F346674

General Info

Members Datasets Scaffolds Average Seq Length
234 155 179 323

Family's Representative Sequence

Representative Sequence 3300002738|JGI25154J39366_1002434|JGI25154J39366_10024346
Length 341
Sequence MSSALHSTAAGVLASIPSPPVSYFDLGPLRIHFYALCIIAGIIVAVLMTNHRLTKRGAEPWVVIDIAILAVPLAIIGARIFHVLTHPNFYFGEGKNTWNPFEPGSVWAIWEGGIAIFGALIGGAVGAYLGCRWTGIRFWTFADALAPGLLLAQAMGRFGNWFNHELFGLPTSLPWGLEIESTNSAFPPGLPEGTLFHPTFLYEVIWNGLGVLVLLWLGRKLFFQWGRLFAIYLIWYSAGRILWESIRIDPSEIILGLRSNVWAAIIGVVVGLVILVVQTRRHPGLEPSPYQPGRGRKDVDADVQSQDNPSDFVDVSEPPAEEVAAGATATSAAPSSGDGSR

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221553 Microbacterium sp. Root553 Isolate Unclassified
5 2643221566 Microbacterium sp. Root166 Isolate Unclassified
6 2643221575 Microbacterium sp. Root61 Isolate Unclassified
7 2643221597 Microbacterium sp. Root180 Isolate Unclassified
8 2643221630 Microbacterium sp. Root322 Isolate Unclassified
9 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
10 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
11 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
12 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
13 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
14 2773857759 Microbacterium sp. 1294 Isolate Unclassified
15 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
16 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
17 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
18 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
19 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
20 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
21 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
22 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
23 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
24 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
25 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
26 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
27 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
28 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
29 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
30 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
31 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
32 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
33 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
34 2919069694 Microbacterium sp. 1154 Isolate Unclassified
35 2919395869 Microbacterium resistens 2980 Isolate Unclassified
36 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
37 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
38 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
39 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
40 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
41 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
42 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
43 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
44 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
45 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
46 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
47 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
48 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
49 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
50 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
51 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
52 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
53 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
