F350491

General Info

Members Datasets Scaffolds Average Seq Length
237 173 220 498

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221646|2644260500
Length 575
Sequence IARIVVVGGGSAGWMVAAALVTGLKGRAAVEVVESEXIGIXGVGEATFPSIRNYNQLIGXDERDFLRATNGTYKLGIRFCDWLDVGKDYFHTFGHFGNLFGSQTLWGQHRRMGLXXPLGVQCVPTVMAMKGRFVLPDEQAQFKYAYHFDPLGVQCVPTVMAMKGRFVLPDEQAQFKYAYHFDAVQYAAFLRKXAVQRGARHTLGRITDVSRRADGGVAAVQLEDGRRIXGDLFVDCSGFRSLLLGQALAEPFVDFSHWLPVDGAWACPTERVGEELAPYTXATALEGGWAWRIPLQNRTGHGHVFSSRFIDADRAREXLLARLDGKPLGEPRXXRFTTGHRERFWVHNVVAIGLSSGFLEPLESTSIYLIQDGISRLMTLLTAGRPVDENDRALFNDGAARRFARIRDFIILHYCLTRRRDSELWRRDSELWRHRHHPAGRPVDENDRALFNDGAARRFARIRDFIILHYCLTRRRDSELWRHVSSMELPETLAFRMELWRRYGVLHEYDEEGFDATSWLAIHAGMEHWPERNDPVFAEISPERATQALDQRRKAIEASVARMPQHHRMLLKMLG

