F349350

General Info

Members Datasets Scaffolds Average Seq Length
236 169 225 126

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0650294|Ga0495638_0650294_33_476
Length 147
Sequence MAQLALACSPPIVRLLESGGRAEVTVDRDVFQFIREHVRSVWALELLLRLKHDPERCWSVEELVGDLRASHSLVTDNLTAFEDAGLVVADDRGCFRYQPAAAVLAKVCDDLDATYRTKPVTVIRWISAPTERLQSLADAFKFKGKDR

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
3 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
4 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
5 2643221584 Caulobacter sp. Root656 Isolate Unclassified
6 2643221640 Caulobacter sp. Root342 Isolate Unclassified
7 2643221642 Caulobacter sp. Root343 Isolate Unclassified
8 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
9 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
10 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
11 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
150 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
151 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
152 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
153 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
156 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
161 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
162 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
168 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
169 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.24
Nodule 0.42
Rhizoplane 1.69
Rhizosphere 57.2
Stem 0
Stem Tuber 0
Unclassified 11.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10024977 3300003316 Bacteria 1346
2 rootH1_10024977 3300003323 Bacteria 25411
3 rootH1_10074625 3300003316 Bacteria 3360
4 rootL2_10028023 3300003322 Bacteria 4490
5 rootH1_10385764 3300003323 Unclassified 1659
6 Ga0055537_1001013 3300003773 Bacteria 12743
7 Ga0055524_1016869 3300003775 Bacteria 2597
8 Ga0055524_1016917 3300003775 Bacteria 2591
9 Ga0055536_1011129 3300003781 Bacteria 3492
10 Ga0055536_1011160 3300003781 Bacteria 3483
11 Ga0055530_10010242 3300003791 Bacteria 3492
12 Ga0055530_10010269 3300003791 Bacteria 3483
13 Ga0055531_10000383 3300003794 Bacteria 42716
14 Ga0070670_100011791 3300005331 Bacteria 7474
15 Ga0070666_10638210 3300005335 Bacteria 779
16 Ga0070680_100525819 3300005336 Bacteria 1013
17 Ga0070689_101007712 3300005340 Bacteria 741
18 Ga0070668_100005398 3300005347 Bacteria 9487
19 Ga0070668_100015835 3300005347 Bacteria 5640
20 Ga0070671_100024434 3300005355 Bacteria 4946
21 Ga0070667_100058350 3300005367 Bacteria 3263
22 Ga0070681_10666931 3300005458 Bacteria 955
23 Ga0070681_10974559 3300005458 Unclassified 767
24 Ga0070679_100609371 3300005530 Unclassified 1035
25 Ga0070686_100646372 3300005544 Bacteria 838
26 Ga0068854_100316408 3300005578 Bacteria 1267
27 Ga0068852_100789884 3300005616 Unclassified 963
28 Ga0068859_100002330 3300005617 Bacteria 19304
29 Ga0068859_100890470 3300005617 Unclassified 975
30 Ga0068863_100001255 3300005841 Bacteria 25283
31 Ga0068858_100008334 3300005842 Bacteria 9973
32 Ga0068860_100064286 3300005843 Bacteria 3485
33 Ga0068862_100136319 3300005844 Bacteria 2175
34 Ga0075368_10004757 3300006042 Bacteria 4623
35 Ga0075364_10004100 3300006051 Bacteria 8361
36 Ga0075367_10001867 3300006178 Bacteria 9309
37 Ga0075369_10057501 3300006186 Bacteria 1692
38 Ga0075369_10126814 3300006186 Bacteria 1158
39 Ga0075366_10032212 3300006195 Bacteria 3086
40 Ga0075366_10089097 3300006195 Bacteria 1848
41 Ga0075366_10105060 3300006195 Bacteria 1697
