F353594

General Info

Members Datasets Scaffolds Average Seq Length
241 179 239 466

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100037987|Ga0070665_1000379874
Length 527
Sequence MRVYPTARRRAASPRSPDISGLKIQPDYAVGWVTLLVRLPTADRDSMKRPLLGTTCLLALSLTVHAAPPDVGSAASEPQFRELYKELVETNTTLSSGSCTLAAERMAARLKAAGFPDSDLHPFAAPDHPKEGGLVAIYPGKDKKAKAILLMAHIDVVEAKREDWTRDPFKLVEENGNFYARGSFDDKAEAAIWVDTLIRYKKESFKPRRTLKLALTCGEETAGALNGAQWLTQNQRELIDAEFAINEGAWGELDAQGNKVVMQIEAGEKYPQNYRLEVTNRGGHSSRPVKDNAIYHLANALTKVEAYEFPAMFTDANRAYFAGIAKIQAAKANEANDNQKIADAMNSLVKDPTDAKAIALVSEKDPSWNATMRTTCVATMLEGGHATNALPQRARATVNCRIFPGVSPQSVQQKLEEIVGDSAVKITMPESRGPSPXXXXLTPRILGPFQKLTAQFWPGLPVLPLLQAGATDGEFTNAVGIPTYGIMPVFAGPDLGNIHGLNEYVGVNTLLEGRDFLYRLIKVYANQ