54 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
147 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
148 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
149 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
153 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
154 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
155 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.64
Metatranscriptomes 0.85
Isolates 23.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.85
Bulb 0
Endosphere 11.54
Nodule 0
Rhizoplane 12.39
Rhizosphere 41.88
Stem 0
Stem Tuber 0.43
Unclassified 32.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009208 3300001979 Bacteria 3880
2 JGI24740J21852_10014532 3300001979 Bacteria 2899
3 JGI25154J39366_1002434 3300002738 Bacteria 4839
4 Ga0006562J51391_1085532 3300003578 Bacteria 5820
5 Ga0006562J51391_1085535 3300003578 Bacteria 3850
6 Ga0065714_10073918 3300005288 Bacteria 3113
7 Ga0070658_10000104 3300005327 Bacteria 75381
8 Ga0070658_10050984 3300005327 Bacteria 3354
9 Ga0070660_100029447 3300005339 Bacteria 4115
10 Ga0070659_100017892 3300005366 Bacteria 5339
11 Ga0070665_100104686 3300005548 Bacteria 2832
12 Ga0068855_100059815 3300005563 Bacteria 4457
13 Ga0075365_10000801 3300006038 Bacteria 12900
14 Ga0075363_100073473 3300006048 Bacteria 1860
15 Ga0075364_10005899 3300006051 Bacteria 7156
16 Ga0075364_10009842 3300006051 Bacteria 5751
17 Ga0075364_10022231 3300006051 Bacteria 4003
18 Ga0075364_10027190 3300006051 Bacteria 3653
19 Ga0075364_10037903 3300006051 Bacteria 3123
20 Ga0075364_10117842 3300006051 Bacteria 1776
21 Ga0075367_10001632 3300006178 Bacteria 9750
22 Ga0075369_10007689 3300006186 Bacteria 4119
23 Ga0075369_10023116 3300006186 Bacteria 2568
24 Ga0075370_10054865 3300006353 Bacteria 2264
25 Ga0105244_10030120 3300009036 Bacteria 2890
26 Ga0105243_10059378 3300009148 Bacteria 3052
27 Ga0105248_10001838 3300009177 Bacteria 23503
28 Ga0105237_10020290 3300009545 Bacteria 6855
29 Ga0105246_10195685 3300011119 Bacteria 1568
30 Ga0157370_10079201 3300013104 Bacteria 3094
31 Ga0157370_10126529 3300013104 Bacteria 2385
32 Ga0157369_10001740 3300013105 Bacteria 26433
33 Ga0171462_1003 3300013250 Bacteria 853796
34 Ga0163162_10039824 3300013306 Bacteria 4696
35 Ga0157372_10005078 3300013307 Bacteria 13993
36 Ga0157372_10024667 3300013307 Bacteria 6535
37 Ga0157375_10456888 3300013308 Bacteria 1443
38 Ga0209646_1000099 3300025246 Bacteria 180436
39 Ga0207655_1004123 3300025728 Bacteria 10441
40 Ga0207705_10000001 3300025909 Bacteria 2061880
41 Ga0207671_10051805 3300025914 Bacteria 3041
42 Ga0207657_10082213 3300025919 Bacteria 2704
43 Ga0207690_10061895 3300025932 Bacteria 2546
44 Ga0207711_10000299 3300025941 Bacteria 53150
45 Ga0207667_10029862 3300025949 Bacteria 5905
46 Ga0207639_10045279 3300026041 Bacteria 3313
47 Ga0268266_10034152 3300028379 Bacteria 4325
48 Ga0307405_10261875 3300031731 Bacteria 1292
49 Ga0307413_10297048 3300031824 Bacteria 1223
50 Ga0307406_10000108 3300031901 Bacteria 48095
51 Ga0307406_10001738 3300031901 Bacteria 11937
52 Ga0307406_10033096 3300031901 Bacteria 3161
53 Ga0307406_10070429 3300031901 Bacteria 2290
54 Ga0307406_10144339 3300031901 Bacteria 1689
55 Ga0307416_100188467 3300032002 Bacteria 1942
56 Ga0307415_100107686 3300032126 Bacteria 2060
57 Ga0395898_0188264 3300037466 Bacteria 1972
58 Ga0395901_0040283 3300038443 Bacteria 4838
59 Ga0466961_0093195 3300044693 Bacteria 1901
60 Ga0466961_0101983 3300044693 Bacteria 1807
61 Ga0466971_0064733 3300044719 Bacteria 1655