Samples

Sample ID Description Type Environment
1 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
2 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
3 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
4 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
5 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
8 2643221656 Pelomonas sp. Root405 Isolate Unclassified
9 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
10 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
11 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
117 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
158 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
159 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
163 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
164 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
167 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
172 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
173 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.51
Metatranscriptomes 0
Isolates 5.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.68
Nodule 0.84
Rhizoplane 2.53
Rhizosphere 62.03
Stem 0
Stem Tuber 0
Unclassified 13.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10007265 3300001989 Bacteria 4163
2 JGI25156J39149_1000974 3300002705 Bacteria 13636
3 JGI25156J39149_1012910 3300002705 Bacteria 1806
4 JGI25154J39366_1000548 3300002738 Bacteria 18583
5 JGI25157J39369_1000049 3300002741 Bacteria 115611
6 JGI25150J39212_1000582 3300002774 Bacteria 14421
7 JGI25153J46596_10000260 3300003215 Bacteria 42298
8 rootH1_10001762 3300003316 Bacteria 21345
9 rootL2_10028753 3300003322 Bacteria 6815
10 rootL2_10035907 3300003322 Bacteria 9818
11 rootL2_10088908 3300003322 Bacteria 4466
12 rootH1_10021415 3300003323 Bacteria 26101
13 Ga0055539_1000696 3300003752 Bacteria 8641
14 Ga0055525_1000046 3300003759 Bacteria 261587
15 Ga0055535_1000121 3300003761 Bacteria 83760
16 Ga0055529_1000223 3300003763 Bacteria 72861
17 Ga0055526_1001427 3300003771 Bacteria 17011
18 Ga0055537_1002490 3300003773 Bacteria 6141
19 Ga0055524_1000129 3300003775 Bacteria 88836
20 Ga0055528_1008134 3300003790 Bacteria 4541
21 Ga0055540_1010104 3300003792 Bacteria 3172
22 Ga0065165_1001232 3300005262 Bacteria 29266
23 Ga0065165_1009535 3300005262 Bacteria 4339
24 Ga0070660_100107776 3300005339 Bacteria 2214
25 Ga0070673_100019830 3300005364 Bacteria 4836
26 Ga0070659_100186691 3300005366 Bacteria 1703
27 Ga0068853_100027738 3300005539 Bacteria 4760
28 Ga0068853_100113617 3300005539 Bacteria 2408
29 Ga0068857_100004451 3300005577 Bacteria 11839
30 Ga0068854_100001635 3300005578 Bacteria 13642
31 Ga0068856_100000458 3300005614 Bacteria 44947
32 Ga0068856_100097074 3300005614 Bacteria 2936
33 Ga0068863_100001437 3300005841 Bacteria 23607
34 Ga0068860_100005179 3300005843 Bacteria 13257
35 Ga0081455_10010161 3300005937 Bacteria 9584
36 Ga0099826_10000001 3300006948 Bacteria 1155201
37 Ga0105240_10021972 3300009093 Bacteria 8475
38 Ga0105240_10315548 3300009093 Bacteria 1783
39 Ga0105243_10083503 3300009148 Bacteria 2613
40 Ga0105241_10016919 3300009174 Bacteria 5352
41 Ga0105237_10007549 3300009545 Bacteria 11884
42 Ga0105033_102984 3300009986 Bacteria 1412
43 Ga0105239_10024844 3300010375 Bacteria 6601
44 Ga0157369_10000835 3300013105 Bacteria 39366
45 Ga0163162_10119960 3300013306 Bacteria 2733
46 Ga0157372_10256604 3300013307 Bacteria 2030
47 Ga0213872_10000002 3300021361 Bacteria 554092
48 Ga0213872_10001334 3300021361 Bacteria 16286
49 Ga0213872_10055524 3300021361 Bacteria 1795
50 Ga0209563_100005 3300025230 Bacteria 1774893
51 Ga0209258_100163 3300025242 Bacteria 149677
52 Ga0207425_1000072 3300025245 Bacteria 115017
53 Ga0209646_1000138 3300025246 Bacteria 114892
54 Ga0209026_1000021 3300025250 Bacteria 375165
55 Ga0209026_1004801 3300025250 Bacteria 3859
56 Ga0209677_100484 3300025253 Bacteria 22615
57 Ga0209148_1004654 3300025254 Bacteria 3320
58 Ga0209759_1000025 3300025256 Bacteria 317082
59 Ga0209759_1001069 3300025256 Bacteria 17985
60 Ga0209129_1002536 3300025258 Bacteria 8864
61 Ga0209565_1000132 3300025263 Bacteria 104716
62 Ga0209565_1000281 3300025263 Bacteria 50202
63 Ga0209455_1000059 3300025272 Bacteria 339995
64 Ga0209673_1004175 3300025273 Bacteria 7887
65 Ga0209673_1010361 3300025273 Bacteria 3934