42 Ga0075370_10062712 3300006353 Bacteria 2118
43 Ga0075370_10075165 3300006353 Bacteria 1937
44 Ga0075370_10194774 3300006353 Bacteria 1195
45 Ga0075370_10387546 3300006353 Bacteria 837
46 Ga0097620_100002330 3300006931 Bacteria 19304
47 Ga0097620_100890417 3300006931 Unclassified 975
48 Ga0079104_1048787 3300006946 Bacteria 952
49 Ga0105248_10275375 3300009177 Bacteria 1895
50 Ga0105248_10575320 3300009177 Bacteria 1271
51 Ga0105238_10286464 3300009551 Bacteria 1629
52 Ga0157369_12382350 3300013105 Bacteria 536
53 Ga0163163_10000523 3300014325 Bacteria 34253
54 Ga0157379_10014439 3300014968 Bacteria 6930
55 Ga0213876_10750827 3300021384 Bacteria 519
56 Ga0209148_1007605 3300025254 Bacteria 2237
57 Ga0209565_1000208 3300025263 Bacteria 68570
58 Ga0209673_1001424 3300025273 Bacteria 22942
59 Ga0209675_1008761 3300025291 Bacteria 3666
60 Ga0209676_1000215 3300025292 Bacteria 127311
61 Ga0209676_1000237 3300025292 Bacteria 117742
62 Ga0209564_1014190 3300025295 Bacteria 3331
63 Ga0209758_1004408 3300025297 Bacteria 11737
64 Ga0209050_1001326 3300025298 Bacteria 27570
65 Ga0209050_1001451 3300025298 Bacteria 25450
66 Ga0209256_1001191 3300025299 Bacteria 29124
67 Ga0209256_1009752 3300025299 Bacteria 4146
68 Ga0209256_1015577 3300025299 Bacteria 2647
69 Ga0209051_1004482 3300025303 Bacteria 8586
70 Ga0209257_1000313 3300025304 Bacteria 102682
71 Ga0209257_1010908 3300025304 Bacteria 4489
72 Ga0207680_10079559 3300025903 Bacteria 2056
73 Ga0207707_10121032 3300025912 Bacteria 2288
74 Ga0207707_10589459 3300025912 Bacteria 942
75 Ga0207694_10227060 3300025924 Bacteria 1524
76 Ga0207650_10007621 3300025925 Bacteria 7375
77 Ga0207644_10001318 3300025931 Bacteria 15943
78 Ga0207670_11016221 3300025936 Bacteria 698
79 Ga0207711_10021225 3300025941 Bacteria 5424
80 Ga0207668_10005454 3300025972 Bacteria 7491
81 Ga0207668_10016314 3300025972 Bacteria 4633
82 Ga0207640_10301372 3300025981 Bacteria 1268
83 Ga0207658_10090522 3300025986 Bacteria 2371
84 Ga0207703_10001817 3300026035 Bacteria 19028
85 Ga0207639_10050223 3300026041 Bacteria 3167
86 Ga0207639_11978392 3300026041 Unclassified 544
87 Ga0207641_10006146 3300026088 Bacteria 10158
88 Ga0207698_10624213 3300026142 Unclassified 1065
89 Ga0209813_10001991 3300027866 Bacteria 4623
90 Ga0268266_10074879 3300028379 Bacteria 2940
91 Ga0268265_10033455 3300028380 Bacteria 3738
92 Ga0268264_10097823 3300028381 Bacteria 2544
93 Ga0265332_10260482 3300031238 Bacteria 717
94 Ga0307413_10159132 3300031824 Bacteria 1584
95 Ga0307407_10100405 3300031903 Unclassified 1795
96 Ga0307412_10979029 3300031911 Bacteria 746
97 Ga0307409_100754028 3300031995 Bacteria 977
98 Ga0307416_101062205 3300032002 Bacteria 914
99 Ga0307414_10630289 3300032004 Bacteria 965
100 Ga0307411_10137046 3300032005 Bacteria 1799
101 Ga0307415_101116050 3300032126 Unclassified 739
102 Ga0395899_0000004 3300037312 Bacteria 874267
103 Ga0395899_0000223 3300037312 Bacteria 77606
104 Ga0395899_0238139 3300037312 Bacteria 1253
105 Ga0395900_0000008 3300037418 Bacteria 480459
106 Ga0395900_0573773 3300037418 Bacteria 1070
107 Ga0395898_0001908 3300037466 Bacteria 26558
108 Ga0395898_0165002 3300037466 Bacteria 2118
109 Ga0395905_0003700 3300037471 Bacteria 16191
110 Ga0395901_0000008 3300038443 Bacteria 495962
111 Ga0395901_0514020 3300038443 Bacteria 1217
112 Ga0436365_0562450 3300039437 Bacteria 556
113 Ga0436365_1309689 3300039437 Bacteria 1717
114 Ga0439461_0075682 3300041410 Bacteria 787
115 Ga0439461_0138116 3300041410 Bacteria 621
116 Ga0451853_3792778 3300041512 Bacteria 809