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
168 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
169 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
170 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
171 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
172 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
173 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
174 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
175 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
176 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.71
Nodule 0
Rhizoplane 3.73
Rhizosphere 79.25
Stem 0
Stem Tuber 0
Unclassified 8.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000652 3300003215 Bacteria 21214
2 Ga0070658_10000013 3300005327 Bacteria 267776
3 Ga0070658_10000413 3300005327 Bacteria 37184
4 Ga0070658_10026835 3300005327 Bacteria 4624
5 Ga0070658_10036095 3300005327 Bacteria 3983
6 Ga0070690_100034433 3300005330 Bacteria 3174
7 Ga0070670_100027677 3300005331 Bacteria 4876
8 Ga0070670_100101950 3300005331 Bacteria 2472
9 Ga0070666_10003728 3300005335 Bacteria 9234
10 Ga0070660_100061728 3300005339 Bacteria 2910
11 Ga0070661_100003037 3300005344 Bacteria 11542
12 Ga0070671_100001573 3300005355 Bacteria 17178
13 Ga0070671_100009778 3300005355 Bacteria 7702
14 Ga0070671_100011374 3300005355 Bacteria 7154
15 Ga0070671_100015957 3300005355 Bacteria 6068
16 Ga0070671_100048388 3300005355 Bacteria 3535
17 Ga0070674_100093313 3300005356 Bacteria 2178
18 Ga0070659_100000998 3300005366 Bacteria 20776
19 Ga0070659_100006502 3300005366 Bacteria 8436
20 Ga0070659_100107552 3300005366 Bacteria 2249
21 Ga0070659_100131979 3300005366 Bacteria 2029
22 Ga0070709_10067679 3300005434 Bacteria 2294
23 Ga0070711_100030942 3300005439 Unclassified 3549
24 Ga0070678_100029984 3300005456 Bacteria 3732
25 Ga0070678_100106197 3300005456 Bacteria 2188
26 Ga0070662_100041793 3300005457 Bacteria 3273
27 Ga0070681_10065613 3300005458 Bacteria 3598
28 Ga0070681_10281321 3300005458 Bacteria 1574
29 Ga0070698_100086501 3300005471 Unclassified 3121
30 Ga0070699_100093705 3300005518 Unclassified 2628
31 Ga0070665_100037590 3300005548 Bacteria 4867
32 Ga0070665_100037987 3300005548 Bacteria 4841
33 Ga0068855_100071317 3300005563 Bacteria 4040
34 Ga0068855_100199247 3300005563 Bacteria 2255
35 Ga0070664_100085889 3300005564 Bacteria 2718
36 Ga0070664_100140025 3300005564 Bacteria 2130
37 Ga0068852_100093522 3300005616 Bacteria 2695
38 Ga0068864_100002250 3300005618 Bacteria 15962
39 Ga0068851_10028719 3300005834 Bacteria 2748
40 Ga0068858_100000651 3300005842 Bacteria 36230
41 Ga0070717_10048337 3300006028 Bacteria 3489
42 Ga0070716_100019239 3300006173 Bacteria 3567
43 Ga0068871_100128168 3300006358 Bacteria 2149
44 Ga0068871_100133873 3300006358 Unclassified 2103
45 Ga0075428_100000212 3300006844 Bacteria 55968
46 Ga0075430_100022296 3300006846 Bacteria 5387
47 Ga0075431_100000078 3300006847 Bacteria 57344
48 Ga0068865_100000431 3300006881 Bacteria 23307
49 Ga0075436_100004381 3300006914 Bacteria 9689
50 Ga0099794_10021089 3300007265 Bacteria 2957
51 Ga0105240_10021910 3300009093 Bacteria 8488
52 Ga0105240_10029232 3300009093 Bacteria 7185
53 Ga0105240_10129556 3300009093 Bacteria 3028
54 Ga0105240_10259152 3300009093 Bacteria 2007
55 Ga0111539_10008125 3300009094 Bacteria 13367
56 Ga0111539_10019705 3300009094 Bacteria 8318
57 Ga0105245_10005111 3300009098 Bacteria 11533
58 Ga0114129_10047332 3300009147 Bacteria 6043
59 Ga0114129_10266569 3300009147 Bacteria 2293
60 Ga0105243_10083245 3300009148 Bacteria 2617
61 Ga0105242_10056538 3300009176 Bacteria 3211
62 Ga0105242_10175325 3300009176 Bacteria 1887
63 Ga0105248_10000097 3300009177 Bacteria 97424
64 Ga0105248_10000280 3300009177 Bacteria 60247
65 Ga0105248_10013228 3300009177 Bacteria 9084
66 Ga0105238_10045098 3300009551 Bacteria 4454
67 Ga0105249_10305799 3300009553 Bacteria 1596
68 Ga0105246_10012944 3300011119 Bacteria 5219
69 Ga0157378_10058016 3300013297 Bacteria 3452
70 Ga0157378_10175503 3300013297 Bacteria 2012
71 Ga0157375_10300962 3300013308 Bacteria 1767