66 Ga0209676_1030942 3300025292 Bacteria 1629
67 Ga0209025_1000721 3300025294 Bacteria 56094
68 Ga0209564_1000502 3300025295 Bacteria 64443
69 Ga0209564_1004092 3300025295 Bacteria 9185
70 Ga0209758_1000009 3300025297 Bacteria 1123483
71 Ga0209758_1001190 3300025297 Bacteria 32852
72 Ga0209758_1006117 3300025297 Bacteria 8827
73 Ga0209050_1000005 3300025298 Bacteria 1557793
74 Ga0209050_1004719 3300025298 Bacteria 9028
75 Ga0209256_1000285 3300025299 Bacteria 88890
76 Ga0209256_1019885 3300025299 Bacteria 2118
77 Ga0209051_1000377 3300025303 Bacteria 63522
78 Ga0209257_1002030 3300025304 Bacteria 21596
79 Ga0209257_1002036 3300025304 Bacteria 21541
80 Ga0209257_1016233 3300025304 Bacteria 3027
81 Ga0207654_10055543 3300025911 Bacteria 2293
82 Ga0207695_10013031 3300025913 Bacteria 9932
83 Ga0207671_10094777 3300025914 Bacteria 2253
84 Ga0207657_10114612 3300025919 Bacteria 2222
85 Ga0207667_10060257 3300025949 Bacteria 3973
86 Ga0207651_10015889 3300025960 Bacteria 4390
87 Ga0207640_10002868 3300025981 Bacteria 9246
88 Ga0207702_10000227 3300026078 Bacteria 65464
89 Ga0207702_10030219 3300026078 Bacteria 4514
90 Ga0207641_10000210 3300026088 Bacteria 75487
91 Ga0207674_10007836 3300026116 Bacteria 12416
92 Ga0209282_1000001 3300027666 Bacteria 2450367
93 Ga0268264_10000408 3300028381 Bacteria 60961
94 Ga0307515_10081592 3300028794 Bacteria 4198
95 Ga0265327_10009961 3300031251 Bacteria 6766
96 Ga0307513_10058844 3300031456 Bacteria 4081
97 Ga0307513_10102102 3300031456 Bacteria 2888
98 Ga0307408_100000029 3300031548 Bacteria 227806
99 Ga0307408_100000087 3300031548 Bacteria 101616
100 Ga0265314_10054864 3300031711 Bacteria 2755
101 Ga0316578_10028048 3300031728 Bacteria 3186
102 Ga0307516_10018957 3300031730 Bacteria 7141
103 Ga0307405_10040614 3300031731 Bacteria 2819
104 Ga0307413_10010694 3300031824 Bacteria 4468
105 Ga0307413_10056387 3300031824 Bacteria 2396
106 Ga0307410_10154180 3300031852 Bacteria 1713
107 Ga0307406_10004383 3300031901 Bacteria 7674
108 Ga0307407_10016276 3300031903 Bacteria 3698
109 Ga0307409_100063570 3300031995 Bacteria 2894
110 Ga0307416_100158386 3300032002 Bacteria 2088
111 Ga0307414_10078890 3300032004 Bacteria 2401
112 Ga0307411_10000047 3300032005 Bacteria 35825
113 Ga0307411_10016840 3300032005 Bacteria 4146
114 Ga0307411_10038056 3300032005 Bacteria 3030
115 Ga0307411_10068136 3300032005 Bacteria 2397
116 Ga0307415_100064583 3300032126 Bacteria 2547
117 Ga0373940_0005523 3300035088 Bacteria 2745
118 Ga0373939_0000187 3300035114 Bacteria 17199
119 Ga0373962_0019149 3300035242 Bacteria 1788
120 Ga0316574_0016186 3300035398 Bacteria 4341
121 Ga0373931_0000096 3300035691 Bacteria 40532
122 Ga0316582_0016954 3300036647 Bacteria 4202
123 Ga0395899_0139668 3300037312 Bacteria 1725
124 Ga0395900_0236970 3300037418 Bacteria 1832
125 Ga0395905_0002289 3300037471 Bacteria 21489
126 Ga0395905_0003500 3300037471 Bacteria 16752
127 Ga0395905_0006465 3300037471 Bacteria 11791
128 Ga0395905_0187785 3300037471 Bacteria 1939
129 Ga0436361_0061503 3300039447 Bacteria 127805
130 Ga0436363_0411453 3300039450 Bacteria 2327
131 Ga0451853_0178522 3300041512 Bacteria 2511
132 Ga0439437_000478 3300042000 Bacteria 3945
133 Ga0439448_0000590 3300042005 Bacteria 8528
134 Ga0439450_002798 3300042008 Bacteria 2797
135 Ga0439455_0000206 3300042012 Bacteria 6887
136 Ga0439435_0012648 3300042436 Bacteria 2050
137 Ga0466969_0000006 3300044656 Bacteria 152970
138 Ga0466965_0032446 3300044683 Bacteria 2551
139 Ga0466966_0085347 3300044684 Bacteria 1963
140 Ga0466963_0010488 3300044694 Bacteria 5610
141 Ga0466964_0000040 3300044706 Bacteria 26586
142 Ga0453684_0049667 3300044712 Bacteria 5528
143 Ga0453684_0088776 3300044712 Bacteria 3827
144 Ga0466957_0009789 3300044842 Bacteria 5479
145 Ga0466959_0043670 3300045049 Bacteria 3304
146 Ga0451576_0022117 3300045051 Bacteria 6899
147 Ga0466967_0007328 3300045976 Bacteria 7944
148 Ga0466967_0105108 3300045976 Bacteria 2586
149 Ga0495638_0001741 3300046460 Bacteria 19095
150 Ga0495638_0001888 3300046460 Bacteria 18107
151 Ga0495638_0005318 3300046460 Bacteria 9601
152 Ga0495638_0039323 3300046460 Bacteria 3003
153 Ga0495638_0043527 3300046460 Bacteria 2832
154 Ga0495650_0000017 3300046471 Bacteria 542552
155 Ga0495650_0000169 3300046471 Bacteria 145238
156 Ga0495606_0000972 3300046507 Bacteria 41909