117 Ga0439445_0074293 3300042004 Bacteria 944
118 Ga0439446_0003421 3300042156 Bacteria 3939
119 Ga0439435_0040938 3300042436 Bacteria 1296
120 Ga0466965_0119668 3300044683 Bacteria 1359
121 Ga0466966_0504590 3300044684 Unclassified 728
122 Ga0466961_0319497 3300044693 Bacteria 947
123 Ga0466970_0362095 3300044765 Unclassified 824
124 Ga0466960_0405256 3300044901 Bacteria 786
125 Ga0466959_0008097 3300045049 Bacteria 7413
126 Ga0466967_0631375 3300045976 Bacteria 1058
127 Ga0495638_0000908 3300046460 Bacteria 30254
128 Ga0495638_0011370 3300046460 Bacteria 6134
129 Ga0495638_0194365 3300046460 Bacteria 1149
130 Ga0495638_0650294 3300046460 Bacteria 512
131 Ga0495650_0000030 3300046471 Bacteria 436318
132 Ga0495583_0000002 3300046506 Bacteria 782521
133 Ga0495583_0442607 3300046506 Bacteria 509
134 Ga0495606_0002012 3300046507 Bacteria 24965
135 Ga0495610_0000046 3300046512 Bacteria 153789
136 Ga0495616_0000084 3300046513 Bacteria 79811
137 Ga0495616_0026371 3300046513 Bacteria 3094
138 Ga0495632_0008352 3300046519 Bacteria 6366
139 Ga0495632_0194168 3300046519 Bacteria 926
140 Ga0495637_0012633 3300046520 Bacteria 4032
141 Ga0495643_0038548 3300046522 Bacteria 2617
142 Ga0495648_0000176 3300046524 Bacteria 73832
143 Ga0495648_0079929 3300046524 Bacteria 1864
144 Ga0495663_0023096 3300046525 Bacteria 1800
145 Ga0495654_0000065 3300046530 Bacteria 126355
146 Ga0495597_0032660 3300046542 Bacteria 2361
147 Ga0495668_0012264 3300046616 Bacteria 5087
148 Ga0495668_0051759 3300046616 Bacteria 2273
149 Ga0495668_0084138 3300046616 Bacteria 1744
150 Ga0495668_0168572 3300046616 Bacteria 1199
151 Ga0495625_0002981 3300046660 Bacteria 17557
152 Ga0495625_0292105 3300046660 Bacteria 1045
153 Ga0495625_0335344 3300046660 Bacteria 959
154 Ga0495625_0628644 3300046660 Bacteria 641
155 Ga0495670_0084701 3300046691 Bacteria 1618
156 Ga0495671_0456666 3300046692 Bacteria 610
157 Ga0495660_0026325 3300046810 Bacteria 3298
158 Ga0495660_0050217 3300046810 Bacteria 2273
159 Ga0495660_0196347 3300046810 Bacteria 966
160 Ga0495672_0147038 3300047320 Bacteria 1225
161 Ga0495683_0124072 3300047323 Bacteria 1223
162 Ga0495679_002490 3300047446 Bacteria 9346
163 Ga0495673_0000593 3300047469 Bacteria 36285
164 Ga0495673_0001487 3300047469 Bacteria 18540
165 Ga0495681_0032305 3300047470 Bacteria 2637
166 Ga0495681_0165522 3300047470 Bacteria 918
167 Ga0495686_0016890 3300047472 Bacteria 4933
168 Ga0495686_0145353 3300047472 Bacteria 1396
169 Ga0495686_0484156 3300047472 Bacteria 653
170 Ga0496101_0201496 3300048904 Bacteria 1539
171 Ga0496107_0000217 3300048910 Bacteria 30178
172 Ga0496115_0002036 3300048918 Bacteria 14467
173 Ga0496115_0760454 3300048918 Bacteria 757
174 Ga0496121_0002188 3300048924 Bacteria 30587
175 Ga0496121_0313175 3300048924 Bacteria 1060
176 Ga0496121_0726552 3300048924 Unclassified 594
177 Ga0496122_0084187 3300048925 Bacteria 2201
178 Ga0496124_0043804 3300048927 Bacteria 3844
179 Ga0496124_0396556 3300048927 Bacteria 959
180 Ga0496124_0561747 3300048927 Bacteria 751
181 Ga0496125_0068965 3300048928 Bacteria 2777
182 Ga0496126_0016053 3300048929 Bacteria 7509
183 Ga0496126_0214121 3300048929 Bacteria 1621
184 Ga0495678_108263 3300049459 Bacteria 952
185 Ga0501034_0239845 3300049571 Bacteria 1759
186 Ga0501047_0005754 3300049581 Bacteria 11671
187 Ga0501047_0127790 3300049581 Bacteria 2422
188 Ga0501047_1297510 3300049581 Bacteria 542
189 Ga0501048_0124566 3300049582 Bacteria 1822
190 Ga0501048_0385179 3300049582 Bacteria 1001