72 Ga0163163_10067662 3300014325 Bacteria 3552
73 Ga0213876_10006758 3300021384 Bacteria 6262
74 Ga0209233_1008394 3300025261 Bacteria 3201
75 Ga0209758_1000008 3300025297 Bacteria 1215263
76 Ga0207688_10030177 3300025901 Bacteria 2989
77 Ga0207705_10001132 3300025909 Bacteria 21689
78 Ga0207705_10006065 3300025909 Bacteria 8990
79 Ga0207695_10104683 3300025913 Bacteria 2818
80 Ga0207663_10046915 3300025916 Unclassified 2664
81 Ga0207657_10031271 3300025919 Bacteria 4825
82 Ga0207650_10033996 3300025925 Bacteria 3696
83 Ga0207687_10007880 3300025927 Bacteria 6981
84 Ga0207644_10002597 3300025931 Bacteria 11634
85 Ga0207644_10010573 3300025931 Bacteria 6084
86 Ga0207690_10001176 3300025932 Bacteria 16564
87 Ga0207690_10005098 3300025932 Bacteria 7756
88 Ga0207706_10021956 3300025933 Bacteria 5730
89 Ga0207706_10034493 3300025933 Bacteria 4501
90 Ga0207686_10046195 3300025934 Bacteria 2685
91 Ga0207686_10105903 3300025934 Bacteria 1887
92 Ga0207704_10000223 3300025938 Bacteria 28382
93 Ga0207665_10018916 3300025939 Bacteria 4526
94 Ga0207691_10015763 3300025940 Bacteria 7183
95 Ga0207711_10000267 3300025941 Bacteria 56315
96 Ga0207711_10099076 3300025941 Bacteria 2576
97 Ga0207677_10062283 3300026023 Bacteria 2587
98 Ga0207703_10001240 3300026035 Bacteria 23887
99 Ga0207641_10166835 3300026088 Bacteria 2006
100 Ga0207648_10072308 3300026089 Bacteria 3006
101 Ga0207676_10012977 3300026095 Bacteria 5982
102 Ga0207676_10040990 3300026095 Bacteria 3552
103 Ga0207676_10093837 3300026095 Bacteria 2471
104 Ga0207683_10003677 3300026121 Bacteria 13324
105 Ga0207428_10035223 3300027907 Bacteria 4093
106 Ga0207428_10041474 3300027907 Bacteria 3726
107 Ga0268266_10004409 3300028379 Bacteria 13485
108 Ga0307517_10050455 3300028786 Bacteria 4229
109 Ga0307515_10039755 3300028794 Bacteria 7466
110 Ga0307513_10006292 3300031456 Bacteria 15550
111 Ga0307509_10000023 3300031507 Bacteria 242310
112 Ga0307405_10027597 3300031731 Bacteria 3294
113 Ga0307413_10029249 3300031824 Bacteria 3080
114 Ga0307409_100118872 3300031995 Bacteria 2233
115 Ga0307510_10000009 3300033180 Bacteria 409702
116 Ga0373934_0000019 3300035086 Bacteria 56145
117 Ga0373923_0016393 3300035111 Bacteria 2814
118 Ga0373954_0020137 3300035118 Bacteria 3015
119 Ga0373956_0000002 3300035119 Bacteria 88965
120 Ga0373957_0015204 3300035120 Bacteria 2645
121 Ga0373957_0024427 3300035120 Bacteria 2170
122 Ga0373955_0045214 3300035172 Bacteria 2375
123 Ga0373933_0000386 3300035724 Bacteria 28300
124 Ga0373933_0137251 3300035724 Bacteria 1541
125 Ga0373937_0000085 3300036401 Bacteria 85937
126 Ga0373937_0009036 3300036401 Bacteria 8651
127 Ga0395900_0091276 3300037418 Bacteria 3130
128 Ga0395905_0015004 3300037471 Bacteria 7384
129 Ga0395905_0038349 3300037471 Bacteria 4496
130 Ga0395905_0039707 3300037471 Bacteria 4416
131 Ga0395905_0156016 3300037471 Bacteria 2147
132 Ga0436365_0909946 3300039437 Bacteria 8310
133 Ga0436361_0565063 3300039447 Bacteria 3469
134 Ga0436361_0570418 3300039447 Bacteria 5071
135 Ga0436361_0923929 3300039447 Bacteria 2278
136 Ga0466958_0058077 3300045836 Bacteria 2352
137 Ga0495617_002749 3300046452 Bacteria 6801
138 Ga0495617_007532 3300046452 Bacteria 3775
139 Ga0495592_0057117 3300046454 Bacteria 2881
140 Ga0495638_0010096 3300046460 Bacteria 6578
141 Ga0495651_0000046 3300046462 Bacteria 89908
142 Ga0495580_0038968 3300046472 Bacteria 3400
143 Ga0495580_0133909 3300046472 Unclassified 1718
144 Ga0495605_0003477 3300046474 Bacteria 9369
145 Ga0495585_0025805 3300046492 Bacteria 3361
146 Ga0495607_0015392 3300046501 Bacteria 4958
147 Ga0495583_0000053 3300046506 Bacteria 210542
148 Ga0495606_0000594 3300046507 Bacteria 57221
149 Ga0495606_0009614 3300046507 Bacteria 8146
150 Ga0495616_0002605 3300046513 Bacteria 11874
151 Ga0495620_0040897 3300046515 Bacteria 2037
152 Ga0495628_0034888 3300046516 Bacteria 4044
153 Ga0495630_0045677 3300046517 Bacteria 3273
154 Ga0495631_0003693 3300046518 Bacteria 8351
155 Ga0495637_0035282 3300046520 Bacteria 2185
156 Ga0495644_0000391 3300046523 Bacteria 19655
157 Ga0495648_0001949 3300046524 Bacteria 19663