157 Ga0495606_0004803 3300046507 Bacteria 13281
158 Ga0495610_0000343 3300046512 Bacteria 49113
159 Ga0495616_0009543 3300046513 Bacteria 5666
160 Ga0495616_0022392 3300046513 Bacteria 3413
161 Ga0495632_0035183 3300046519 Bacteria 2558
162 Ga0495637_0002849 3300046520 Bacteria 9381
163 Ga0495637_0005235 3300046520 Bacteria 6640
164 Ga0495654_0000126 3300046530 Bacteria 85179
165 Ga0495622_0000003 3300046557 Bacteria 268681
166 Ga0495625_0000064 3300046660 Bacteria 174730
167 Ga0495625_0000139 3300046660 Bacteria 112271
168 Ga0495625_0003153 3300046660 Bacteria 16792
169 Ga0495625_0006347 3300046660 Bacteria 10560
170 Ga0495625_0046255 3300046660 Bacteria 3141
171 Ga0495661_0001023 3300046665 Bacteria 24840
172 Ga0495670_0000024 3300046691 Bacteria 91893
173 Ga0495649_0007059 3300046694 Bacteria 6911
174 Ga0495660_0000213 3300046810 Bacteria 59421
175 Ga0495660_0005780 3300046810 Bacteria 7390
176 Ga0495672_0000647 3300047320 Bacteria 38716
177 Ga0495672_0000782 3300047320 Bacteria 34487
178 Ga0495687_002038 3300047443 Bacteria 17054
179 Ga0495677_0000202 3300047445 Bacteria 27383
180 Ga0495626_0000020 3300048091 Bacteria 222537
181 Ga0495626_0005589 3300048091 Bacteria 7293
182 Ga0496100_0006476 3300048903 Bacteria 6384
183 Ga0496102_0000159 3300048905 Bacteria 91043
184 Ga0496102_0030170 3300048905 Bacteria 4853
185 Ga0496109_0005999 3300048912 Bacteria 10205
186 Ga0496113_0021320 3300048916 Bacteria 4569
187 Ga0496115_0017002 3300048918 Bacteria 5548
188 Ga0496122_0001613 3300048925 Bacteria 35254
189 Ga0496123_0000198 3300048926 Bacteria 122508
190 Ga0496125_0000605 3300048928 Bacteria 61001
191 Ga0501033_0114171 3300049570 Bacteria 1964
192 Ga0501069_0051811 3300049585 Bacteria 2285
193 Ga0501070_0020978 3300049586 Bacteria 5481
194 Ga0501201_002670 3300049651 Bacteria 1633
195 Ga0501211_000261 3300049658 Bacteria 4734
196 Ga0501211_000752 3300049658 Bacteria 3322
197 Ga0501211_003400 3300049658 Bacteria 1643
198 Ga0501233_001741 3300049668 Bacteria 3751
199 Ga0501235_001379 3300049669 Bacteria 5152
200 Ga0501235_001996 3300049669 Bacteria 4372
201 Ga0501235_007686 3300049669 Bacteria 2349
202 Ga0501235_019279 3300049669 Bacteria 1513
203 Ga0501249_001928 3300049679 Bacteria 4217
204 Ga0501229_000022 3300049706 Bacteria 17361
205 Ga0501229_000028 3300049706 Bacteria 15831
206 Ga0501229_000275 3300049706 Bacteria 5838
207 Ga0501229_001714 3300049706 Bacteria 2567
208 Ga0501265_004005 3300049762 Bacteria 1674
209 Ga0501267_000036 3300049764 Bacteria 7462
210 nmdc:mga0n895_300898_c1 3300050512 Bacteria 1626
211 Ga0500554_005872 3300053102 Bacteria 2714
212 Ga0500556_0000357 3300053104 Bacteria 33957
213 Ga0500556_0000415 3300053104 Bacteria 30866
214 Ga0500618_000060 3300053125 Bacteria 97135
215 Ga0500658_0003967 3300053134 Bacteria 5551
216 Ga0500658_0009025 3300053134 Bacteria 3680
217 Ga0500616_0007476 3300053153 Bacteria 6931
218 Ga0500627_0005630 3300053158 Bacteria 4178
219 Ga0500645_005457 3300053730 Bacteria 4676
220 Ga0500645_017875 3300053730 Bacteria 2219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009986 Ga0105033_102984 Ga0105033_1029841 381
2 3300031824 Ga0307413_10056387 Ga0307413_100563872 444
3 3300031901 Ga0307406_10004383 Ga0307406_100043832 444
4 3300031903 Ga0307407_10016276 Ga0307407_100162762 444
5 3300031995 Ga0307409_100063570 Ga0307409_1000635702 444
6 3300032004 Ga0307414_10078890 Ga0307414_100788901 444
7 3300049651 Ga0501201_002670 Ga0501201_002670_104_1576 461
8 3300049658 Ga0501211_003400 Ga0501211_003400_41_1513 461
9 3300049669 Ga0501235_019279 Ga0501235_019279_10_1482 461
10 3300049706 Ga0501229_001714 Ga0501229_001714_48_1520 461
11 3300046660 Ga0495625_0046255 Ga0495625_0046255_20_1411 462
12 3300049669 Ga0501235_001379 Ga0501235_001379_3106_4578 462
13 3300049679 Ga0501249_001928 Ga0501249_001928_63_1535 462
14 3300049706 Ga0501229_000028 Ga0501229_000028_5731_7203 462
15 3300031852 Ga0307410_10154180 Ga0307410_101541801 464
16 3300032005 Ga0307411_10068136 Ga0307411_100681362 464
17 3300032126 Ga0307415_100064583 Ga0307415_1000645832 464
18 3300035242 Ga0373962_0019149 Ga0373962_0019149_66_1487 471
19 3300037471 Ga0395905_0006465 Ga0395905_0006465_7762_9234 473
20 3300044712 Ga0453684_0088776 Ga0453684_0088776_66_1550 473
21 3300049668 Ga0501233_001741 Ga0501233_001741_852_2336 473
