3300021384 Bacteria 1326
56 Ga0207682_10006806 3300025893 Bacteria 4587
57 Ga0207680_10127598 3300025903 Bacteria 1672
58 Ga0207647_10381832 3300025904 Bacteria 795
59 Ga0207699_10001403 3300025906 Bacteria 11437
60 Ga0207645_10561662 3300025907 Bacteria 774
61 Ga0207643_10160942 3300025908 Bacteria 1351
62 Ga0207643_10281704 3300025908 Bacteria 1031
63 Ga0207671_10618776 3300025914 Bacteria 863
64 Ga0207663_10372943 3300025916 Bacteria 1085
65 Ga0207681_10167292 3300025923 Bacteria 1663
66 Ga0207694_10047786 3300025924 Bacteria 3310
67 Ga0207659_10039067 3300025926 Bacteria 3306
68 Ga0207659_10288447 3300025926 Bacteria 1344
69 Ga0207690_10697131 3300025932 Bacteria 835
70 Ga0207706_10015413 3300025933 Bacteria 6906
71 Ga0207706_10134795 3300025933 Bacteria 2172
72 Ga0207670_10375079 3300025936 Bacteria 1132
73 Ga0207669_10008446 3300025937 Bacteria 4835
74 Ga0207669_10558924 3300025937 Bacteria 924
75 Ga0207691_10000720 3300025940 Bacteria 32686
76 Ga0207689_10158982 3300025942 Bacteria 1862
77 Ga0207661_10473401 3300025944 Bacteria 1143
78 Ga0207661_11128766 3300025944 Bacteria 722
79 Ga0207679_10543267 3300025945 Bacteria 1042
80 Ga0207651_10012239 3300025960 Bacteria 4845
81 Ga0207712_10795795 3300025961 Bacteria 831
82 Ga0207668_10067553 3300025972 Bacteria 2539
83 Ga0207658_10051222 3300025986 Bacteria 3042
84 Ga0207677_10392369 3300026023 Bacteria 1175
85 Ga0207676_10026665 3300026095 Bacteria 4297
86 Ga0207675_100453106 3300026118 Bacteria 1272
87 Ga0207675_100578371 3300026118 Bacteria 1124
88 Ga0207683_10003359 3300026121 Bacteria 13946
89 Ga0265318_10021861 3300028577 Bacteria 2564
90 Ga0265318_10027403 3300028577 Bacteria 2239
91 Ga0265330_10022220 3300031235 Bacteria 2889
92 Ga0265330_10043710 3300031235 Bacteria 1981
93 Ga0265325_10062006 3300031241 Bacteria 1895
94 Ga0265325_10065109 3300031241 Bacteria 1841
95 Ga0265340_10002587 3300031247 Bacteria 10275
96 Ga0265340_10007291 3300031247 Bacteria 6011
97 Ga0265340_10010584 3300031247 Bacteria 4931
98 Ga0265340_10023721 3300031247 Bacteria 3126
99 Ga0265340_10088894 3300031247 Bacteria 1446
100 Ga0265339_10147616 3300031249 Bacteria 1192
101 Ga0265316_10012137 3300031344 Bacteria 7735
102 Ga0265316_10332295 3300031344 Bacteria 1102
103 Ga0265313_10005225 3300031595 Bacteria 9619
104 Ga0265313_10055475 3300031595 Bacteria 1877
105 Ga0265313_10115404 3300031595 Bacteria 1176
106 Ga0265314_10003068 3300031711 Bacteria 16468
107 Ga0265314_10440071 3300031711 Bacteria 696
108 Ga0265342_10006227 3300031712 Bacteria 8915
109 Ga0265342_10021592 3300031712 Bacteria 4107
110 Ga0265342_10065525 3300031712 Bacteria 2129
111 Ga0265342_10238256 3300031712 Bacteria 975
112 Ga0307410_10334508 3300031852 Bacteria 1205
113 Ga0307406_10142250 3300031901 Bacteria 1700
114 Ga0307409_101253180 3300031995 Bacteria 766
115 Ga0307510_10230370 3300033180 Bacteria 1356
116 Ga0316574_0185821 3300035398 Bacteria 1337
117 Ga0373935_0317240 3300035692 Bacteria 1105
118 Ga0316584_0211691 3300036712 Bacteria 1426
119 Ga0373925_0848841 3300037068 Bacteria 753
120 Ga0395900_0157391 3300037418 Bacteria 2320