191 Ga0501071_0414647 3300049587 Bacteria 1029
192 Ga0501238_003956 3300049671 Bacteria 1836
193 Ga0501083_0052567 3300049744 Bacteria 2737
194 nmdc:mga00v17_3294_c1 3300050491 Bacteria 8327
195 nmdc:mga0k408_101655_c1 3300050493 Unclassified 1695
196 nmdc:mga0k408_33350_c1 3300050493 Bacteria 2945
197 nmdc:mga0k408_38023_c1 3300050493 Bacteria 2763
198 nmdc:mga06z11_5238_c1 3300050494 Bacteria 5186
199 nmdc:mga04h51_19085_c1 3300050495 Bacteria 2029
200 nmdc:mga07m45_10199_c1 3300050496 Bacteria 4899
201 nmdc:mga07m45_163180_c1 3300050496 Bacteria 1294
202 nmdc:mga07m45_62296_c1 3300050496 Bacteria 2114
203 nmdc:mga07m45_85189_c2 3300050496 Bacteria 1230
204 nmdc:mga0sz30_28261_c1 3300050516 Bacteria 2307
205 nmdc:mga0sz30_34098_c1 3300050516 Bacteria 2118
206 Ga0500578_0150824 3300053086 Bacteria 1448
207 Ga0500643_084851 3300053087 Bacteria 867
208 Ga0500644_0000010 3300053088 Bacteria 127225
209 Ga0500554_030250 3300053102 Bacteria 1590
210 Ga0500556_0000967 3300053104 Bacteria 15354
211 Ga0500608_000248 3300053122 Bacteria 21224
212 Ga0500608_214520 3300053122 Bacteria 783
213 Ga0500614_004901 3300053123 Bacteria 2815
214 Ga0500618_000234 3300053125 Bacteria 43695
215 Ga0500658_0012524 3300053134 Bacteria 3129
216 Ga0500559_0004438 3300053136 Bacteria 6665
217 Ga0500564_006955 3300053138 Bacteria 4765
218 Ga0500616_0009187 3300053153 Bacteria 6034
219 Ga0500622_0042227 3300053156 Bacteria 2370
220 Ga0500622_0118206 3300053156 Bacteria 1288
221 Ga0500627_0045905 3300053158 Bacteria 1892
222 Ga0500645_000774 3300053730 Bacteria 19376
223 Ga0500645_190586 3300053730 Bacteria 555
224 Ga0500609_003855 3300053731 Bacteria 2091
225 Ga0500596_023318 3300053735 Bacteria 938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0000004 Ga0395899_0000004_755105_755479 100
2 3300050496 nmdc:mga07m45_62296_c1 nmdc:mga07m45_62296_c1_14_325 103
3 3300031824 Ga0307413_10159132 Ga0307413_101591322 113
4 3300031903 Ga0307407_10100405 Ga0307407_101004055 113
5 3300031995 Ga0307409_100754028 Ga0307409_1007540282 113
6 3300032004 Ga0307414_10630289 Ga0307414_106302891 113
7 3300032005 Ga0307411_10137046 Ga0307411_101370463 113
8 3300005530 Ga0070679_100609371 Ga0070679_1006093712 119
9 3300006186 Ga0075369_10057501 Ga0075369_100575012 119
10 3300045976 Ga0466967_0631375 Ga0466967_0631375_431_796 119
11 3300048918 Ga0496115_0760454 Ga0496115_0760454_203_619 119
12 3300048927 Ga0496124_0043804 Ga0496124_0043804_2760_3248 119
13 3300048929 Ga0496126_0214121 Ga0496126_0214121_292_780 119
14 3300050516 nmdc:mga0sz30_34098_c1 nmdc:mga0sz30_34098_c1_872_1360 119
15 iso_pu_bacteria 2511231221 2512035070 119
16 iso_pu_bacteria 2897803580 2897806376 119
17 iso_pu_bacteria 8054002106 8054009312 119
18 iso_pu_bacteria 2585428106 2587918557 120
19 iso_pu_bacteria 2643221545 2643749672 120
20 iso_pu_bacteria 2643221552 2643781612 120
21 iso_pu_bacteria 2643221584 2643928287 120
22 iso_pu_bacteria 2643221640 2644224878 120
23 iso_pu_bacteria 2643221642 2644234188 120
24 iso_pu_bacteria 2643221691 2644508629 120
25 iso_pu_bacteria 2857504554 2857505245 120
26 iso_pu_bacteria 2928531327 2928533308 120
27 3300003323 rootH1_10385764 rootH1_103857644 121
28 3300005331 Ga0070670_100011791 Ga0070670_10001179110 121
29 3300005335 Ga0070666_10638210 Ga0070666_106382101 121
30 3300005347 Ga0070668_100005398 Ga0070668_1000053986 121
31 3300005355 Ga0070671_100024434 Ga0070671_1000244341 121
32 3300005367 Ga0070667_100058350 Ga0070667_1000583504 121
33 3300005544 Ga0070686_100646372 Ga0070686_1006463721 121