22 3300049669 Ga0501235_007686 Ga0501235_007686_746_2230 473
23 3300049706 Ga0501229_000275 Ga0501229_000275_4003_5487 473
24 3300049764 Ga0501267_000036 Ga0501267_000036_4009_5481 473
25 3300046460 Ga0495638_0043527 Ga0495638_0043527_449_1933 475
26 3300046513 Ga0495616_0009543 Ga0495616_0009543_871_2355 475
27 3300049762 Ga0501265_004005 Ga0501265_004005_101_1603 476
28 3300037471 Ga0395905_0002289 Ga0395905_0002289_15280_16752 479
29 iso_pu_bacteria 2990059506 2990062557 480
30 3300005366 Ga0070659_100186691 Ga0070659_1001866911 481
31 3300044712 Ga0453684_0049667 Ga0453684_0049667_2888_4363 482
32 3300031251 Ga0265327_10009961 Ga0265327_100099613 483
33 3300039450 Ga0436363_0411453 Ga0436363_0411453_228_1748 483
34 iso_pu_bacteria 2643221544 2643746768 484
35 iso_pu_bacteria 2643221646 2644260500 484
36 3300032005 Ga0307411_10038056 Ga0307411_100380562 485
37 3300003316 rootH1_10001762 rootH1_100017627 486
38 3300003322 rootL2_10028753 rootL2_100287532 486
39 3300003322 rootL2_10035907 rootL2_100359077 486
40 3300003322 rootL2_10088908 rootL2_100889082 486
41 3300028794 Ga0307515_10081592 Ga0307515_100815922 486
42 3300031548 Ga0307408_100000087 Ga0307408_10000008738 486
43 3300032005 Ga0307411_10000047 Ga0307411_1000004710 486
44 3300044656 Ga0466969_0000006 Ga0466969_0000006_40937_42409 486
45 3300044712 Ga0453684_0088776 Ga0453684_0088776_1547_3019 486
46 3300045051 Ga0451576_0022117 Ga0451576_0022117_1779_3251 486
47 3300049658 Ga0501211_000752 Ga0501211_000752_18_1490 486
48 3300049669 Ga0501235_001996 Ga0501235_001996_1647_3119 486
49 3300049706 Ga0501229_000022 Ga0501229_000022_8922_10394 486
50 iso_pu_bacteria 8025413630 8025417882 486
51 3300025304 Ga0209257_1016233 Ga0209257_10162332 487
52 3300042005 Ga0439448_0000590 Ga0439448_0000590_5283_6758 487
53 3300042008 Ga0439450_002798 Ga0439450_002798_1259_2734 487
54 3300042012 Ga0439455_0000206 Ga0439455_0000206_2510_3985 487
55 3300044706 Ga0466964_0000040 Ga0466964_0000040_9250_10725 487
56 3300044712 Ga0453684_0049667 Ga0453684_0049667_1389_2864 487
57 3300045976 Ga0466967_0007328 Ga0466967_0007328_4563_6038 487
58 3300045976 Ga0466967_0105108 Ga0466967_0105108_15_1529 487
59 3300047443 Ga0495687_002038 Ga0495687_002038_2062_3582 487
60 iso_pu_bacteria 2643221585 2643935809 487
61 iso_pu_bacteria 2643221656 2644317592 487
62 3300036647 Ga0316582_0016954 Ga0316582_0016954_1298_2767 488
63 3300002705 JGI25156J39149_1012910 JGI25156J39149_10129101 489
64 3300003761 Ga0055535_1000121 Ga0055535_100012155 489
65 3300003763 Ga0055529_1000223 Ga0055529_10002233 489
66 3300025242 Ga0209258_100163 Ga0209258_10016366 489
67 3300025254 Ga0209148_1004654 Ga0209148_10046541 489
68 3300025256 Ga0209759_1001069 Ga0209759_10010699 489
69 3300025272 Ga0209455_1000059 Ga0209455_1000059227 489
70 3300037471 Ga0395905_0006465 Ga0395905_0006465_6281_7765 489
71 3300044683 Ga0466965_0032446 Ga0466965_0032446_779_2275 489
72 3300045051 Ga0451576_0022117 Ga0451576_0022117_3248_4732 489
73 3300049585 Ga0501069_0051811 Ga0501069_0051811_463_1980 489
74 3300049586 Ga0501070_0020978 Ga0501070_0020978_3541_5058 489
75 3300025914 Ga0207671_10094777 Ga0207671_100947772 490
76 3300031730 Ga0307516_10018957 Ga0307516_100189572 490
77 3300035088 Ga0373940_0005523 Ga0373940_0005523_962_2449 490
78 3300035114 Ga0373939_0000187 Ga0373939_0000187_8826_10313 490
79 3300035691 Ga0373931_0000096 Ga0373931_0000096_30263_31750 490
80 3300037471 Ga0395905_0003500 Ga0395905_0003500_7091_8581 490
81 3300044694 Ga0466963_0010488 Ga0466963_0010488_966_2519 490
82 3300046519 Ga0495632_0035183 Ga0495632_0035183_988_2475 490
83 3300025949 Ga0207667_10060257 Ga0207667_100602572 492
84 3300005539 Ga0068853_100027738 Ga0068853_1000277383 493
85 3300005614 Ga0068856_100097074 Ga0068856_1000970742 493
86 3300005841 Ga0068863_100001437 Ga0068863_1000014379 493
87 3300005843 Ga0068860_100005179 Ga0068860_1000051797 493
88 3300009093 Ga0105240_10315548 Ga0105240_103155481 493
89 3300009545 Ga0105237_10007549 Ga0105237_100075492 493
90 3300013306 Ga0163162_10119960 Ga0163162_101199602 493
91 3300026078 Ga0207702_10030219 Ga0207702_100302192 493
92 3300026088 Ga0207641_10000210 Ga0207641_1000021016 493
93 3300028381 Ga0268264_10000408 Ga0268264_1000040830 493
94 3300031456 Ga0307513_10058844 Ga0307513_100588442 493
95 iso_pu_bacteria 2582581280 2585153176 493