121 Ga0395898_0486315 3300037466 Bacteria 1174
122 Ga0395905_0021976 3300037471 Bacteria 6035
123 Ga0436364_0556782 3300037853 Bacteria 765
124 Ga0436364_0987839 3300037853 Bacteria 1091
125 Ga0436364_1361836 3300037853 Bacteria 1285
126 Ga0436365_0050130 3300039437 Bacteria 1431
127 Ga0436365_0404207 3300039437 Bacteria 1312
128 Ga0436365_1716714 3300039437 Bacteria 1584
129 Ga0436365_1938037 3300039437 Bacteria 723
130 Ga0436363_0640862 3300039450 Bacteria 855
131 Ga0436362_0068401 3300039453 Bacteria 881
132 Ga0439461_0099126 3300041410 Bacteria 708
133 Ga0451837_1612070 3300041494 Bacteria 838
134 Ga0439455_0132757 3300042012 Bacteria 703
135 Ga0466965_0176512 3300044683 Bacteria 1126
136 Ga0466968_0031293 3300044735 Bacteria 2207
137 Ga0466968_0085492 3300044735 Bacteria 1391
138 Ga0466970_0047682 3300044765 Bacteria 2284
139 Ga0466960_0130431 3300044901 Bacteria 1326
140 Ga0466967_1148472 3300045976 Bacteria 774
141 Ga0495605_0022515 3300046474 Bacteria 3328
142 Ga0495685_018908 3300047447 Bacteria 2366
143 Ga0495615_0008393 3300048090 Bacteria 1994
144 Ga0496112_0283122 3300048915 Bacteria 1605
145 Ga0496114_0033470 3300048917 Bacteria 4235
146 Ga0496119_0002204 3300048922 Bacteria 21763
147 Ga0496122_0016290 3300048925 Bacteria 7050
148 Ga0496123_0003152 3300048926 Bacteria 18863
149 Ga0496124_0621386 3300048927 Bacteria 699
150 Ga0501032_0030681 3300049569 Bacteria 3689
151 Ga0501032_0253244 3300049569 Bacteria 1143
152 Ga0501033_0086207 3300049570 Bacteria 2299
153 Ga0501033_0655498 3300049570 Bacteria 717
154 Ga0501033_0718532 3300049570 Bacteria 679
155 Ga0501034_0016156 3300049571 Bacteria 7658
156 Ga0501034_0040812 3300049571 Bacteria 4695
157 Ga0501034_0043792 3300049571 Bacteria 4528
158 Ga0501034_0047013 3300049571 Bacteria 4359
159 Ga0501034_0169677 3300049571 Bacteria 2150
160 Ga0501034_0204540 3300049571 Bacteria 1931
161 Ga0501034_0690773 3300049571 Bacteria 919
162 Ga0501036_0122800 3300049572 Bacteria 2193
163 Ga0501036_0229725 3300049572 Bacteria 1557
164 Ga0501037_0498049 3300049573 Bacteria 827
165 Ga0501037_0632905 3300049573 Bacteria 716
166 Ga0501039_0693128 3300049575 Bacteria 797
167 Ga0501039_0877091 3300049575 Bacteria 699
168 Ga0501043_0084666 3300049579 Bacteria 2492
169 Ga0501047_0060611 3300049581 Bacteria 3651
170 Ga0501047_0116972 3300049581 Bacteria 2547
171 Ga0501047_0129347 3300049581 Bacteria 2405
172 Ga0501047_0136443 3300049581 Bacteria 2334
173 Ga0501047_0175392 3300049581 Bacteria 2011
174 Ga0501047_0311122 3300049581 Bacteria 1416
175 Ga0501047_0379037 3300049581 Bacteria 1249
176 Ga0501047_0612446 3300049581 Bacteria 910
177 Ga0501067_0001744 3300049583 Bacteria 11950
178 Ga0501067_0010872 3300049583 Bacteria 5038
179 Ga0501067_0164648 3300049583 Bacteria 1235
180 Ga0501069_0333209 3300049585 Bacteria 893
181 Ga0501069_0615372 3300049585 Bacteria 652
182 Ga0501070_0099545 3300049586 Bacteria 2405
183 Ga0501070_0140460 3300049586 Bacteria 1994
184 Ga0501070_0229143 3300049586 Bacteria 1522
185 Ga0501072_0030786 3300049588 Bacteria 4198
186 Ga0501073_0195125 3300049589 Bacteria 1400
187 Ga0501074_0449303 3300049590 Bacteria 914