62 Ga0466970_0000039 3300044765 Bacteria 47478
63 Ga0466970_0063486 3300044765 Bacteria 1980
64 Ga0466970_0218909 3300044765 Bacteria 1062
65 Ga0466957_0056098 3300044842 Bacteria 2408
66 Ga0466957_0400876 3300044842 Bacteria 938
67 Ga0466960_0022601 3300044901 Bacteria 2813
68 Ga0466959_0083369 3300045049 Bacteria 2302
69 Ga0466958_0079760 3300045836 Bacteria 2013
70 Ga0466967_0045997 3300045976 Bacteria 3797
71 Ga0495627_000357 3300046453 Bacteria 42749
72 Ga0495620_0039888 3300046515 Bacteria 2072
73 Ga0495686_0070987 3300047472 Bacteria 2145
74 Ga0496101_0004230 3300048904 Bacteria 9001
75 Ga0496101_0028607 3300048904 Bacteria 3892
76 Ga0496102_0034937 3300048905 Bacteria 4524
77 Ga0496103_0002535 3300048906 Bacteria 11448
78 Ga0496104_0049148 3300048907 Bacteria 3977
79 Ga0496105_0016923 3300048908 Bacteria 5834
80 Ga0496105_0021750 3300048908 Bacteria 5191
81 Ga0496105_0103223 3300048908 Bacteria 2354
82 Ga0496106_0091655 3300048909 Bacteria 2347
83 Ga0496107_0165566 3300048910 Bacteria 1639
84 Ga0496108_0065535 3300048911 Bacteria 3062
85 Ga0496108_0151494 3300048911 Bacteria 2001
86 Ga0496108_0400378 3300048911 Bacteria 1199
87 Ga0496108_0401750 3300048911 Bacteria 1197
88 Ga0496109_0054305 3300048912 Bacteria 3654
89 Ga0496109_0084521 3300048912 Bacteria 2928
90 Ga0496109_0111448 3300048912 Bacteria 2544
91 Ga0496110_0095491 3300048913 Bacteria 2663
92 Ga0496110_0258981 3300048913 Bacteria 1583
93 Ga0496111_0076221 3300048914 Bacteria 2444
94 Ga0496113_0053516 3300048916 Bacteria 3018
95 Ga0496113_0245925 3300048916 Bacteria 1427
96 Ga0496114_0017016 3300048917 Bacteria 5863
97 Ga0496114_0040017 3300048917 Bacteria 3879
98 Ga0496114_0073599 3300048917 Bacteria 2875
99 Ga0496114_0107627 3300048917 Bacteria 2386
100 Ga0496115_0179733 3300048918 Bacteria 1749
101 Ga0496115_0196399 3300048918 Bacteria 1667
102 Ga0496115_0266833 3300048918 Bacteria 1407
103 Ga0496117_0000468 3300048920 Bacteria 67418
104 Ga0496117_0000630 3300048920 Bacteria 57051
105 Ga0496117_0002894 3300048920 Bacteria 20783
106 Ga0496117_0031855 3300048920 Bacteria 4018
107 Ga0496117_0062513 3300048920 Bacteria 2551
108 Ga0496118_0004920 3300048921 Bacteria 15520
109 Ga0496118_0016495 3300048921 Bacteria 6774
110 Ga0496118_0025553 3300048921 Bacteria 5058
111 Ga0496119_0002046 3300048922 Bacteria 22830
112 Ga0496119_0002717 3300048922 Bacteria 19096
113 Ga0496119_0007500 3300048922 Bacteria 9805
114 Ga0496119_0008597 3300048922 Bacteria 8941
115 Ga0496120_0001568 3300048923 Bacteria 26755
116 Ga0496120_0001603 3300048923 Bacteria 26271
117 Ga0496120_0001799 3300048923 Bacteria 24071
118 Ga0496120_0112038 3300048923 Bacteria 1424
119 Ga0496122_0000054 3300048925 Bacteria 259135
120 Ga0496122_0000240 3300048925 Bacteria 123001
121 Ga0496122_0001200 3300048925 Bacteria 44223
122 Ga0496122_0001458 3300048925 Bacteria 38143
123 Ga0496122_0018355 3300048925 Bacteria 6472
124 Ga0496122_0021203 3300048925 Bacteria 5828
125 Ga0496123_0000039 3300048926 Bacteria 259107
126 Ga0496123_0000225 3300048926 Bacteria 115105
127 Ga0496123_0001124 3300048926 Bacteria 39914
128 Ga0496123_0003197 3300048926 Bacteria 18680
129 Ga0496124_0001567 3300048927 Bacteria 33061
130 Ga0496124_0002353 3300048927 Bacteria 24953
131 Ga0496124_0002402 3300048927 Bacteria 24604
132 Ga0496124_0096193 3300048927 Bacteria 2406
133 Ga0496125_0000061 3300048928 Bacteria 262739
134 Ga0496125_0003167 3300048928 Bacteria 20405
135 Ga0496125_0009923 3300048928 Bacteria 9679
136 Ga0496125_0010326 3300048928 Bacteria 9455