96 iso_pu_bacteria 2582581293 2585199143 493
97 iso_pu_bacteria 2643221545 2643747726 493
98 iso_pu_bacteria 2643221691 2644510456 493
99 3300041512 Ga0451853_0178522 Ga0451853_0178522_937_2427 494
100 3300003323 rootH1_10021415 rootH1_100214157 495
101 3300046810 Ga0495660_0005780 Ga0495660_0005780_3596_5092 495
102 3300003773 Ga0055537_1002490 Ga0055537_10024902 496
103 3300003790 Ga0055528_1008134 Ga0055528_10081342 496
104 3300025263 Ga0209565_1000281 Ga0209565_10002812 496
105 3300025273 Ga0209673_1004175 Ga0209673_10041754 496
106 3300025297 Ga0209758_1001190 Ga0209758_100119013 496
107 3300025297 Ga0209758_1006117 Ga0209758_10061172 496
108 3300025299 Ga0209256_1019885 Ga0209256_10198852 496
109 3300035398 Ga0316574_0016186 Ga0316574_0016186_2514_4013 496
110 3300042436 Ga0439435_0012648 Ga0439435_0012648_197_1696 496
111 3300046460 Ga0495638_0005318 Ga0495638_0005318_2259_3758 496
112 3300046471 Ga0495650_0000017 Ga0495650_0000017_58237_59736 496
113 3300046507 Ga0495606_0004803 Ga0495606_0004803_6541_8040 496
114 3300046512 Ga0495610_0000343 Ga0495610_0000343_18929_20428 496
115 3300046513 Ga0495616_0022392 Ga0495616_0022392_1847_3346 496
116 3300046520 Ga0495637_0005235 Ga0495637_0005235_19_1518 496
117 3300046530 Ga0495654_0000126 Ga0495654_0000126_25476_26975 496
118 3300046660 Ga0495625_0003153 Ga0495625_0003153_1730_3229 496
119 3300046660 Ga0495625_0006347 Ga0495625_0006347_6835_8334 496
120 3300046694 Ga0495649_0007059 Ga0495649_0007059_5249_6751 496
121 3300046810 Ga0495660_0000213 Ga0495660_0000213_41313_42818 496
122 3300047320 Ga0495672_0000647 Ga0495672_0000647_14565_16064 496
123 3300048918 Ga0496115_0017002 Ga0496115_0017002_1727_3226 496
124 3300049570 Ga0501033_0114171 Ga0501033_0114171_141_1646 496
125 3300053102 Ga0500554_005872 Ga0500554_005872_621_2120 496
126 3300053104 Ga0500556_0000357 Ga0500556_0000357_16511_18010 496
127 3300053134 Ga0500658_0009025 Ga0500658_0009025_1515_3014 496
128 3300053153 Ga0500616_0007476 Ga0500616_0007476_4599_6098 496
129 3300053158 Ga0500627_0005630 Ga0500627_0005630_2154_3653 496
130 3300053730 Ga0500645_005457 Ga0500645_005457_2382_3881 496
131 3300053730 Ga0500645_017875 Ga0500645_017875_114_1613 496
132 iso_pu_bacteria 2919688452 2919691318 496
133 3300005262 Ga0065165_1001232 Ga0065165_100123223 497
134 3300025273 Ga0209673_1010361 Ga0209673_10103613 497
135 3300025295 Ga0209564_1004092 Ga0209564_10040922 497
136 3300031728 Ga0316578_10028048 Ga0316578_100280482 497
137 3300046460 Ga0495638_0039323 Ga0495638_0039323_436_1938 497
138 3300046660 Ga0495625_0000139 Ga0495625_0000139_20924_22426 497
139 3300053125 Ga0500618_000060 Ga0500618_000060_51061_52569 497
140 iso_pu_bacteria 2643221544 2643746601 497
141 iso_pu_bacteria 2643221562 2643831354 497
142 3300003759 Ga0055525_1000046 Ga0055525_100004681 498
143 3300025230 Ga0209563_100005 Ga0209563_100005819 498
144 3300002774 JGI25150J39212_1000582 JGI25150J39212_10005824 499
145 3300003215 JGI25153J46596_10000260 JGI25153J46596_100002607 499
146 3300003771 Ga0055526_1001427 Ga0055526_10014275 499
147 3300003775 Ga0055524_1000129 Ga0055524_100012943 499
148 3300003792 Ga0055540_1010104 Ga0055540_10101042 499
149 3300005262 Ga0065165_1009535 Ga0065165_10095352 499
150 3300005364 Ga0070673_100019830 Ga0070673_1000198303 499
151 3300006948 Ga0099826_10000001 Ga0099826_10000001270 499
152 3300025245 Ga0207425_1000072 Ga0207425_10000728 499
153 3300025258 Ga0209129_1002536 Ga0209129_10025363 499
154 3300025263 Ga0209565_1000132 Ga0209565_100013261 499
155 3300025292 Ga0209676_1030942 Ga0209676_10309422 499
156 3300025294 Ga0209025_1000721 Ga0209025_100072131 499
157 3300025295 Ga0209564_1000502 Ga0209564_100050231 499
158 3300025297 Ga0209758_1000009 Ga0209758_1000009644 499
159 3300025298 Ga0209050_1000005 Ga0209050_1000005525 499
160 3300025298 Ga0209050_1004719 Ga0209050_10047194 499
161 3300025299 Ga0209256_1000285 Ga0209256_100028543 499
162 3300025303 Ga0209051_1000377 Ga0209051_100037754 499
163 3300025304 Ga0209257_1002030 Ga0209257_10020307 499
164 3300025304 Ga0209257_1002036 Ga0209257_10020367 499
165 3300025960 Ga0207651_10015889 Ga0207651_100158892 499
166 3300027666 Ga0209282_1000001 Ga0209282_10000011408 499
167 3300046660 Ga0495625_0000064 Ga0495625_0000064_121997_123532 499