188 Ga0501074_0782060 3300049590 Bacteria 673
189 Ga0501075_0233391 3300049591 Bacteria 1403
190 Ga0501076_0141795 3300049592 Bacteria 1953
191 Ga0501076_0632789 3300049592 Bacteria 883
192 Ga0501077_0185313 3300049593 Bacteria 1322
193 Ga0501077_0331676 3300049593 Bacteria 970
194 Ga0501079_0788442 3300049741 Bacteria 748
195 Ga0501080_0146841 3300049742 Bacteria 2180
196 Ga0501080_0295228 3300049742 Bacteria 1471
197 Ga0501080_0405843 3300049742 Bacteria 1225
198 Ga0501080_0746596 3300049742 Bacteria 861
199 Ga0501081_0168027 3300049743 Bacteria 1583
200 Ga0501083_0000366 3300049744 Bacteria 28661
201 Ga0501083_0017441 3300049744 Bacteria 5004
202 Ga0501083_0028037 3300049744 Bacteria 3882
203 Ga0501083_0107224 3300049744 Bacteria 1838
204 Ga0501083_0113592 3300049744 Bacteria 1779
205 Ga0501083_0325455 3300049744 Bacteria 999
206 Ga0501035_0035242 3300049822 Bacteria 4542
207 Ga0501035_0166902 3300049822 Bacteria 1903
208 Ga0501035_0250345 3300049822 Bacteria 1505
209 Ga0501035_0351832 3300049822 Bacteria 1232
210 Ga0501044_0006144 3300049823 Bacteria 13263
211 Ga0501044_0052069 3300049823 Bacteria 4220
212 Ga0501044_0248359 3300049823 Bacteria 1721
213 Ga0501044_0294391 3300049823 Bacteria 1554
214 Ga0501044_0834999 3300049823 Bacteria 799
215 nmdc:mga05p37_72901_c1 3300050507 Bacteria 4226
216 nmdc:mga09592_32634_c1 3300050508 Bacteria 4341
217 nmdc:mga06r32_26639_c1 3300050510 Bacteria 5393
218 nmdc:mga0n895_1280964_c1 3300050512 Bacteria 704
219 Ga0500650_0228583 3300053098 Bacteria 840
220 Ga0500556_0000038 3300053104 Bacteria 138208
221 Ga0500652_060723 3300053131 Bacteria 1556
222 Ga0500627_0155200 3300053158 Bacteria 1034
223 Ga0500645_019861 3300053730 Bacteria 2087
224 Ga0501084_0055815 3300054114 Bacteria 3305
225 Ga0501084_0106686 3300054114 Bacteria 2353
226 Ga0501084_0350365 3300054114 Bacteria 1247
227 Ga0501084_0622189 3300054114 Bacteria 912
228 Ga0501082_0000002 3300060353 Bacteria 186546
229 Ga0501082_0019935 3300060353 Bacteria 5779
230 Ga0501082_0202157 3300060353 Bacteria 1729
231 Ga0501082_0266063 3300060353 Bacteria 1492
232 Ga0501082_0402198 3300060353 Bacteria 1195
233 Ga0501082_0714477 3300060353 Bacteria 877
234 Ga0501082_0920697 3300060353 Bacteria 765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0714477 Ga0501082_0714477_27_497 156
2 3300049591 Ga0501075_0233391 Ga0501075_0233391_512_1114 186
3 3300049741 Ga0501079_0788442 Ga0501079_0788442_124_726 186
4 3300049743 Ga0501081_0168027 Ga0501081_0168027_95_697 186
5 3300054114 Ga0501084_0055815 Ga0501084_0055815_620_1222 186
6 3300060353 Ga0501082_0402198 Ga0501082_0402198_193_795 186
7 3300049571 Ga0501034_0016156 Ga0501034_0016156_210_815 188
8 3300049572 Ga0501036_0229725 Ga0501036_0229725_349_954 188
9 3300049581 Ga0501047_0060611 Ga0501047_0060611_2477_3082 188
10 3300049581 Ga0501047_0175392 Ga0501047_0175392_207_812 188
11 3300049742 Ga0501080_0746596 Ga0501080_0746596_174_779 188
12 3300031247 Ga0265340_10010584 Ga0265340_100105846 189
13 3300031249 Ga0265339_10147616 Ga0265339_101476162 189
14 3300049571 Ga0501034_0169677 Ga0501034_0169677_1497_2102 189