137 Ga0496125_0023789 3300048928 Bacteria 5647
138 Ga0496125_0039724 3300048928 Bacteria 4047
139 Ga0496125_0072987 3300048928 Bacteria 2671
140 Ga0496125_0097885 3300048928 Bacteria 2172
141 Ga0496126_0000998 3300048929 Bacteria 48229
142 Ga0496126_0022655 3300048929 Bacteria 6105
143 Ga0496126_0165564 3300048929 Bacteria 1887
144 Ga0501032_0001123 3300049569 Bacteria 21395
145 Ga0501033_0000262 3300049570 Bacteria 50390
146 Ga0501034_0004069 3300049571 Bacteria 16416
147 Ga0501034_0007434 3300049571 Bacteria 11660
148 Ga0501034_0014801 3300049571 Bacteria 8024
149 Ga0501034_0054299 3300049571 Bacteria 4034
150 Ga0501036_0017566 3300049572 Bacteria 5983
151 Ga0501037_0002799 3300049573 Bacteria 12640
152 Ga0501038_0002557 3300049574 Bacteria 16962
153 Ga0501038_0006758 3300049574 Bacteria 10595
154 Ga0501038_0059034 3300049574 Bacteria 3287
155 Ga0501038_0071404 3300049574 Bacteria 2945
156 Ga0501043_0007879 3300049579 Bacteria 8424
157 Ga0501043_0244961 3300049579 Bacteria 1382
158 Ga0501046_0000410 3300049580 Bacteria 42702
159 Ga0501047_0000344 3300049581 Bacteria 52888
160 Ga0501070_0083448 3300049586 Bacteria 2645
161 Ga0501035_0002127 3300049822 Bacteria 19704
162 Ga0501044_0000317 3300049823 Bacteria 60978
163 Ga0501045_0176905 3300049824 Bacteria 1589
164 nmdc:mga03n38_19130_c1 3300050490 Bacteria 2715
165 nmdc:mga00v17_150703_c1 3300050491 Bacteria 1494
166 nmdc:mga00v17_17644_c1 3300050491 Bacteria 4044
167 nmdc:mga00v17_33023_c1 3300050491 Bacteria 3063
168 nmdc:mga00v17_5267_c1 3300050491 Bacteria 6812
169 nmdc:mga0yw44_2733_c1 3300050492 Bacteria 7628
170 nmdc:mga07m45_47533_c1 3300050496 Bacteria 2413
171 nmdc:mga0sz30_20581_c1 3300050516 Bacteria 2662
172 nmdc:mga0sz30_43108_c1 3300050516 Bacteria 1899
173 Ga0500643_000082 3300053087 Bacteria 101189
174 Ga0500650_0006068 3300053098 Bacteria 4575
175 Ga0500573_0022023 3300053140 Bacteria 3656
176 Ga0500573_0199521 3300053140 Bacteria 1063
177 Ga0500577_0006055 3300053142 Bacteria 3305
178 Ga0500616_0002060 3300053153 Bacteria 17628
179 Ga0466962_0076164 3300061719 Bacteria 1603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053140 Ga0500573_0022023 Ga0500573_0022023_1405_2379 276
2 3300048922 Ga0496119_0002046 Ga0496119_0002046_3961_4965 277
3 3300048923 Ga0496120_0001799 Ga0496120_0001799_4534_5538 277
4 3300053140 Ga0500573_0199521 Ga0500573_0199521_59_1033 277
5 3300048929 Ga0496126_0165564 Ga0496126_0165564_582_1631 278
6 3300048917 Ga0496114_0017016 Ga0496114_0017016_2806_3717 280
7 3300048918 Ga0496115_0179733 Ga0496115_0179733_774_1685 280
8 3300032126 Ga0307415_100107686 Ga0307415_1001076861 282
9 3300031901 Ga0307406_10033096 Ga0307406_100330961 283
10 3300044765 Ga0466970_0000039 Ga0466970_0000039_7131_8147 283
11 3300044842 Ga0466957_0400876 Ga0466957_0400876_13_909 283
12 3300045976 Ga0466967_0045997 Ga0466967_0045997_1320_2336 283
13 3300048925 Ga0496122_0001200 Ga0496122_0001200_31569_32525 283
14 3300048926 Ga0496123_0001124 Ga0496123_0001124_10029_10985 283
15 iso_pu_bacteria 2747842429 2747952521 283
16 3300001979 JGI24740J21852_10014532 JGI24740J21852_100145322 284
17 3300031731 Ga0307405_10261875 Ga0307405_102618752 284
18 3300037466 Ga0395898_0188264 Ga0395898_0188264_171_1184 284
19 3300049571 Ga0501034_0014801 Ga0501034_0014801_4813_5757 285
20 3300049574 Ga0501038_0002557 Ga0501038_0002557_9241_10185 285
21 3300013307 Ga0157372_10024667 Ga0157372_100246677 286
22 3300047472 Ga0495686_0070987 Ga0495686_0070987_44_961 286