34 3300005617 Ga0068859_100002330 Ga0068859_10000233019 121
35 3300005841 Ga0068863_100001255 Ga0068863_10000125514 121
36 3300005842 Ga0068858_100008334 Ga0068858_10000833411 121
37 3300005843 Ga0068860_100064286 Ga0068860_1000642864 121
38 3300006931 Ga0097620_100002330 Ga0097620_10000233019 121
39 3300009177 Ga0105248_10275375 Ga0105248_102753754 121
40 3300014325 Ga0163163_10000523 Ga0163163_1000052315 121
41 3300014968 Ga0157379_10014439 Ga0157379_100144396 121
42 3300025903 Ga0207680_10079559 Ga0207680_100795593 121
43 3300025925 Ga0207650_10007621 Ga0207650_1000762110 121
44 3300025931 Ga0207644_10001318 Ga0207644_100013183 121
45 3300025941 Ga0207711_10021225 Ga0207711_100212252 121
46 3300025972 Ga0207668_10005454 Ga0207668_100054547 121
47 3300025986 Ga0207658_10090522 Ga0207658_100905224 121
48 3300026035 Ga0207703_10001817 Ga0207703_1000181722 121
49 3300026041 Ga0207639_11978392 Ga0207639_119783921 121
50 3300026088 Ga0207641_10006146 Ga0207641_1000614611 121
51 3300028379 Ga0268266_10074879 Ga0268266_100748795 121
52 3300028381 Ga0268264_10097823 Ga0268264_100978233 121
53 3300031238 Ga0265332_10260482 Ga0265332_102604821 121
54 3300031911 Ga0307412_10979029 Ga0307412_109790291 121
55 3300041410 Ga0439461_0075682 Ga0439461_0075682_363_731 121
56 3300049587 Ga0501071_0414647 Ga0501071_0414647_550_918 121
57 3300032002 Ga0307416_101062205 Ga0307416_1010622053 122
58 3300032126 Ga0307415_101116050 Ga0307415_1011160502 122
59 3300044683 Ga0466965_0119668 Ga0466965_0119668_924_1295 122
60 3300044693 Ga0466961_0319497 Ga0466961_0319497_257_628 122
61 3300049571 Ga0501034_0239845 Ga0501034_0239845_1201_1572 122
62 3300049744 Ga0501083_0052567 Ga0501083_0052567_1547_1918 122
63 3300053735 Ga0500596_023318 Ga0500596_023318_14_382 122
64 3300005340 Ga0070689_101007712 Ga0070689_1010077121 123
65 3300005458 Ga0070681_10974559 Ga0070681_109745592 123
66 3300005578 Ga0068854_100316408 Ga0068854_1003164083 123
67 3300005617 Ga0068859_100890470 Ga0068859_1008904702 123
68 3300006042 Ga0075368_10004757 Ga0075368_100047575 123
69 3300006051 Ga0075364_10004100 Ga0075364_100041004 123
70 3300006178 Ga0075367_10001867 Ga0075367_1000186712 123
71 3300006186 Ga0075369_10126814 Ga0075369_101268142 123
72 3300006195 Ga0075366_10032212 Ga0075366_100322124 123
73 3300006195 Ga0075366_10089097 Ga0075366_100890972 123
74 3300006353 Ga0075370_10062712 Ga0075370_100627122 123
75 3300006353 Ga0075370_10387546 Ga0075370_103875462 123
76 3300006931 Ga0097620_100890417 Ga0097620_1008904173 123
77 3300006946 Ga0079104_1048787 Ga0079104_10487873 123
78 3300009177 Ga0105248_10575320 Ga0105248_105753202 123
79 3300009551 Ga0105238_10286464 Ga0105238_102864642 123
80 3300013105 Ga0157369_12382350 Ga0157369_123823502 123
81 3300025254 Ga0209148_1007605 Ga0209148_10076054 123
82 3300025912 Ga0207707_10121032 Ga0207707_101210325 123
83 3300025924 Ga0207694_10227060 Ga0207694_102270604 123
84 3300025936 Ga0207670_11016221 Ga0207670_110162211 123
85 3300025981 Ga0207640_10301372 Ga0207640_103013722 123
86 3300026041 Ga0207639_10050223 Ga0207639_100502232 123
87 3300027866 Ga0209813_10001991 Ga0209813_100019914 123
88 3300044765 Ga0466970_0362095 Ga0466970_0362095_275_649 123
89 3300044901 Ga0466960_0405256 Ga0466960_0405256_18_389 123
90 3300045049 Ga0466959_0008097 Ga0466959_0008097_4000_4374 123
91 3300048924 Ga0496121_0726552 Ga0496121_0726552_11_382 123
92 3300048925 Ga0496122_0084187 Ga0496122_0084187_1289_1663 123
93 3300049581 Ga0501047_0127790 Ga0501047_0127790_731_1102 123