15 3300049586 Ga0501070_0099545 Ga0501070_0099545_714_1319 189
16 3300049822 Ga0501035_0035242 Ga0501035_0035242_241_846 189
17 3300049822 Ga0501035_0351832 Ga0501035_0351832_39_644 189
18 3300049823 Ga0501044_0006144 Ga0501044_0006144_4915_5520 189
19 3300049581 Ga0501047_0136443 Ga0501047_0136443_423_1028 193
20 3300049823 Ga0501044_0834999 Ga0501044_0834999_52_657 193
21 3300005434 Ga0070709_10009360 Ga0070709_100093603 195
22 3300005439 Ga0070711_100223364 Ga0070711_1002233642 195
23 3300025906 Ga0207699_10001403 Ga0207699_1000140311 195
24 3300025916 Ga0207663_10372943 Ga0207663_103729432 195
25 iso_pu_bacteria 2523231067 2523468796 197
26 iso_pu_bacteria 2643221733 2644729469 197
27 iso_pu_bacteria 2738543031 2739349708 197
28 iso_pu_bacteria 2842698319 2842699156 197
29 iso_pu_bacteria 2861691609 2861691675 197
30 iso_pu_bacteria 2882456835 2882461319 197
31 iso_pu_bacteria 2889306138 2889310725 197
32 iso_pu_bacteria 2917554339 2917557980 197
33 iso_pu_bacteria 2928125067 2928129058 197
34 iso_pu_bacteria 2939669807 2939673634 197
35 3300003203 JGI25406J46586_10017320 JGI25406J46586_100173203 200
36 3300005293 Ga0065715_10156555 Ga0065715_101565553 200
37 3300005295 Ga0065707_10469592 Ga0065707_104695921 200
38 3300005328 Ga0070676_10117819 Ga0070676_101178193 200
39 3300005330 Ga0070690_100261900 Ga0070690_1002619002 200
40 3300005331 Ga0070670_100016910 Ga0070670_1000169105 200
41 3300005331 Ga0070670_100243032 Ga0070670_1002430321 200
42 3300005333 Ga0070677_10001997 Ga0070677_100019976 200
43 3300005347 Ga0070668_100139438 Ga0070668_1001394382 200
44 3300005354 Ga0070675_100214770 Ga0070675_1002147702 200
45 3300005356 Ga0070674_100014576 Ga0070674_1000145765 200
46 3300005364 Ga0070673_100058108 Ga0070673_1000581083 200
47 3300005367 Ga0070667_100085710 Ga0070667_1000857103 200
48 3300005456 Ga0070678_100017817 Ga0070678_1000178173 200
49 3300005457 Ga0070662_100009754 Ga0070662_1000097543 200
50 3300005459 Ga0068867_100166799 Ga0068867_1001667992 200
51 3300005535 Ga0070684_100032071 Ga0070684_1000320713 200
52 3300005543 Ga0070672_100006473 Ga0070672_1000064733 200
53 3300005614 Ga0068856_100920934 Ga0068856_1009209341 200
54 3300005617 Ga0068859_100027176 Ga0068859_1000271767 200
55 3300005618 Ga0068864_100164433 Ga0068864_1001644332 200
56 3300005840 Ga0068870_10156945 Ga0068870_101569452 200
57 3300005842 Ga0068858_100218509 Ga0068858_1002185092 200
58 3300005985 Ga0081539_10001975 Ga0081539_1000197522 200
59 3300006042 Ga0075368_10098806 Ga0075368_100988061 200
60 3300006051 Ga0075364_10074560 Ga0075364_100745602 200
61 3300006051 Ga0075364_10127460 Ga0075364_101274602 200
62 3300006178 Ga0075367_10051991 Ga0075367_100519913 200
63 3300006358 Ga0068871_100814999 Ga0068871_1008149991 200
64 3300006846 Ga0075430_100865926 Ga0075430_1008659261 200
65 3300006847 Ga0075431_100000345 Ga0075431_10000034526 200
66 3300006880 Ga0075429_100005281 Ga0075429_1000052818 200
67 3300006931 Ga0097620_100027176 Ga0097620_1000271767 200
68 3300009093 Ga0105240_11227799 Ga0105240_112277991 200
69 3300009098 Ga0105245_10858406 Ga0105245_108584062 200