168 3300046665 Ga0495661_0001023 Ga0495661_0001023_2313_3821 499
169 3300047445 Ga0495677_0000202 Ga0495677_0000202_6623_8131 499
170 3300048091 Ga0495626_0005589 Ga0495626_0005589_3061_4569 499
171 3300048903 Ga0496100_0006476 Ga0496100_0006476_923_2431 499
172 3300048905 Ga0496102_0030170 Ga0496102_0030170_1024_2538 499
173 3300049658 Ga0501211_000261 Ga0501211_000261_78_1592 499
174 3300013105 Ga0157369_10000835 Ga0157369_1000083520 500
175 3300031548 Ga0307408_100000029 Ga0307408_100000029197 500
176 3300032002 Ga0307416_100158386 Ga0307416_1001583862 500
177 3300044842 Ga0466957_0009789 Ga0466957_0009789_890_2410 500
178 3300002705 JGI25156J39149_1000974 JGI25156J39149_10009744 501
179 3300002738 JGI25154J39366_1000548 JGI25154J39366_10005486 501
180 3300002741 JGI25157J39369_1000049 JGI25157J39369_100004985 501
181 3300003752 Ga0055539_1000696 Ga0055539_10006964 501
182 3300005339 Ga0070660_100107776 Ga0070660_1001077762 501
183 3300005539 Ga0068853_100113617 Ga0068853_1001136172 501
184 3300005577 Ga0068857_100004451 Ga0068857_1000044513 501
185 3300005578 Ga0068854_100001635 Ga0068854_1000016352 501
186 3300005614 Ga0068856_100000458 Ga0068856_10000045821 501
187 3300005937 Ga0081455_10010161 Ga0081455_100101615 501
188 3300009093 Ga0105240_10021972 Ga0105240_100219725 501
189 3300009174 Ga0105241_10016919 Ga0105241_100169193 501
190 3300010375 Ga0105239_10024844 Ga0105239_100248443 501
191 3300021361 Ga0213872_10000002 Ga0213872_10000002311 501
192 3300021361 Ga0213872_10055524 Ga0213872_100555242 501
193 3300025246 Ga0209646_1000138 Ga0209646_100013823 501
194 3300025250 Ga0209026_1000021 Ga0209026_1000021182 501
195 3300025253 Ga0209677_100484 Ga0209677_1004844 501
196 3300025256 Ga0209759_1000025 Ga0209759_1000025182 501
197 3300025911 Ga0207654_10055543 Ga0207654_100555432 501
198 3300025913 Ga0207695_10013031 Ga0207695_100130315 501
199 3300025919 Ga0207657_10114612 Ga0207657_101146122 501
200 3300025981 Ga0207640_10002868 Ga0207640_100028686 501
201 3300026078 Ga0207702_10000227 Ga0207702_1000022721 501
202 3300026116 Ga0207674_10007836 Ga0207674_100078363 501
203 3300031456 Ga0307513_10102102 Ga0307513_101021022 501
204 3300031711 Ga0265314_10054864 Ga0265314_100548643 501
205 3300031731 Ga0307405_10040614 Ga0307405_100406142 501
206 3300031824 Ga0307413_10010694 Ga0307413_100106942 501
207 3300032005 Ga0307411_10016840 Ga0307411_100168402 501
208 3300039447 Ga0436361_0061503 Ga0436361_0061503_3237_4754 501
209 3300042000 Ga0439437_000478 Ga0439437_000478_707_2227 501
210 3300046460 Ga0495638_0001888 Ga0495638_0001888_15144_16679 501
211 3300046471 Ga0495650_0000169 Ga0495650_0000169_81701_83218 501
212 3300046507 Ga0495606_0000972 Ga0495606_0000972_34252_35769 501
213 3300046557 Ga0495622_0000003 Ga0495622_0000003_49082_50599 501
214 3300046691 Ga0495670_0000024 Ga0495670_0000024_31651_33171 501
215 3300048912 Ga0496109_0005999 Ga0496109_0005999_4810_6336 501
216 3300048916 Ga0496113_0021320 Ga0496113_0021320_115_1641 501
217 3300048925 Ga0496122_0001613 Ga0496122_0001613_11191_12717 501
218 3300048926 Ga0496123_0000198 Ga0496123_0000198_60091_61617 501
219 3300048928 Ga0496125_0000605 Ga0496125_0000605_22647_24173 501
220 3300053134 Ga0500658_0003967 Ga0500658_0003967_177_1712 501
221 3300009148 Ga0105243_10083503 Ga0105243_100835032 502
222 3300013307 Ga0157372_10256604 Ga0157372_102566042 502
223 3300046460 Ga0495638_0001741 Ga0495638_0001741_14927_16465 502
224 3300046520 Ga0495637_0002849 Ga0495637_0002849_2085_3620 502
225 3300047320 Ga0495672_0000782 Ga0495672_0000782_3523_5157 502
226 3300048091 Ga0495626_0000020 Ga0495626_0000020_188307_189833 502
227 3300050512 nmdc:mga0n895_300898_c1 nmdc:mga0n895_300898_c1_27_1541 502
228 3300053104 Ga0500556_0000415 Ga0500556_0000415_16190_17725 502
229 3300037312 Ga0395899_0139668 Ga0395899_0139668_25_1563 503
230 3300037418 Ga0395900_0236970 Ga0395900_0236970_95_1633 503
231 3300037471 Ga0395905_0187785 Ga0395905_0187785_167_1705 503
232 3300044684 Ga0466966_0085347 Ga0466966_0085347_203_1717 503
233 3300045049 Ga0466959_0043670 Ga0466959_0043670_206_1720 503
234 3300048905 Ga0496102_0000159 Ga0496102_0000159_38144_39676 503
235 3300021361 Ga0213872_10001334 Ga0213872_100013343 504
236 3300001989 JGI24739J22299_10007265 JGI24739J22299_100072652 505
237 3300025250 Ga0209026_1004801 Ga0209026_10048013 505