94 3300049581 Ga0501047_1297510 Ga0501047_1297510_145_516 123
95 3300049582 Ga0501048_0124566 Ga0501048_0124566_1086_1457 123
96 3300050491 nmdc:mga00v17_3294_c1 nmdc:mga00v17_3294_c1_5173_5544 123
97 3300050493 nmdc:mga0k408_101655_c1 nmdc:mga0k408_101655_c1_785_1156 123
98 3300050493 nmdc:mga0k408_38023_c1 nmdc:mga0k408_38023_c1_1329_1700 123
99 3300050494 nmdc:mga06z11_5238_c1 nmdc:mga06z11_5238_c1_4043_4414 123
100 3300050495 nmdc:mga04h51_19085_c1 nmdc:mga04h51_19085_c1_680_1051 123
101 3300050496 nmdc:mga07m45_10199_c1 nmdc:mga07m45_10199_c1_1631_2002 123
102 3300050516 nmdc:mga0sz30_28261_c1 nmdc:mga0sz30_28261_c1_223_594 123
103 3300003316 rootH1_10024977 rootH1_100249772 124
104 3300003316 rootH1_10074625 rootH1_100746254 124
105 3300003322 rootL2_10028023 rootL2_100280235 124
106 3300003773 Ga0055537_1001013 Ga0055537_100101310 124
107 3300003775 Ga0055524_1016869 Ga0055524_10168694 124
108 3300003775 Ga0055524_1016917 Ga0055524_10169173 124
109 3300003781 Ga0055536_1011129 Ga0055536_10111294 124
110 3300003781 Ga0055536_1011160 Ga0055536_10111604 124
111 3300003791 Ga0055530_10010242 Ga0055530_100102424 124
112 3300003791 Ga0055530_10010269 Ga0055530_100102694 124
113 3300003794 Ga0055531_10000383 Ga0055531_100003834 124
114 3300005336 Ga0070680_100525819 Ga0070680_1005258192 124
115 3300005347 Ga0070668_100015835 Ga0070668_1000158354 124
116 3300005458 Ga0070681_10666931 Ga0070681_106669311 124
117 3300005616 Ga0068852_100789884 Ga0068852_1007898842 124
118 3300005844 Ga0068862_100136319 Ga0068862_1001363193 124
119 3300006195 Ga0075366_10105060 Ga0075366_101050601 124
120 3300006353 Ga0075370_10075165 Ga0075370_100751651 124
121 3300006353 Ga0075370_10194774 Ga0075370_101947743 124
122 3300021384 Ga0213876_10750827 Ga0213876_107508271 124
123 3300025263 Ga0209565_1000208 Ga0209565_100020837 124
124 3300025273 Ga0209673_1001424 Ga0209673_10014246 124
125 3300025291 Ga0209675_1008761 Ga0209675_10087614 124
126 3300025292 Ga0209676_1000215 Ga0209676_100021562 124
127 3300025292 Ga0209676_1000237 Ga0209676_100023755 124
128 3300025295 Ga0209564_1014190 Ga0209564_10141902 124
129 3300025297 Ga0209758_1004408 Ga0209758_10044082 124
130 3300025298 Ga0209050_1001326 Ga0209050_10013268 124
131 3300025298 Ga0209050_1001451 Ga0209050_10014518 124
132 3300025299 Ga0209256_1001191 Ga0209256_100119121 124
133 3300025299 Ga0209256_1009752 Ga0209256_10097525 124
134 3300025299 Ga0209256_1015577 Ga0209256_10155774 124
135 3300025303 Ga0209051_1004482 Ga0209051_100448213 124
136 3300025304 Ga0209257_1000313 Ga0209257_100031359 124
137 3300025304 Ga0209257_1010908 Ga0209257_10109085 124
138 3300025912 Ga0207707_10589459 Ga0207707_105894593 124
139 3300025972 Ga0207668_10016314 Ga0207668_100163144 124
140 3300026142 Ga0207698_10624213 Ga0207698_106242133 124
141 3300028380 Ga0268265_10033455 Ga0268265_100334554 124
142 3300037312 Ga0395899_0000223 Ga0395899_0000223_56400_56786 124
143 3300037312 Ga0395899_0238139 Ga0395899_0238139_570_956 124
144 3300037418 Ga0395900_0000008 Ga0395900_0000008_226874_227260 124
145 3300037418 Ga0395900_0573773 Ga0395900_0573773_351_737 124
146 3300037466 Ga0395898_0001908 Ga0395898_0001908_14064_14450 124
147 3300037466 Ga0395898_0165002 Ga0395898_0165002_20_406 124
148 3300037471 Ga0395905_0003700 Ga0395905_0003700_15679_16065 124
149 3300038443 Ga0395901_0000008 Ga0395901_0000008_253206_253592 124
150 3300038443 Ga0395901_0514020 Ga0395901_0514020_168_554 124
151 3300039437 Ga0436365_0562450 Ga0436365_0562450_122_508 124