158 Ga0495642_0008004 3300046528 Bacteria 4045
159 Ga0495609_0000208 3300046538 Bacteria 58639
160 Ga0495597_0023108 3300046542 Bacteria 2878
161 Ga0495645_0129986 3300046543 Bacteria 1766
162 Ga0495634_0101383 3300046642 Bacteria 1859
163 Ga0495611_0000930 3300046648 Bacteria 15719
164 Ga0495625_0003483 3300046660 Bacteria 15621
165 Ga0495625_0029898 3300046660 Bacteria 4069
166 Ga0495657_0014424 3300046675 Bacteria 5801
167 Ga0495599_0003097 3300046678 Bacteria 9684
168 Ga0495599_0091935 3300046678 Bacteria 1893
169 Ga0495670_0001551 3300046691 Bacteria 11229
170 Ga0495671_0012588 3300046692 Bacteria 4614
171 Ga0495671_0062696 3300046692 Bacteria 1832
172 Ga0495600_0002659 3300046809 Bacteria 10327
173 Ga0495636_0000853 3300047318 Bacteria 11253
174 Ga0495672_0006508 3300047320 Bacteria 9027
175 Ga0495680_0021684 3300047322 Bacteria 5372
176 Ga0495680_0071473 3300047322 Bacteria 2642
177 Ga0495683_0005764 3300047323 Bacteria 6824
178 Ga0495687_000268 3300047443 Bacteria 69524
179 Ga0495677_0001739 3300047445 Bacteria 8722
180 Ga0495685_000031 3300047447 Bacteria 58983
181 Ga0495685_037588 3300047447 Bacteria 1660
182 Ga0495686_0000669 3300047472 Bacteria 46516
183 Ga0496100_0081758 3300048903 Bacteria 2183
184 Ga0496102_0011011 3300048905 Bacteria 7793
185 Ga0496105_0136802 3300048908 Bacteria 2018
186 Ga0496108_0065509 3300048911 Bacteria 3063
187 Ga0496109_0021901 3300048912 Bacteria 5658
188 Ga0496112_0005895 3300048915 Bacteria 10679
189 Ga0496112_0047407 3300048915 Bacteria 4216
190 Ga0496115_0000373 3300048918 Bacteria 36954
191 Ga0496115_0129742 3300048918 Bacteria 2077
192 Ga0496117_0000151 3300048920 Bacteria 148304
193 Ga0496118_0000016 3300048921 Bacteria 549586
194 Ga0496118_0029632 3300048921 Bacteria 4586
195 Ga0496119_0007587 3300048922 Bacteria 9733
196 Ga0496119_0035509 3300048922 Unclassified 3265
197 Ga0496120_0000713 3300048923 Bacteria 48804
198 Ga0496121_0024317 3300048924 Bacteria 5798
199 Ga0496122_0000935 3300048925 Bacteria 53083
200 Ga0496123_0000337 3300048926 Bacteria 88727
201 Ga0496124_0128883 3300048927 Bacteria 2012
202 Ga0496125_0025300 3300048928 Bacteria 5438
203 Ga0496126_0087637 3300048929 Bacteria 2743
204 Ga0495678_000706 3300049459 Bacteria 30378
205 Ga0495682_0004469 3300049460 Bacteria 5974
206 Ga0501032_0000113 3300049569 Bacteria 67568
207 Ga0501067_0000050 3300049583 Bacteria 69383
208 Ga0501068_0003153 3300049584 Bacteria 8827
209 Ga0501073_0004778 3300049589 Bacteria 10166
210 Ga0501077_0000004 3300049593 Bacteria 130033
211 Ga0501080_0006085 3300049742 Bacteria 10817
212 Ga0501044_0002091 3300049823 Bacteria 22987
213 nmdc:mga05p37_64806_c1 3300050507 Bacteria 4496
214 nmdc:mga09592_83289_c1 3300050508 Bacteria 2726
215 nmdc:mga0qj67_18578_c1 3300050509 Bacteria 5298
216 nmdc:mga0qj67_92721_c1 3300050509 Bacteria 2428
217 nmdc:mga06r32_27_c1 3300050510 Bacteria 88363
218 nmdc:mga06r32_50883_c1 3300050510 Bacteria 3963
219 nmdc:mga08y16_55229_c1 3300050511 Bacteria 4151
220 nmdc:mga08y16_562_c2 3300050511 Bacteria 27914
221 nmdc:mga08x19_9237_c1 3300050514 Bacteria 5892
222 Ga0500643_000026 3300053087 Bacteria 259231
223 Ga0500643_009202 3300053087 Bacteria 3795
224 Ga0500647_0053058 3300053091 Bacteria 1951
225 Ga0500566_0005568 3300053094 Bacteria 7484
226 Ga0500641_0001774 3300053096 Bacteria 7641
227 Ga0500554_000185 3300053102 Bacteria 12999
228 Ga0500562_002446 3300053108 Bacteria 4659
229 Ga0500572_004595 3300053111 Bacteria 3131
230 Ga0500595_000073 3300053119 Bacteria 70983
231 Ga0500595_004937 3300053119 Bacteria 5895
232 Ga0500595_006647 3300053119 Bacteria 4879
233 Ga0500608_009478 3300053122 Bacteria 4139
234 Ga0500614_000338 3300053123 Bacteria 12160
235 Ga0500658_0000669 3300053134 Bacteria 14134
236 Ga0500559_0001716 3300053136 Bacteria 12031
237 Ga0500568_0016810 3300053139 Bacteria 3242
238 Ga0500622_0000608 3300053156 Bacteria 32512
239 Ga0500622_0050986 3300053156 Bacteria 2131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10175503 Ga0157378_101755032 385
2 3300050508 nmdc:mga09592_83289_c1 nmdc:mga09592_83289_c1_833_2071 398
3 3300013297 Ga0157378_10058016 Ga0157378_100580162 413