23 3300049574 Ga0501038_0071404 Ga0501038_0071404_1321_2292 286
24 3300049579 Ga0501043_0244961 Ga0501043_0244961_352_1323 286
25 3300048904 Ga0496101_0004230 Ga0496101_0004230_3687_4637 287
26 3300048905 Ga0496102_0034937 Ga0496102_0034937_1418_2368 287
27 3300048906 Ga0496103_0002535 Ga0496103_0002535_4785_5735 287
28 3300048908 Ga0496105_0016923 Ga0496105_0016923_985_1935 287
29 3300048911 Ga0496108_0400378 Ga0496108_0400378_55_966 287
30 3300048912 Ga0496109_0054305 Ga0496109_0054305_2305_3255 287
31 3300048916 Ga0496113_0053516 Ga0496113_0053516_552_1502 287
32 3300048917 Ga0496114_0073599 Ga0496114_0073599_17_967 287
33 3300048923 Ga0496120_0112038 Ga0496120_0112038_59_1009 287
34 3300026041 Ga0207639_10045279 Ga0207639_100452792 288
35 3300038443 Ga0395901_0040283 Ga0395901_0040283_1993_2985 288
36 3300048908 Ga0496105_0021750 Ga0496105_0021750_2341_3246 289
37 3300048911 Ga0496108_0151494 Ga0496108_0151494_392_1297 289
38 3300048912 Ga0496109_0084521 Ga0496109_0084521_1343_2248 289
39 3300048913 Ga0496110_0095491 Ga0496110_0095491_1329_2234 289
40 3300048916 Ga0496113_0245925 Ga0496113_0245925_309_1214 289
41 3300048918 Ga0496115_0196399 Ga0496115_0196399_471_1376 289
42 3300049571 Ga0501034_0054299 Ga0501034_0054299_2638_3579 289
43 3300013104 Ga0157370_10126529 Ga0157370_101265292 291
44 3300013306 Ga0163162_10039824 Ga0163162_100398242 291
45 3300048904 Ga0496101_0028607 Ga0496101_0028607_103_1083 291
46 3300048909 Ga0496106_0091655 Ga0496106_0091655_1095_2075 291
47 3300048910 Ga0496107_0165566 Ga0496107_0165566_637_1617 291
48 3300048911 Ga0496108_0065535 Ga0496108_0065535_793_1773 291
49 3300048912 Ga0496109_0111448 Ga0496109_0111448_122_1102 291
50 3300048913 Ga0496110_0258981 Ga0496110_0258981_502_1482 291
51 3300048914 Ga0496111_0076221 Ga0496111_0076221_1130_2110 291
52 3300048917 Ga0496114_0040017 Ga0496114_0040017_464_1444 291
53 3300048920 Ga0496117_0000468 Ga0496117_0000468_29205_30209 292
54 3300048922 Ga0496119_0007500 Ga0496119_0007500_6628_7632 292
55 3300048923 Ga0496120_0001603 Ga0496120_0001603_19109_20113 292
56 3300048925 Ga0496122_0001458 Ga0496122_0001458_32872_33876 292
57 3300048926 Ga0496123_0003197 Ga0496123_0003197_10094_11098 292
58 3300048927 Ga0496124_0001567 Ga0496124_0001567_12466_13470 292
59 3300048928 Ga0496125_0009923 Ga0496125_0009923_7630_8634 292
60 3300048929 Ga0496126_0022655 Ga0496126_0022655_880_1884 292
61 3300049569 Ga0501032_0001123 Ga0501032_0001123_18731_19654 292
62 3300049570 Ga0501033_0000262 Ga0501033_0000262_47355_48278 292
63 3300049571 Ga0501034_0004069 Ga0501034_0004069_7217_8140 292
64 3300049572 Ga0501036_0017566 Ga0501036_0017566_4871_5794 292
65 3300049573 Ga0501037_0002799 Ga0501037_0002799_5734_6657 292
66 3300049574 Ga0501038_0006758 Ga0501038_0006758_9172_10095 292
67 3300049579 Ga0501043_0007879 Ga0501043_0007879_3572_4495 292
68 3300049580 Ga0501046_0000410 Ga0501046_0000410_41457_42380 292
69 3300049581 Ga0501047_0000344 Ga0501047_0000344_41457_42380 292
70 3300049586 Ga0501070_0083448 Ga0501070_0083448_1650_2573 292
71 3300049822 Ga0501035_0002127 Ga0501035_0002127_8277_9200 292
72 3300049823 Ga0501044_0000317 Ga0501044_0000317_15992_16915 292
73 3300049824 Ga0501045_0176905 Ga0501045_0176905_366_1289 292
74 3300005327 Ga0070658_10000104 Ga0070658_1000010466 293
75 3300005327 Ga0070658_10050984 Ga0070658_100509842 293
76 3300005339 Ga0070660_100029447 Ga0070660_1000294474 293
77 3300005366 Ga0070659_100017892 Ga0070659_1000178922 293
78 3300005563 Ga0068855_100059815 Ga0068855_1000598151 293