70 3300009101 Ga0105247_10018056 Ga0105247_100180565 200
71 3300009147 Ga0114129_10016707 Ga0114129_100167075 200
72 3300009148 Ga0105243_10037604 Ga0105243_100376042 200
73 3300009174 Ga0105241_10314213 Ga0105241_103142133 200
74 3300009176 Ga0105242_10325899 Ga0105242_103258992 200
75 3300009176 Ga0105242_11144819 Ga0105242_111448191 200
76 3300009177 Ga0105248_10572121 Ga0105248_105721213 200
77 3300009551 Ga0105238_10020466 Ga0105238_100204662 200
78 3300011119 Ga0105246_10373346 Ga0105246_103733462 200
79 3300013297 Ga0157378_10110893 Ga0157378_101108933 200
80 3300013308 Ga0157375_11434157 Ga0157375_114341571 200
81 3300014325 Ga0163163_10142688 Ga0163163_101426883 200
82 3300014326 Ga0157380_11357231 Ga0157380_113572311 200
83 3300014969 Ga0157376_10153510 Ga0157376_101535102 200
84 3300015265 Ga0182005_1112396 Ga0182005_11123962 200
85 3300021384 Ga0213876_10072285 Ga0213876_100722852 200
86 3300021384 Ga0213876_10123172 Ga0213876_101231723 200
87 3300021384 Ga0213876_10132234 Ga0213876_101322343 200
88 3300025893 Ga0207682_10006806 Ga0207682_100068063 200
89 3300025903 Ga0207680_10127598 Ga0207680_101275983 200
90 3300025904 Ga0207647_10381832 Ga0207647_103818321 200
91 3300025907 Ga0207645_10561662 Ga0207645_105616621 200
92 3300025908 Ga0207643_10160942 Ga0207643_101609421 200
93 3300025908 Ga0207643_10281704 Ga0207643_102817042 200
94 3300025914 Ga0207671_10618776 Ga0207671_106187761 200
95 3300025923 Ga0207681_10167292 Ga0207681_101672922 200
96 3300025924 Ga0207694_10047786 Ga0207694_100477864 200
97 3300025926 Ga0207659_10039067 Ga0207659_100390671 200
98 3300025926 Ga0207659_10288447 Ga0207659_102884473 200
99 3300025932 Ga0207690_10697131 Ga0207690_106971311 200
100 3300025933 Ga0207706_10015413 Ga0207706_100154133 200
101 3300025933 Ga0207706_10134795 Ga0207706_101347952 200
102 3300025936 Ga0207670_10375079 Ga0207670_103750791 200
103 3300025937 Ga0207669_10008446 Ga0207669_100084464 200
104 3300025937 Ga0207669_10558924 Ga0207669_105589241 200
105 3300025940 Ga0207691_10000720 Ga0207691_1000072020 200
106 3300025942 Ga0207689_10158982 Ga0207689_101589823 200
107 3300025944 Ga0207661_10473401 Ga0207661_104734012 200
108 3300025944 Ga0207661_11128766 Ga0207661_111287661 200
109 3300025945 Ga0207679_10543267 Ga0207679_105432672 200
110 3300025960 Ga0207651_10012239 Ga0207651_100122391 200
111 3300025961 Ga0207712_10795795 Ga0207712_107957951 200
112 3300025972 Ga0207668_10067553 Ga0207668_100675533 200
113 3300025986 Ga0207658_10051222 Ga0207658_100512223 200
114 3300026023 Ga0207677_10392369 Ga0207677_103923692 200
115 3300026095 Ga0207676_10026665 Ga0207676_100266653 200
116 3300026118 Ga0207675_100453106 Ga0207675_1004531062 200
117 3300026118 Ga0207675_100578371 Ga0207675_1005783712 200
118 3300026121 Ga0207683_10003359 Ga0207683_100033593 200
119 3300028577 Ga0265318_10021861 Ga0265318_100218613 200
120 3300028577 Ga0265318_10027403 Ga0265318_100274033 200
121 3300031235 Ga0265330_10022220 Ga0265330_100222202 200
122 3300031235 Ga0265330_10043710 Ga0265330_100437103 200
123 3300031241 Ga0265325_10062006 Ga0265325_100620062 200