4 3300048915 Ga0496112_0047407 Ga0496112_0047407_510_1919 429
5 3300046543 Ga0495645_0129986 Ga0495645_0129986_66_1358 430
6 3300021384 Ga0213876_10006758 Ga0213876_100067583 435
7 3300039437 Ga0436365_0909946 Ga0436365_0909946_884_2320 435
8 3300009093 Ga0105240_10029232 Ga0105240_100292322 436
9 3300053087 Ga0500643_009202 Ga0500643_009202_1426_2817 436
10 3300009098 Ga0105245_10005111 Ga0105245_100051119 437
11 3300009148 Ga0105243_10083245 Ga0105243_100832451 437
12 3300025927 Ga0207687_10007880 Ga0207687_100078805 437
13 3300005458 Ga0070681_10281321 Ga0070681_102813212 441
14 3300037418 Ga0395900_0091276 Ga0395900_0091276_104_1429 441
15 3300005366 Ga0070659_100006502 Ga0070659_1000065024 443
16 3300025932 Ga0207690_10005098 Ga0207690_100050985 443
17 3300053119 Ga0500595_004937 Ga0500595_004937_3739_5148 444
18 3300028794 Ga0307515_10039755 Ga0307515_100397556 446
19 3300009093 Ga0105240_10259152 Ga0105240_102591522 447
20 3300009177 Ga0105248_10000097 Ga0105248_1000009791 447
21 3300025941 Ga0207711_10000267 Ga0207711_1000026716 447
22 3300005327 Ga0070658_10026835 Ga0070658_100268353 448
23 3300005355 Ga0070671_100011374 Ga0070671_1000113745 448
24 3300005616 Ga0068852_100093522 Ga0068852_1000935222 448
25 3300025909 Ga0207705_10006065 Ga0207705_100060658 448
26 3300025931 Ga0207644_10010573 Ga0207644_100105737 448
27 3300046492 Ga0495585_0025805 Ga0495585_0025805_1969_3333 448
28 3300048915 Ga0496112_0005895 Ga0496112_0005895_8722_10149 448
29 3300005327 Ga0070658_10000013 Ga0070658_1000001372 449
30 3300005563 Ga0068855_100199247 Ga0068855_1001992472 449
31 3300048925 Ga0496122_0000935 Ga0496122_0000935_22229_23638 449
32 3300048926 Ga0496123_0000337 Ga0496123_0000337_22291_23700 449
33 3300005331 Ga0070670_100101950 Ga0070670_1001019502 452
34 3300005355 Ga0070671_100001573 Ga0070671_1000015732 452
35 3300005356 Ga0070674_100093313 Ga0070674_1000933133 452
36 3300005366 Ga0070659_100107552 Ga0070659_1001075522 452
37 3300005456 Ga0070678_100029984 Ga0070678_1000299844 452
38 3300005456 Ga0070678_100106197 Ga0070678_1001061971 452
39 3300005564 Ga0070664_100085889 Ga0070664_1000858893 452
40 3300013308 Ga0157375_10300962 Ga0157375_103009622 452
41 3300025901 Ga0207688_10030177 Ga0207688_100301773 452
42 3300025931 Ga0207644_10002597 Ga0207644_100025972 452
43 3300025933 Ga0207706_10034493 Ga0207706_100344932 452
44 3300025940 Ga0207691_10015763 Ga0207691_100157638 452
45 3300025941 Ga0207711_10099076 Ga0207711_100990763 452
46 3300026095 Ga0207676_10040990 Ga0207676_100409904 452
47 3300026121 Ga0207683_10003677 Ga0207683_1000367714 452
48 3300005331 Ga0070670_100027677 Ga0070670_1000276773 453
49 3300005355 Ga0070671_100015957 Ga0070671_1000159574 453
50 3300025925 Ga0207650_10033996 Ga0207650_100339962 453
51 3300026088 Ga0207641_10166835 Ga0207641_101668352 453
52 3300026095 Ga0207676_10093837 Ga0207676_100938372 453
53 3300031824 Ga0307413_10029249 Ga0307413_100292494 453
54 3300048921 Ga0496118_0029632 Ga0496118_0029632_2119_3504 453
55 3300053096 Ga0500641_0001774 Ga0500641_0001774_1392_2774 453
56 3300053122 Ga0500608_009478 Ga0500608_009478_2180_3676 453
57 3300005842 Ga0068858_100000651 Ga0068858_10000065123 454
58 3300026035 Ga0207703_10001240 Ga0207703_1000124021 454
59 3300050509 nmdc:mga0qj67_18578_c1 nmdc:mga0qj67_18578_c1_247_1647 454
60 3300050510 nmdc:mga06r32_50883_c1 nmdc:mga06r32_50883_c1_2146_3546 454
61 3300006844 Ga0075428_100000212 Ga0075428_10000021233 455
62 3300006847 Ga0075431_100000078 Ga0075431_10000007810 455
63 3300009094 Ga0111539_10019705 Ga0111539_100197054 455
64 3300009147 Ga0114129_10047332 Ga0114129_100473322 455
65 3300027907 Ga0207428_10041474 Ga0207428_100414746 455
66 3300037471 Ga0395905_0038349 Ga0395905_0038349_1482_2900 455
67 3300037471 Ga0395905_0039707 Ga0395905_0039707_2753_4177 455
68 3300049569 Ga0501032_0000113 Ga0501032_0000113_23418_24830 455
69 3300049583 Ga0501067_0000050 Ga0501067_0000050_11021_12433 455
70 3300049584 Ga0501068_0003153 Ga0501068_0003153_6523_7935 455
71 3300049589 Ga0501073_0004778 Ga0501073_0004778_6570_7982 455