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04820

Trp_halogenase

Tryptophan halogenase

3

154

0.97

PF04820

Trp_halogenase

Tryptophan halogenase

150

439

0.97

PF04820

Trp_halogenase

Tryptophan halogenase

434

542

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y1w-assembly1.cif.gz_B xcc4156, a flavin-dependent halogenase from xanthomonas campestris 0.9689 7 504
6frl-assembly1.cif.gz_A brvh, a flavin-dependent halogenase from brevundimonas sp. bal3 0.9642 7 494
6y1w-assembly1.cif.gz_B xcc4156, a flavin-dependent halogenase from xanthomonas campestris 0.9631 7 504
6frl-assembly1.cif.gz_B brvh, a flavin-dependent halogenase from brevundimonas sp. bal3 0.9584 5 499
6frl-assembly1.cif.gz_B brvh, a flavin-dependent halogenase from brevundimonas sp. bal3 0.9546 5 499
ID Description Score Start End Superfamily
6frlA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9642 7 494 3.50.50.60
6frlA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9507 7 494 3.50.50.60
2wetA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9315 6 497 3.50.50.60
2wetA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9225 6 497 3.50.50.60
2jkcA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9215 7 497 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A431J5E0-F1-model_v4 deleted 0.9849 2 267
AF-A0A7X5N4A5-F1-model_v4 Tryptophan 7-halogenase 0.9838 172 291 GO:0004497
AF-A0A259J7G2-F1-model_v4 deleted 0.9837 22 396
AF-A0A520EHI4-F1-model_v4 deleted 0.9836 40 378
AF-A0A1Y6HCN7-F1-model_v4 Tryptophan halogenase 0.9832 72 426 GO:0004497

Feature Viewer

pLDDT pTM Quality
93.52 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map