124 3300031241 Ga0265325_10065109 Ga0265325_100651093 200
125 3300031247 Ga0265340_10002587 Ga0265340_100025877 200
126 3300031247 Ga0265340_10007291 Ga0265340_100072917 200
127 3300031247 Ga0265340_10023721 Ga0265340_100237212 200
128 3300031247 Ga0265340_10088894 Ga0265340_100888943 200
129 3300031344 Ga0265316_10012137 Ga0265316_100121374 200
130 3300031344 Ga0265316_10332295 Ga0265316_103322953 200
131 3300031595 Ga0265313_10005225 Ga0265313_100052253 200
132 3300031595 Ga0265313_10055475 Ga0265313_100554752 200
133 3300031595 Ga0265313_10115404 Ga0265313_101154043 200
134 3300031711 Ga0265314_10003068 Ga0265314_100030687 200
135 3300031711 Ga0265314_10440071 Ga0265314_104400711 200
136 3300031712 Ga0265342_10006227 Ga0265342_100062279 200
137 3300031712 Ga0265342_10021592 Ga0265342_100215923 200
138 3300031712 Ga0265342_10065525 Ga0265342_100655253 200
139 3300031712 Ga0265342_10238256 Ga0265342_102382562 200
140 3300031852 Ga0307410_10334508 Ga0307410_103345082 200
141 3300031901 Ga0307406_10142250 Ga0307406_101422501 200
142 3300031995 Ga0307409_101253180 Ga0307409_1012531802 200
143 3300033180 Ga0307510_10230370 Ga0307510_102303702 200
144 3300035398 Ga0316574_0185821 Ga0316574_0185821_219_824 200
145 3300035692 Ga0373935_0317240 Ga0373935_0317240_138_740 200
146 3300036712 Ga0316584_0211691 Ga0316584_0211691_604_1209 200
147 3300037068 Ga0373925_0848841 Ga0373925_0848841_65_670 200
148 3300037418 Ga0395900_0157391 Ga0395900_0157391_10_615 200
149 3300037466 Ga0395898_0486315 Ga0395898_0486315_324_929 200
150 3300037471 Ga0395905_0021976 Ga0395905_0021976_3234_3839 200
151 3300037853 Ga0436364_0556782 Ga0436364_0556782_109_711 200
152 3300037853 Ga0436364_0987839 Ga0436364_0987839_409_1014 200
153 3300037853 Ga0436364_1361836 Ga0436364_1361836_524_1129 200
154 3300039437 Ga0436365_0050130 Ga0436365_0050130_517_1119 200
155 3300039437 Ga0436365_0404207 Ga0436365_0404207_87_692 200
156 3300039437 Ga0436365_1716714 Ga0436365_1716714_705_1307 200
157 3300039437 Ga0436365_1938037 Ga0436365_1938037_53_655 200
158 3300039450 Ga0436363_0640862 Ga0436363_0640862_148_753 200
159 3300039453 Ga0436362_0068401 Ga0436362_0068401_45_647 200
160 3300041410 Ga0439461_0099126 Ga0439461_0099126_63_668 200
161 3300041494 Ga0451837_1612070 Ga0451837_1612070_115_723 200
162 3300042012 Ga0439455_0132757 Ga0439455_0132757_24_626 200
163 3300044683 Ga0466965_0176512 Ga0466965_0176512_135_740 200
164 3300044735 Ga0466968_0031293 Ga0466968_0031293_1388_1993 200
165 3300044735 Ga0466968_0085492 Ga0466968_0085492_537_1142 200
166 3300044765 Ga0466970_0047682 Ga0466970_0047682_1640_2245 200
167 3300044901 Ga0466960_0130431 Ga0466960_0130431_201_806 200
168 3300045976 Ga0466967_1148472 Ga0466967_1148472_68_673 200
169 3300046474 Ga0495605_0022515 Ga0495605_0022515_678_1280 200
170 3300047447 Ga0495685_018908 Ga0495685_018908_170_772 200
171 3300048090 Ga0495615_0008393 Ga0495615_0008393_1378_1980 200
172 3300048915 Ga0496112_0283122 Ga0496112_0283122_137_739 200
173 3300048917 Ga0496114_0033470 Ga0496114_0033470_1331_1936 200
174 3300048922 Ga0496119_0002204 Ga0496119_0002204_6689_7294 200