79 3300013104 Ga0157370_10079201 Ga0157370_100792012 293
80 3300025909 Ga0207705_10000001 Ga0207705_100000011925 293
81 3300025919 Ga0207657_10082213 Ga0207657_100822133 293
82 3300025932 Ga0207690_10061895 Ga0207690_100618953 293
83 3300025949 Ga0207667_10029862 Ga0207667_100298622 293
84 3300048925 Ga0496122_0018355 Ga0496122_0018355_2112_3152 293
85 3300048927 Ga0496124_0096193 Ga0496124_0096193_540_1580 293
86 3300048928 Ga0496125_0023789 Ga0496125_0023789_4105_5145 293
87 3300053142 Ga0500577_0006055 Ga0500577_0006055_677_1690 293
88 3300053153 Ga0500616_0002060 Ga0500616_0002060_9262_10236 293
89 3300044765 Ga0466970_0218909 Ga0466970_0218909_31_942 294
90 iso_pu_bacteria 2939660829 2939661069 294
91 3300044765 Ga0466970_0063486 Ga0466970_0063486_481_1494 295
92 3300048911 Ga0496108_0401750 Ga0496108_0401750_178_1149 295
93 3300048921 Ga0496118_0004920 Ga0496118_0004920_9178_10185 295
94 3300048922 Ga0496119_0008597 Ga0496119_0008597_5183_6190 295
95 3300048923 Ga0496120_0001568 Ga0496120_0001568_4208_5215 295
96 3300048925 Ga0496122_0000054 Ga0496122_0000054_180672_181679 295
97 3300048926 Ga0496123_0000039 Ga0496123_0000039_180672_181679 295
98 3300048927 Ga0496124_0002402 Ga0496124_0002402_18842_19849 295
99 3300048928 Ga0496125_0003167 Ga0496125_0003167_11733_12740 295
100 3300049574 Ga0501038_0059034 Ga0501038_0059034_909_1907 295
101 iso_pu_bacteria 2946033335 2946033848 295
102 3300003578 Ga0006562J51391_1085532 Ga0006562J51391_10855322 296
103 3300003578 Ga0006562J51391_1085535 Ga0006562J51391_10855353 296
104 3300006051 Ga0075364_10027190 Ga0075364_100271902 296
105 3300006186 Ga0075369_10007689 Ga0075369_100076891 296
106 3300009148 Ga0105243_10059378 Ga0105243_100593782 296
107 3300013307 Ga0157372_10005078 Ga0157372_100050782 296
108 3300025728 Ga0207655_1004123 Ga0207655_10041232 296
109 3300050516 nmdc:mga0sz30_43108_c1 nmdc:mga0sz30_43108_c1_64_1014 296
110 iso_pu_bacteria 2585428157 2588108378 296
111 iso_pu_bacteria 2643221546 2643752016 296
112 iso_pu_bacteria 2808606306 2808631305 296
113 iso_pu_bacteria 2919395869 2919399019 296
114 3300005288 Ga0065714_10073918 Ga0065714_100739182 297
115 3300005548 Ga0070665_100104686 Ga0070665_1001046862 297
116 3300006038 Ga0075365_10000801 Ga0075365_100008019 297
117 3300006048 Ga0075363_100073473 Ga0075363_1000734732 297
118 3300006051 Ga0075364_10009842 Ga0075364_100098424 297
119 3300006051 Ga0075364_10022231 Ga0075364_100222313 297
120 3300006051 Ga0075364_10037903 Ga0075364_100379032 297
121 3300006178 Ga0075367_10001632 Ga0075367_100016323 297
122 3300006186 Ga0075369_10023116 Ga0075369_100231162 297
123 3300006353 Ga0075370_10054865 Ga0075370_100548652 297
124 3300009036 Ga0105244_10030120 Ga0105244_100301202 297
125 3300013250 Ga0171462_1003 Ga0171462_1003516 297
126 3300013308 Ga0157375_10456888 Ga0157375_104568882 297
127 3300028379 Ga0268266_10034152 Ga0268266_100341525 297
128 3300031824 Ga0307413_10297048 Ga0307413_102970482 297
129 3300031901 Ga0307406_10000108 Ga0307406_1000010846 297
130 3300031901 Ga0307406_10144339 Ga0307406_101443392 297
131 3300032002 Ga0307416_100188467 Ga0307416_1001884672 297
132 3300046515 Ga0495620_0039888 Ga0495620_0039888_848_1831 297
133 3300048907 Ga0496104_0049148 Ga0496104_0049148_274_1245 297
134 3300048908 Ga0496105_0103223 Ga0496105_0103223_15_986 297
135 3300048917 Ga0496114_0107627 Ga0496114_0107627_768_1739 297
136 3300048918 Ga0496115_0266833 Ga0496115_0266833_79_1095 297
137 3300048920 Ga0496117_0000630 Ga0496117_0000630_30085_31083 297