72 3300049593 Ga0501077_0000004 Ga0501077_0000004_94640_96052 455
73 3300049742 Ga0501080_0006085 Ga0501080_0006085_1364_2776 455
74 3300049823 Ga0501044_0002091 Ga0501044_0002091_19_1431 455
75 3300050507 nmdc:mga05p37_64806_c1 nmdc:mga05p37_64806_c1_383_1801 455
76 3300050510 nmdc:mga06r32_27_c1 nmdc:mga06r32_27_c1_28715_30133 455
77 3300050511 nmdc:mga08y16_562_c2 nmdc:mga08y16_562_c2_4681_6099 455
78 3300025261 Ga0209233_1008394 Ga0209233_10083942 457
79 3300048920 Ga0496117_0000151 Ga0496117_0000151_143499_144932 457
80 3300048921 Ga0496118_0000016 Ga0496118_0000016_68568_70001 457
81 3300048922 Ga0496119_0007587 Ga0496119_0007587_5101_6534 457
82 3300048923 Ga0496120_0000713 Ga0496120_0000713_4298_5731 457
83 3300048924 Ga0496121_0024317 Ga0496121_0024317_4093_5526 457
84 3300048927 Ga0496124_0128883 Ga0496124_0128883_285_1718 457
85 3300005548 Ga0070665_100037590 Ga0070665_1000375902 458
86 3300006028 Ga0070717_10048337 Ga0070717_100483372 458
87 3300009094 Ga0111539_10008125 Ga0111539_100081254 458
88 3300009551 Ga0105238_10045098 Ga0105238_100450982 458
89 3300027907 Ga0207428_10035223 Ga0207428_100352232 458
90 3300028379 Ga0268266_10004409 Ga0268266_100044095 458
91 3300033180 Ga0307510_10000009 Ga0307510_1000000919 458
92 3300035724 Ga0373933_0137251 Ga0373933_0137251_103_1506 458
93 3300037471 Ga0395905_0156016 Ga0395905_0156016_478_1896 458
94 3300046517 Ga0495630_0045677 Ga0495630_0045677_1442_2845 458
95 3300047322 Ga0495680_0071473 Ga0495680_0071473_429_1832 458
96 3300048922 Ga0496119_0035509 Ga0496119_0035509_1394_2827 458
97 3300048928 Ga0496125_0025300 Ga0496125_0025300_209_1642 458
98 3300050511 nmdc:mga08y16_55229_c1 nmdc:mga08y16_55229_c1_11_1429 458
99 3300005471 Ga0070698_100086501 Ga0070698_1000865012 459
100 3300005518 Ga0070699_100093705 Ga0070699_1000937052 459
101 3300006846 Ga0075430_100022296 Ga0075430_1000222961 459
102 3300009147 Ga0114129_10266569 Ga0114129_102665691 459
103 3300009553 Ga0105249_10305799 Ga0105249_103057991 459
104 3300035086 Ga0373934_0000019 Ga0373934_0000019_24619_26025 459
105 3300035119 Ga0373956_0000002 Ga0373956_0000002_41954_43360 459
106 3300035120 Ga0373957_0015204 Ga0373957_0015204_331_1737 459
107 3300035172 Ga0373955_0045214 Ga0373955_0045214_266_1672 459
108 3300035724 Ga0373933_0000386 Ga0373933_0000386_11172_12578 459
109 3300036401 Ga0373937_0000085 Ga0373937_0000085_27769_29175 459
110 3300046462 Ga0495651_0000046 Ga0495651_0000046_46051_47457 459
111 3300046507 Ga0495606_0009614 Ga0495606_0009614_1124_2581 459
112 3300046515 Ga0495620_0040897 Ga0495620_0040897_551_1963 459
113 3300046675 Ga0495657_0014424 Ga0495657_0014424_1812_3218 459
114 3300048918 Ga0496115_0000373 Ga0496115_0000373_12410_13822 459
115 3300050509 nmdc:mga0qj67_92721_c1 nmdc:mga0qj67_92721_c1_982_2409 459
116 3300005366 Ga0070659_100000998 Ga0070659_1000009982 460
117 3300025932 Ga0207690_10001176 Ga0207690_100011761 460
118 3300031507 Ga0307509_10000023 Ga0307509_10000023126 460
119 3300035111 Ga0373923_0016393 Ga0373923_0016393_154_1560 460
120 3300035118 Ga0373954_0020137 Ga0373954_0020137_1257_2663 460
121 3300035120 Ga0373957_0024427 Ga0373957_0024427_65_1471 460
122 3300039447 Ga0436361_0565063 Ga0436361_0565063_1867_3270 460
123 3300046452 Ga0495617_002749 Ga0495617_002749_4819_6225 460
124 3300046454 Ga0495592_0057117 Ga0495592_0057117_1261_2667 460
125 3300046472 Ga0495580_0038968 Ga0495580_0038968_1403_2809 460
126 3300046516 Ga0495628_0034888 Ga0495628_0034888_14_1420 460
127 3300046520 Ga0495637_0035282 Ga0495637_0035282_572_1978 460
128 3300046642 Ga0495634_0101383 Ga0495634_0101383_115_1521 460
129 3300046678 Ga0495599_0003097 Ga0495599_0003097_4161_5567 460
130 3300046678 Ga0495599_0091935 Ga0495599_0091935_208_1614 460
131 3300046809 Ga0495600_0002659 Ga0495600_0002659_2554_3960 460
132 3300047322 Ga0495680_0021684 Ga0495680_0021684_1285_2691 460
133 3300053091 Ga0500647_0053058 Ga0500647_0053058_178_1590 460
134 3300053094 Ga0500566_0005568 Ga0500566_0005568_5718_7130 460
135 3300053102 Ga0500554_000185 Ga0500554_000185_5868_7280 460