175 3300048925 Ga0496122_0016290 Ga0496122_0016290_6001_6606 200
176 3300048926 Ga0496123_0003152 Ga0496123_0003152_7887_8492 200
177 3300048927 Ga0496124_0621386 Ga0496124_0621386_50_655 200
178 3300049569 Ga0501032_0030681 Ga0501032_0030681_1200_1805 200
179 3300049569 Ga0501032_0253244 Ga0501032_0253244_90_695 200
180 3300049570 Ga0501033_0086207 Ga0501033_0086207_1656_2261 200
181 3300049570 Ga0501033_0655498 Ga0501033_0655498_89_694 200
182 3300049570 Ga0501033_0718532 Ga0501033_0718532_29_634 200
183 3300049571 Ga0501034_0040812 Ga0501034_0040812_319_942 200
184 3300049571 Ga0501034_0043792 Ga0501034_0043792_1072_1677 200
185 3300049571 Ga0501034_0047013 Ga0501034_0047013_3290_3895 200
186 3300049571 Ga0501034_0204540 Ga0501034_0204540_662_1267 200
187 3300049571 Ga0501034_0690773 Ga0501034_0690773_40_645 200
188 3300049572 Ga0501036_0122800 Ga0501036_0122800_41_691 200
189 3300049573 Ga0501037_0498049 Ga0501037_0498049_153_758 200
190 3300049573 Ga0501037_0632905 Ga0501037_0632905_69_674 200
191 3300049575 Ga0501039_0693128 Ga0501039_0693128_159_764 200
192 3300049575 Ga0501039_0877091 Ga0501039_0877091_74_679 200
193 3300049579 Ga0501043_0084666 Ga0501043_0084666_313_918 200
194 3300049581 Ga0501047_0116972 Ga0501047_0116972_1209_1814 200
195 3300049581 Ga0501047_0129347 Ga0501047_0129347_187_810 200
196 3300049581 Ga0501047_0311122 Ga0501047_0311122_554_1159 200
197 3300049581 Ga0501047_0379037 Ga0501047_0379037_525_1130 200
198 3300049581 Ga0501047_0612446 Ga0501047_0612446_154_759 200
199 3300049583 Ga0501067_0001744 Ga0501067_0001744_5403_6008 200
200 3300049583 Ga0501067_0010872 Ga0501067_0010872_3006_3611 200
201 3300049583 Ga0501067_0164648 Ga0501067_0164648_175_780 200
202 3300049585 Ga0501069_0333209 Ga0501069_0333209_233_838 200
203 3300049585 Ga0501069_0615372 Ga0501069_0615372_14_619 200
204 3300049586 Ga0501070_0140460 Ga0501070_0140460_1243_1848 200
205 3300049586 Ga0501070_0229143 Ga0501070_0229143_540_1145 200
206 3300049588 Ga0501072_0030786 Ga0501072_0030786_28_630 200
207 3300049589 Ga0501073_0195125 Ga0501073_0195125_354_959 200
208 3300049590 Ga0501074_0449303 Ga0501074_0449303_109_714 200
209 3300049590 Ga0501074_0782060 Ga0501074_0782060_51_656 200
210 3300049592 Ga0501076_0141795 Ga0501076_0141795_277_882 200
211 3300049592 Ga0501076_0632789 Ga0501076_0632789_29_634 200
212 3300049593 Ga0501077_0185313 Ga0501077_0185313_618_1223 200
213 3300049593 Ga0501077_0331676 Ga0501077_0331676_139_744 200
214 3300049742 Ga0501080_0146841 Ga0501080_0146841_1457_2062 200
215 3300049742 Ga0501080_0295228 Ga0501080_0295228_372_977 200
216 3300049742 Ga0501080_0405843 Ga0501080_0405843_220_825 200
217 3300049744 Ga0501083_0000366 Ga0501083_0000366_22262_22867 200
218 3300049744 Ga0501083_0017441 Ga0501083_0017441_2465_3070 200
219 3300049744 Ga0501083_0028037 Ga0501083_0028037_1925_2530 200
220 3300049744 Ga0501083_0107224 Ga0501083_0107224_176_781 200
221 3300049744 Ga0501083_0113592 Ga0501083_0113592_1144_1749 200
222 3300049744 Ga0501083_0325455 Ga0501083_0325455_371_973 200
223 3300049822 Ga0501035_0166902 Ga0501035_0166902_31_636 200