138 3300048920 Ga0496117_0062513 Ga0496117_0062513_741_1742 297
139 3300048921 Ga0496118_0025553 Ga0496118_0025553_3614_4612 297
140 3300048922 Ga0496119_0002717 Ga0496119_0002717_14416_15414 297
141 3300048925 Ga0496122_0000240 Ga0496122_0000240_27464_28462 297
142 3300048925 Ga0496122_0021203 Ga0496122_0021203_3425_4426 297
143 3300048926 Ga0496123_0000225 Ga0496123_0000225_80034_81032 297
144 3300048927 Ga0496124_0002353 Ga0496124_0002353_16651_17649 297
145 3300048928 Ga0496125_0072987 Ga0496125_0072987_1250_2248 297
146 3300048928 Ga0496125_0097885 Ga0496125_0097885_721_1722 297
147 3300050490 nmdc:mga03n38_19130_c1 nmdc:mga03n38_19130_c1_603_1586 297
148 3300050491 nmdc:mga00v17_17644_c1 nmdc:mga00v17_17644_c1_1314_2297 297
149 3300050491 nmdc:mga00v17_33023_c1 nmdc:mga00v17_33023_c1_1200_2168 297
150 3300050492 nmdc:mga0yw44_2733_c1 nmdc:mga0yw44_2733_c1_4252_5235 297
151 3300050496 nmdc:mga07m45_47533_c1 nmdc:mga07m45_47533_c1_744_1727 297
152 3300050516 nmdc:mga0sz30_20581_c1 nmdc:mga0sz30_20581_c1_773_1756 297
153 iso_pu_bacteria 2643221566 2643848404 297
154 iso_pu_bacteria 2643221575 2643885576 297
155 iso_pu_bacteria 2643221597 2643995866 297
156 iso_pu_bacteria 2757320536 2758226250 297
157 iso_pu_bacteria 2773857758 2774380619 297
158 iso_pu_bacteria 2773857759 2774384397 297
159 iso_pu_bacteria 2773857763 2774399652 297
160 iso_pu_bacteria 2808606368 2808885533 297
161 iso_pu_bacteria 2808606447 2809227392 297
162 iso_pu_bacteria 2811994872 2812322993 297
163 iso_pu_bacteria 2821268502 2821269896 297
164 iso_pu_bacteria 2833709550 2833710826 297
165 iso_pu_bacteria 2852632344 2852633230 297
166 iso_pu_bacteria 2857720070 2857720321 297
167 iso_pu_bacteria 2870628048 2870630240 297
168 iso_pu_bacteria 2904509784 2904512142 297
169 iso_pu_bacteria 2908678064 2908681050 297
170 iso_pu_bacteria 2919069694 2919072479 297
171 iso_pu_bacteria 2928090899 2928091842 297
172 iso_pu_bacteria 2974294766 2974297033 297
173 iso_pu_bacteria 2974324384 2974326733 297
174 iso_pu_bacteria 2977228692 2977231265 297
175 iso_pu_bacteria 2977236895 2977240046 297
176 iso_pu_bacteria 2977251589 2977254015 297
177 iso_pu_bacteria 2977264416 2977266490 297
178 iso_pu_bacteria 2984542743 2984545680 297
179 iso_pu_bacteria 2984580707 2984581396 297
180 iso_pu_bacteria 8016254467 8016257679 297
181 iso_pu_bacteria 8045830549 8045831465 297
182 3300044693 Ga0466961_0093195 Ga0466961_0093195_363_1286 298
183 3300048928 Ga0496125_0000061 Ga0496125_0000061_57984_58991 298
184 3300048928 Ga0496125_0039724 Ga0496125_0039724_2543_3571 298
185 3300050491 nmdc:mga00v17_150703_c1 nmdc:mga00v17_150703_c1_35_1063 298
186 3300053087 Ga0500643_000082 Ga0500643_000082_72030_73037 298
187 3300053098 Ga0500650_0006068 Ga0500650_0006068_2881_3897 298
188 iso_pu_bacteria 2870622029 2870623550 298
189 iso_pu_bacteria 2939657138 2939657987 298
190 3300002738 JGI25154J39366_1002434 JGI25154J39366_10024346 299
191 3300006051 Ga0075364_10005899 Ga0075364_100058999 299
192 3300006051 Ga0075364_10117842 Ga0075364_101178422 299
193 3300025246 Ga0209646_1000099 Ga0209646_100009966 299
194 3300031901 Ga0307406_10001738 Ga0307406_100017383 299
195 3300031901 Ga0307406_10070429 Ga0307406_100704292 299
196 3300044693 Ga0466961_0101983 Ga0466961_0101983_209_1216 299
197 3300044719 Ga0466971_0064733 Ga0466971_0064733_168_1175 299
198 3300044842 Ga0466957_0056098 Ga0466957_0056098_165_1172 299
199 3300044901 Ga0466960_0022601 Ga0466960_0022601_1499_2506 299