136 3300053111 Ga0500572_004595 Ga0500572_004595_728_2140 460
137 3300053119 Ga0500595_000073 Ga0500595_000073_30669_32081 460
138 3300053123 Ga0500614_000338 Ga0500614_000338_763_2175 460
139 3300053136 Ga0500559_0001716 Ga0500559_0001716_1567_2979 460
140 3300046452 Ga0495617_007532 Ga0495617_007532_1257_2669 461
141 3300046460 Ga0495638_0010096 Ga0495638_0010096_3475_4887 461
142 3300046474 Ga0495605_0003477 Ga0495605_0003477_608_2020 461
143 3300046501 Ga0495607_0015392 Ga0495607_0015392_542_1954 461
144 3300046506 Ga0495583_0000053 Ga0495583_0000053_130462_131874 461
145 3300046513 Ga0495616_0002605 Ga0495616_0002605_7184_8596 461
146 3300046523 Ga0495644_0000391 Ga0495644_0000391_15064_16476 461
147 3300046524 Ga0495648_0001949 Ga0495648_0001949_2410_3822 461
148 3300046538 Ga0495609_0000208 Ga0495609_0000208_25023_26435 461
149 3300046648 Ga0495611_0000930 Ga0495611_0000930_1968_3380 461
150 3300046660 Ga0495625_0003483 Ga0495625_0003483_11528_12940 461
151 3300046691 Ga0495670_0001551 Ga0495670_0001551_721_2133 461
152 3300046692 Ga0495671_0012588 Ga0495671_0012588_2682_4094 461
153 3300047318 Ga0495636_0000853 Ga0495636_0000853_6446_7858 461
154 3300047320 Ga0495672_0006508 Ga0495672_0006508_617_2029 461
155 3300047323 Ga0495683_0005764 Ga0495683_0005764_637_2049 461
156 3300047443 Ga0495687_000268 Ga0495687_000268_50166_51578 461
157 3300047445 Ga0495677_0001739 Ga0495677_0001739_3555_4967 461
158 3300047447 Ga0495685_000031 Ga0495685_000031_7953_9365 461
159 3300049459 Ga0495678_000706 Ga0495678_000706_6948_8360 461
160 3300049460 Ga0495682_0004469 Ga0495682_0004469_2682_4094 461
161 3300005327 Ga0070658_10000413 Ga0070658_100004132 462
162 3300005327 Ga0070658_10036095 Ga0070658_100360954 462
163 3300005330 Ga0070690_100034433 Ga0070690_1000344332 462
164 3300005335 Ga0070666_10003728 Ga0070666_100037287 462
165 3300005339 Ga0070660_100061728 Ga0070660_1000617284 462
166 3300005366 Ga0070659_100131979 Ga0070659_1001319791 462
167 3300005434 Ga0070709_10067679 Ga0070709_100676792 462
168 3300005439 Ga0070711_100030942 Ga0070711_1000309422 462
169 3300005458 Ga0070681_10065613 Ga0070681_100656133 462
170 3300005548 Ga0070665_100037987 Ga0070665_1000379874 462
171 3300006173 Ga0070716_100019239 Ga0070716_1000192392 462
172 3300006914 Ga0075436_100004381 Ga0075436_1000043819 462
173 3300007265 Ga0099794_10021089 Ga0099794_100210892 462
174 3300011119 Ga0105246_10012944 Ga0105246_100129445 462
175 3300025909 Ga0207705_10001132 Ga0207705_1000113211 462
176 3300025916 Ga0207663_10046915 Ga0207663_100469153 462
177 3300025919 Ga0207657_10031271 Ga0207657_100312716 462
178 3300025939 Ga0207665_10018916 Ga0207665_100189164 462
179 3300026023 Ga0207677_10062283 Ga0207677_100622832 462
180 3300026089 Ga0207648_10072308 Ga0207648_100723083 462
181 3300046660 Ga0495625_0029898 Ga0495625_0029898_2204_3646 462
182 3300047472 Ga0495686_0000669 Ga0495686_0000669_14857_16272 462
183 3300048908 Ga0496105_0136802 Ga0496105_0136802_370_1818 462
184 3300050514 nmdc:mga08x19_9237_c1 nmdc:mga08x19_9237_c1_1244_2656 462
185 iso_pu_bacteria 2643221598 2644001380 462
186 3300005355 Ga0070671_100009778 Ga0070671_1000097783 463
187 3300005457 Ga0070662_100041793 Ga0070662_1000417933 463
188 3300005563 Ga0068855_100071317 Ga0068855_1000713173 463
189 3300005618 Ga0068864_100002250 Ga0068864_10000225017 463
190 3300006881 Ga0068865_100000431 Ga0068865_1000004314 463
191 3300009093 Ga0105240_10021910 Ga0105240_100219102 463
192 3300009093 Ga0105240_10129556 Ga0105240_101295562 463
193 3300009176 Ga0105242_10175325 Ga0105242_101753252 463
194 3300009177 Ga0105248_10000280 Ga0105248_1000028040 463
195 3300025913 Ga0207695_10104683 Ga0207695_101046833 463
196 3300025933 Ga0207706_10021956 Ga0207706_100219563 463
197 3300025934 Ga0207686_10105903 Ga0207686_101059032 463
198 3300025938 Ga0207704_10000223 Ga0207704_1000022325 463
199 3300026095 Ga0207676_10012977 Ga0207676_100129772 463
200 3300028786 Ga0307517_10050455 Ga0307517_100504552 463
201 3300031456 Ga0307513_10006292 Ga0307513_1000629217 463
202 3300046528 Ga0495642_0008004 Ga0495642_0008004_859_2268 463