224 3300049822 Ga0501035_0250345 Ga0501035_0250345_607_1212 200
225 3300049823 Ga0501044_0052069 Ga0501044_0052069_3410_4015 200
226 3300049823 Ga0501044_0248359 Ga0501044_0248359_19_624 200
227 3300049823 Ga0501044_0294391 Ga0501044_0294391_189_794 200
228 3300050507 nmdc:mga05p37_72901_c1 nmdc:mga05p37_72901_c1_266_877 200
229 3300050508 nmdc:mga09592_32634_c1 nmdc:mga09592_32634_c1_1187_1798 200
230 3300050510 nmdc:mga06r32_26639_c1 nmdc:mga06r32_26639_c1_1141_1752 200
231 3300050512 nmdc:mga0n895_1280964_c1 nmdc:mga0n895_1280964_c1_59_661 200
232 3300053098 Ga0500650_0228583 Ga0500650_0228583_134_739 200
233 3300053104 Ga0500556_0000038 Ga0500556_0000038_112342_112947 200
234 3300053131 Ga0500652_060723 Ga0500652_060723_523_1128 200
235 3300053158 Ga0500627_0155200 Ga0500627_0155200_183_788 200
236 3300053730 Ga0500645_019861 Ga0500645_019861_1449_2054 200
237 3300054114 Ga0501084_0106686 Ga0501084_0106686_504_1109 200
238 3300054114 Ga0501084_0350365 Ga0501084_0350365_409_1011 200
239 3300054114 Ga0501084_0622189 Ga0501084_0622189_195_800 200
240 3300060353 Ga0501082_0000002 Ga0501082_0000002_84760_85413 200
241 3300060353 Ga0501082_0019935 Ga0501082_0019935_4605_5210 200
242 3300060353 Ga0501082_0202157 Ga0501082_0202157_39_644 200
243 3300060353 Ga0501082_0266063 Ga0501082_0266063_608_1210 200
244 3300060353 Ga0501082_0920697 Ga0501082_0920697_29_634 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13662

Toprim_4

Toprim domain

113

204

0.98

PF21175

RecR_C

RecR, C-terminal

206

229

0.97

PF21176

RecR_HhH

RecR, helix-hairpin-helix

40

84

0.96

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

87

107

0.93

PF01751

Toprim

Toprim domain

114

203

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9415 82 173
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9317 82 173
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8603 20 200
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8558 20 200
4o6p-assembly1.cif.gz_C structural and functional studies the characterization of c58g/c70g mutant in cys4 zinc-finger motif in the recombination mediator protein recr 0.799 5 198
ID Description Score Start End Superfamily
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9545 79 200 3.40.1360.10
af_P9WHI3_76_174_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9511 79 172 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.947 79 200 3.40.1360.10
1vddC03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9422 79 172 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.935 78 172 3.40.1360.10
ID Description Score Start End GO Terms
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.9807 62 157 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9739 73 175 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-W1XYN8-F1-model_v4 Recombination protein RecR 0.9641 42 154 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.961 62 157 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9557 73 175 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.85 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map