152 3300039437 Ga0436365_1309689 Ga0436365_1309689_451_855 124
153 3300041410 Ga0439461_0138116 Ga0439461_0138116_49_423 124
154 3300041512 Ga0451853_3792778 Ga0451853_3792778_271_645 124
155 3300042004 Ga0439445_0074293 Ga0439445_0074293_553_927 124
156 3300042156 Ga0439446_0003421 Ga0439446_0003421_243_617 124
157 3300042436 Ga0439435_0040938 Ga0439435_0040938_821_1195 124
158 3300044684 Ga0466966_0504590 Ga0466966_0504590_63_437 124
159 3300046460 Ga0495638_0000908 Ga0495638_0000908_29364_29738 124
160 3300046460 Ga0495638_0011370 Ga0495638_0011370_616_990 124
161 3300046460 Ga0495638_0194365 Ga0495638_0194365_33_407 124
162 3300046460 Ga0495638_0650294 Ga0495638_0650294_33_476 124
163 3300046471 Ga0495650_0000030 Ga0495650_0000030_169634_170077 124
164 3300046506 Ga0495583_0000002 Ga0495583_0000002_204397_204771 124
165 3300046506 Ga0495583_0442607 Ga0495583_0442607_91_465 124
166 3300046507 Ga0495606_0002012 Ga0495606_0002012_22829_23203 124
167 3300046512 Ga0495610_0000046 Ga0495610_0000046_66394_66837 124
168 3300046513 Ga0495616_0000084 Ga0495616_0000084_55996_56370 124
169 3300046513 Ga0495616_0026371 Ga0495616_0026371_2620_3063 124
170 3300046519 Ga0495632_0008352 Ga0495632_0008352_3638_4012 124
171 3300046519 Ga0495632_0194168 Ga0495632_0194168_343_717 124
172 3300046520 Ga0495637_0012633 Ga0495637_0012633_973_1416 124
173 3300046522 Ga0495643_0038548 Ga0495643_0038548_1539_1982 124
174 3300046524 Ga0495648_0000176 Ga0495648_0000176_45069_45443 124
175 3300046524 Ga0495648_0079929 Ga0495648_0079929_286_660 124
176 3300046525 Ga0495663_0023096 Ga0495663_0023096_714_1157 124
177 3300046530 Ga0495654_0000065 Ga0495654_0000065_32795_33238 124
178 3300046542 Ga0495597_0032660 Ga0495597_0032660_865_1251 124
179 3300046616 Ga0495668_0012264 Ga0495668_0012264_1318_1692 124
180 3300046616 Ga0495668_0051759 Ga0495668_0051759_1674_2048 124
181 3300046616 Ga0495668_0084138 Ga0495668_0084138_642_1016 124
182 3300046616 Ga0495668_0168572 Ga0495668_0168572_179_553 124
183 3300046660 Ga0495625_0002981 Ga0495625_0002981_13525_13968 124
184 3300046660 Ga0495625_0292105 Ga0495625_0292105_468_842 124
185 3300046660 Ga0495625_0335344 Ga0495625_0335344_73_459 124
186 3300046660 Ga0495625_0628644 Ga0495625_0628644_73_459 124
187 3300046691 Ga0495670_0084701 Ga0495670_0084701_489_863 124
188 3300046692 Ga0495671_0456666 Ga0495671_0456666_40_414 124
189 3300046810 Ga0495660_0026325 Ga0495660_0026325_2291_2665 124
190 3300046810 Ga0495660_0050217 Ga0495660_0050217_723_1097 124
191 3300046810 Ga0495660_0196347 Ga0495660_0196347_489_863 124
192 3300047320 Ga0495672_0147038 Ga0495672_0147038_738_1181 124
193 3300047323 Ga0495683_0124072 Ga0495683_0124072_143_517 124
194 3300047446 Ga0495679_002490 Ga0495679_002490_8353_8811 124
195 3300047469 Ga0495673_0000593 Ga0495673_0000593_25590_25964 124
196 3300047469 Ga0495673_0001487 Ga0495673_0001487_3783_4157 124
197 3300047470 Ga0495681_0032305 Ga0495681_0032305_1872_2246 124
198 3300047470 Ga0495681_0165522 Ga0495681_0165522_132_506 124
199 3300047472 Ga0495686_0016890 Ga0495686_0016890_1396_1770 124
200 3300047472 Ga0495686_0145353 Ga0495686_0145353_702_1088 124
201 3300047472 Ga0495686_0484156 Ga0495686_0484156_28_402 124
202 3300048904 Ga0496101_0201496 Ga0496101_0201496_1043_1417 124
203 3300048910 Ga0496107_0000217 Ga0496107_0000217_530_904 124
204 3300048918 Ga0496115_0002036 Ga0496115_0002036_696_1070 124
205 3300048924 Ga0496121_0002188 Ga0496121_0002188_677_1051 124