200 3300045049 Ga0466959_0083369 Ga0466959_0083369_700_1707 299
201 3300045836 Ga0466958_0079760 Ga0466958_0079760_414_1421 299
202 3300046453 Ga0495627_000357 Ga0495627_000357_11866_12891 299
203 3300048920 Ga0496117_0002894 Ga0496117_0002894_17869_18891 299
204 3300048921 Ga0496118_0016495 Ga0496118_0016495_2248_3270 299
205 3300048928 Ga0496125_0010326 Ga0496125_0010326_7676_8698 299
206 3300048929 Ga0496126_0000998 Ga0496126_0000998_32614_33636 299
207 3300049571 Ga0501034_0007434 Ga0501034_0007434_9112_10140 299
208 3300050491 nmdc:mga00v17_5267_c1 nmdc:mga00v17_5267_c1_4248_5273 299
209 3300061719 Ga0466962_0076164 Ga0466962_0076164_67_1074 299
210 iso_pu_bacteria 2643221542 2643733705 299
211 iso_pu_bacteria 2643221553 2643785735 299
212 iso_pu_bacteria 2643221630 2644170279 299
213 iso_pu_bacteria 2643221724 2644680147 299
214 iso_pu_bacteria 2728369380 2730229597 299
215 iso_pu_bacteria 2747842429 2747952810 299
216 iso_pu_bacteria 2844841374 2844843865 299
217 iso_pu_bacteria 2852646457 2852647237 299
218 iso_pu_bacteria 2852663356 2852665216 299
219 iso_pu_bacteria 2857723135 2857723745 299
220 iso_pu_bacteria 2884763398 2884766577 299
221 iso_pu_bacteria 2945968032 2945971703 299
222 iso_pu_bacteria 2946041624 2946044163 299
223 iso_pu_bacteria 2946080515 2946080993 299
224 iso_pu_bacteria 8004182704 8004185204 299
225 iso_pu_bacteria 8056037122 8056039805 300
226 3300009177 Ga0105248_10001838 Ga0105248_1000183821 301
227 3300009545 Ga0105237_10020290 Ga0105237_100202905 301
228 3300011119 Ga0105246_10195685 Ga0105246_101956851 301
229 3300025914 Ga0207671_10051805 Ga0207671_100518053 301
230 3300025941 Ga0207711_10000299 Ga0207711_1000029918 301
231 iso_pu_bacteria 2844852863 2844855926 302
232 3300001979 JGI24740J21852_10009208 JGI24740J21852_100092082 303
233 3300013105 Ga0157369_10001740 Ga0157369_1000174027 303
234 3300048920 Ga0496117_0031855 Ga0496117_0031855_2029_2940 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

21

277

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7549 4 270
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7126 4 270
8i4m-assembly1.cif.gz_H portal-tail complex structure of the cyanophage p-scsp1u 0.4144 209 295
7e4g-assembly1.cif.gz_C crystal structure of schizorhodopsin 4 0.3976 110 268
1qm8-assembly1.cif.gz_A structure of bacteriorhodopsin at 100 k 0.3484 109 269
ID Description Score Start End Superfamily
af_I1JQT2_65_214_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4993 124 264 1.20.140.40
af_Q3UNB8_35_188_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4402 185 271 1.20.140.150
af_A0A0R4ISQ3_248_358_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4157 194 291 1.20.58.390
af_I1JQT2_65_214_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4072 124 264 1.20.140.40
af_A0A0P0Y1V9_13_122_1.20.5.4130 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.4064 185 260 1.20.5.4130
ID Description Score Start End GO Terms
AF-C7Q7Q4-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9413 5 269 GO:0005886
GO:0008961
GO:0042158
AF-A0A1X1PV79-F1-model_v4 deleted 0.9411 5 161
AF-A0A6G8FIZ1-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9385 1 278 GO:0005886
GO:0008961
GO:0042158
AF-A0A7V9RQG8-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9374 5 164 GO:0005886
GO:0008961
GO:0042158
AF-A0A7X7JBI2-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.935 9 133 GO:0005886
GO:0008961
GO:0042158

Feature Viewer

pLDDT pTM Quality
85.43 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map