203 3300048903 Ga0496100_0081758 Ga0496100_0081758_493_1908 463
204 3300048905 Ga0496102_0011011 Ga0496102_0011011_3857_5272 463
205 3300048911 Ga0496108_0065509 Ga0496108_0065509_1254_2669 463
206 3300048912 Ga0496109_0021901 Ga0496109_0021901_558_1973 463
207 3300053087 Ga0500643_000026 Ga0500643_000026_254493_255896 463
208 3300053139 Ga0500568_0016810 Ga0500568_0016810_1211_2614 463
209 iso_pu_bacteria 2582581279 2585146469 463
210 3300006358 Ga0068871_100128168 Ga0068871_1001281682 464
211 3300009176 Ga0105242_10056538 Ga0105242_100565383 464
212 3300025934 Ga0207686_10046195 Ga0207686_100461952 464
213 3300039447 Ga0436361_0570418 Ga0436361_0570418_3078_4577 464
214 3300039447 Ga0436361_0923929 Ga0436361_0923929_643_2052 464
215 3300048929 Ga0496126_0087637 Ga0496126_0087637_279_1712 464
216 3300053119 Ga0500595_006647 Ga0500595_006647_1898_3307 464
217 3300053156 Ga0500622_0050986 Ga0500622_0050986_687_2099 464
218 3300005344 Ga0070661_100003037 Ga0070661_1000030372 465
219 3300005355 Ga0070671_100048388 Ga0070671_1000483882 465
220 3300005564 Ga0070664_100140025 Ga0070664_1001400252 465
221 3300005834 Ga0068851_10028719 Ga0068851_100287192 465
222 3300006358 Ga0068871_100133873 Ga0068871_1001338733 465
223 3300009177 Ga0105248_10013228 Ga0105248_100132284 465
224 3300014325 Ga0163163_10067662 Ga0163163_100676624 465
225 3300036401 Ga0373937_0009036 Ga0373937_0009036_5422_6837 465
226 3300046472 Ga0495580_0133909 Ga0495580_0133909_119_1534 465
227 3300046507 Ga0495606_0000594 Ga0495606_0000594_12593_14026 465
228 3300047447 Ga0495685_037588 Ga0495685_037588_172_1590 465
229 3300031731 Ga0307405_10027597 Ga0307405_100275972 466
230 3300031995 Ga0307409_100118872 Ga0307409_1001188721 466
231 3300037471 Ga0395905_0015004 Ga0395905_0015004_1712_3127 466
232 3300045836 Ga0466958_0058077 Ga0466958_0058077_344_1771 466
233 3300046518 Ga0495631_0003693 Ga0495631_0003693_5053_6474 466
234 3300046542 Ga0495597_0023108 Ga0495597_0023108_519_1940 466
235 3300046692 Ga0495671_0062696 Ga0495671_0062696_156_1577 466
236 3300048918 Ga0496115_0129742 Ga0496115_0129742_20_1513 466
237 3300053108 Ga0500562_002446 Ga0500562_002446_3084_4505 466
238 3300053134 Ga0500658_0000669 Ga0500658_0000669_2538_3956 466
239 3300053156 Ga0500622_0000608 Ga0500622_0000608_24865_26286 466
240 3300003215 JGI25153J46596_10000652 JGI25153J46596_1000065212 467
241 3300025297 Ga0209758_1000008 Ga0209758_10000081162 467

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

267

427

0.96

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

149

523

0.92

PF04389

Peptidase_M28

Peptidase family M28

133

362

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8604 19 196
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.8499 24 465
7t1q-assembly1.cif.gz_B crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid 0.8471 28 466
7t1q-assembly1.cif.gz_B crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid 0.8408 28 466
5xoy-assembly1.cif.gz_A-2 crystal structure of lysk from thermus thermophilus in complex with lysine 0.8404 28 464
ID Description Score Start End Superfamily
af_Q2FWN8_3_180_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8958 20 194 3.40.630.10
af_Q55DP8_2_191_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8941 18 196 3.40.630.10
1q7lC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8791 27 196 3.40.630.10
af_B6TIJ2_17_198_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8582 28 181 3.40.630.10
af_P23908_15_171_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8569 36 194 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A525IPT0-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9205 14 130 GO:0016787
AF-A0A4Q6EZE8-F1-model_v4 deleted 0.9182 11 271
AF-E6V8U3-F1-model_v4 Peptidase M20 0.917 11 465 GO:0006508
GO:0008233
AF-A0A7W1HAW7-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9165 212 463 GO:0006508
GO:0008233
AF-A0A522Z1D4-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9149 19 465 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.51 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map