206 3300048924 Ga0496121_0313175 Ga0496121_0313175_301_675 124
207 3300048927 Ga0496124_0396556 Ga0496124_0396556_495_899 124
208 3300048927 Ga0496124_0561747 Ga0496124_0561747_194_568 124
209 3300048928 Ga0496125_0068965 Ga0496125_0068965_330_734 124
210 3300048929 Ga0496126_0016053 Ga0496126_0016053_5634_6038 124
211 3300049459 Ga0495678_108263 Ga0495678_108263_144_518 124
212 3300049581 Ga0501047_0005754 Ga0501047_0005754_7211_7585 124
213 3300049582 Ga0501048_0385179 Ga0501048_0385179_281_655 124
214 3300049671 Ga0501238_003956 Ga0501238_003956_257_631 124
215 3300050493 nmdc:mga0k408_33350_c1 nmdc:mga0k408_33350_c1_1581_1967 124
216 3300050496 nmdc:mga07m45_163180_c1 nmdc:mga07m45_163180_c1_258_632 124
217 3300050496 nmdc:mga07m45_85189_c2 nmdc:mga07m45_85189_c2_119_505 124
218 3300053086 Ga0500578_0150824 Ga0500578_0150824_766_1140 124
219 3300053087 Ga0500643_084851 Ga0500643_084851_288_662 124
220 3300053088 Ga0500644_0000010 Ga0500644_0000010_3827_4201 124
221 3300053102 Ga0500554_030250 Ga0500554_030250_161_535 124
222 3300053104 Ga0500556_0000967 Ga0500556_0000967_3228_3671 124
223 3300053122 Ga0500608_000248 Ga0500608_000248_4356_4730 124
224 3300053122 Ga0500608_214520 Ga0500608_214520_123_536 124
225 3300053123 Ga0500614_004901 Ga0500614_004901_1862_2236 124
226 3300053125 Ga0500618_000234 Ga0500618_000234_10908_11282 124
227 3300053134 Ga0500658_0012524 Ga0500658_0012524_2671_3114 124
228 3300053136 Ga0500559_0004438 Ga0500559_0004438_4540_4914 124
229 3300053138 Ga0500564_006955 Ga0500564_006955_649_1023 124
230 3300053153 Ga0500616_0009187 Ga0500616_0009187_3532_3975 124
231 3300053156 Ga0500622_0042227 Ga0500622_0042227_1055_1429 124
232 3300053156 Ga0500622_0118206 Ga0500622_0118206_253_627 124
233 3300053158 Ga0500627_0045905 Ga0500627_0045905_1178_1552 124
234 3300053730 Ga0500645_000774 Ga0500645_000774_17637_18080 124
235 3300053730 Ga0500645_190586 Ga0500645_190586_81_524 124
236 3300053731 Ga0500609_003855 Ga0500609_003855_150_524 124

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ffz-assembly1.cif.gz_B tfiiia-tfiiic-brf1-tbp complex bound to 5s rrna gene 0.9235 34 77
1mkm-assembly1.cif.gz_B crystal structure of the thermotoga maritima iclr 0.9125 20 74
3bp8-assembly2.cif.gz_A crystal structure of mlc/eiib complex 0.9089 35 75
6za0-assembly1.cif.gz_A structure of the transcriptional repressor atu1419 (vanr) in complex with a fortuitous citrate from agrobacterium fabrum (p21212 space group) 0.9074 34 75
3f22-assembly1.cif.gz_B crystal structure of zalpha in complex with d(cgtacg) 0.8955 20 75
ID Description Score Start End Superfamily
af_Q60307_1009_1064_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.937 20 75 1.10.10.10
1mkmA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9113 20 73 1.10.10.10
3bp8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9089 35 75 1.10.10.10
af_Q60307_1009_1064_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9062 20 75 1.10.10.10
af_Q0JC96_780_864_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9033 34 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A176RVN1-F1-model_v4 HipA domain protein 0.9626 17 75 GO:0003700
AF-A0A2T6DY12-F1-model_v4 Transcriptional regulator 0.9598 3 104
AF-N0B8S7-F1-model_v4 HTH marR-type domain-containing protein 0.959 6 104
AF-A0A5B8N4C9-F1-model_v4 Transcriptional regulator 0.9417 5 105
AF-A0A3S0EB58-F1-model_v4 MarR family transcriptional regulator 0.9375 6 111

Feature Viewer

pLDDT pTM Quality
87.71 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map